F446871

General Info

Members Datasets Scaffolds Average Seq Length
451 213 451 138

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0560402|Ga0501033_0560402_170_583
Length 137
Sequence MTPTPRSFELRSLTPVLIVDAVEPGLAFWTDRLGFTKENEVPGPDGTLVFASAKKGDVEVMYQTRASVIADGTPASELDGHSITLFITVPSVADLDAIEARVKGTPIVKPRHDTFYGATEFYVREPGGNVVGFAAFK

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
103 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
105 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
160 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
161 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
162 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
163 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
164 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
165 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
166 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
167 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
168 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
169 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
170 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
171 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
172 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
173 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
184 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
185 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
198 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
201 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
212 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
213 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.22
Nodule 0
Rhizoplane 1.33
Rhizosphere 96.01
Stem 0
Stem Tuber 0
Unclassified 2.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_3251030 2162886011 Bacteria 1567
2 Ga0065712_10121751 3300005290 Bacteria 1661
3 Ga0065712_10183929 3300005290 Bacteria 1179
4 Ga0065712_10204667 3300005290 Bacteria 1095
5 Ga0065715_10093526 3300005293 Unclassified 4652
6 Ga0065715_10160962 3300005293 Bacteria 1630
7 Ga0070676_10023665 3300005328 Bacteria 3453
8 Ga0070676_10216372 3300005328 Bacteria 1263
9 Ga0070683_100004042 3300005329 Bacteria 12014
10 Ga0070683_100058108 3300005329 Bacteria 3594
11 Ga0070690_100495675 3300005330 Bacteria 913
12 Ga0070690_101002092 3300005330 Bacteria 658
13 Ga0070690_101398583 3300005330 Bacteria 563
14 Ga0068869_100567764 3300005334 Bacteria 955
15 Ga0070666_10384018 3300005335 Unclassified 1008
16 Ga0070680_100038934 3300005336 Bacteria 3846
17 Ga0070680_100084214 3300005336 Unclassified 2626
18 Ga0070680_100361764 3300005336 Unclassified 1234
19 Ga0070680_100773022 3300005336 Bacteria 827
20 Ga0070680_101116354 3300005336 Unclassified 681
21 Ga0070682_100001389 3300005337 Bacteria 13646
22 Ga0070682_100003946 3300005337 Bacteria 8236
23 Ga0070682_100262355 3300005337 Bacteria 1251
24 Ga0070682_101445027 3300005337 Bacteria 589
25 Ga0068868_100113891 3300005338 Bacteria 2200
26 Ga0068868_100774318 3300005338 Unclassified 864
27 Ga0070660_100219566 3300005339 Unclassified 1545
28 Ga0070660_100262809 3300005339 Unclassified 1410
29 Ga0070660_100743775 3300005339 Bacteria 823
30 Ga0070689_100291365 3300005340 Unclassified 1356
31 Ga0070691_10046119 3300005341 Bacteria 2069
32 Ga0070691_10172029 3300005341 Unclassified 1123
33 Ga0070687_100036163 3300005343 Bacteria 2458
34 Ga0070687_100088734 3300005343 Bacteria 1705
35 Ga0070661_100010103 3300005344 Bacteria 6556
36 Ga0070661_100228081 3300005344 Bacteria 1431
37 Ga0070692_10240716 3300005345 Unclassified 1078
38 Ga0070669_100048184 3300005353 Bacteria 3110
39 Ga0070675_100000029 3300005354 Bacteria 102686
40 Ga0070675_101266573 3300005354 Bacteria 679
41 Ga0070671_100443073 3300005355 Bacteria 1114
42 Ga0070674_100365026 3300005356 Bacteria 1170
43 Ga0070673_100009117 3300005364 Bacteria 6645
44 Ga0070673_100422129 3300005364 Bacteria 1196
45 Ga0070673_100577876 3300005364 Unclassified 1023
46 Ga0070659_100101054 3300005366 Bacteria 2321
47 Ga0070659_101214042 3300005366 Unclassified 667
48 Ga0070667_100000040 3300005367 Bacteria 170222
49 Ga0070667_100116200 3300005367 Bacteria 2324
50 Ga0070667_100510915 3300005367 Unclassified 1102
51 Ga0070709_10012888 3300005434 Bacteria 4685
52 Ga0070709_10683670 3300005434 Unclassified 797
53 Ga0070714_100015991 3300005435 Bacteria 6049
54 Ga0070710_10005596 3300005437 Bacteria 5983
55 Ga0070701_10077313 3300005438 Bacteria 1793
56 Ga0070705_100216863 3300005440 Bacteria 1322
57 Ga0070700_100356191 3300005441 Bacteria 1086
58 Ga0070694_100037340 3300005444 Bacteria 3222
59 Ga0070708_100001445 3300005445 Bacteria 18129
60 Ga0070708_100003138 3300005445 Bacteria 12870
61 Ga0070708_100107159 3300005445 Bacteria 2565
62 Ga0070708_100205326 3300005445 Bacteria 1846
63 Ga0070663_100000031 3300005455 Bacteria 74126
64 Ga0070678_100745180 3300005456 Bacteria 886
65 Ga0070662_100005351 3300005457 Bacteria 8202
66 Ga0070662_100154174 3300005457 Bacteria 1792
67 Ga0070662_100652524 3300005457 Unclassified 888
68 Ga0070681_10000409 3300005458 Bacteria 34934
69 Ga0070681_10012229 3300005458 Bacteria 8508
70 Ga0070681_10030436 3300005458 Bacteria 5415
71 Ga0070681_10046938 3300005458 Bacteria 4318
72 Ga0070681_10054795 3300005458 Unclassified 3973
73 Ga0070681_10151458 3300005458 Bacteria 2245
74 Ga0070681_10178525 3300005458 Unclassified 2045
75 Ga0068867_100028688 3300005459 Bacteria 4007
76 Ga0068867_100043431 3300005459 Unclassified 3291
77 Ga0068867_100061007 3300005459 Bacteria 2799
78 Ga0068867_100693155 3300005459 Unclassified 898
79 Ga0070706_100117029 3300005467 Bacteria 2483
80 Ga0070706_100130102 3300005467 Bacteria 2349
81 Ga0070707_100010321 3300005468 Bacteria 8694
82 Ga0070707_100075635 3300005468 Bacteria 3248
83 Ga0070707_100198095 3300005468 Bacteria 1958
84 Ga0070698_100020643 3300005471 Bacteria 6907
85 Ga0070699_100547243 3300005518 Unclassified 1053
86 Ga0070699_100695741 3300005518 Unclassified 929
87 Ga0070679_100004585 3300005530 Bacteria 12752
88 Ga0070679_100026477 3300005530 Bacteria 5698
89 Ga0070679_100057869 3300005530 Bacteria 3863
90 Ga0070679_100134951 3300005530 Bacteria 2449
91 Ga0070679_100292596 3300005530 Bacteria 1580
92 Ga0070679_100326568 3300005530 Bacteria 1483
93 Ga0070679_100478624 3300005530 Bacteria 1189
94 Ga0070679_100528400 3300005530 Bacteria 1124
95 Ga0070679_100667078 3300005530 Bacteria 983
96 Ga0070684_100001569 3300005535 Bacteria 16503
97 Ga0070684_100060033 3300005535 Bacteria 3325
98 Ga0070684_100220701 3300005535 Bacteria 1730
99 Ga0070684_100624914 3300005535 Bacteria 1002
100 Ga0070684_100714159 3300005535 Bacteria 935
101 Ga0070684_100759750 3300005535 Unclassified 905
102 Ga0070697_100079176 3300005536 Bacteria 2705
103 Ga0070697_100265233 3300005536 Unclassified 1471
104 Ga0070697_100305260 3300005536 Bacteria 1368
105 Ga0070697_100343613 3300005536 Bacteria 1288
106 Ga0070697_101829626 3300005536 Unclassified 543
107 Ga0068853_100004928 3300005539 Bacteria 10393
108 Ga0068853_100176370 3300005539 Bacteria 1936
109 Ga0068853_101062058 3300005539 Bacteria 780
110 Ga0070672_100007932 3300005543 Bacteria 7252
111 Ga0070686_100098633 3300005544 Unclassified 1969
112 Ga0070686_100188248 3300005544 Bacteria 1471
113 Ga0070686_100525899 3300005544 Bacteria 922
114 Ga0070695_100001915 3300005545 Bacteria 11778
115 Ga0070695_100025027 3300005545 Bacteria 3682
116 Ga0070695_100030103 3300005545 Bacteria 3378
117 Ga0070695_100153953 3300005545 Bacteria 1607
118 Ga0070695_100409479 3300005545 Unclassified 1030
119 Ga0070696_100315419 3300005546 Unclassified 1202
120 Ga0070696_100836146 3300005546 Bacteria 760
121 Ga0070693_100001273 3300005547 Bacteria 11395
122 Ga0070693_100141019 3300005547 Bacteria 1517
123 Ga0070693_100434234 3300005547 Unclassified 918
124 Ga0070693_100462742 3300005547 Unclassified 892
125 Ga0070693_100821635 3300005547 Unclassified 690
126 Ga0070693_101377337 3300005547 Unclassified 548
127 Ga0070704_100319108 3300005549 Unclassified 1301
128 Ga0070704_101861994 3300005549 Unclassified 557
129 Ga0068855_100005903 3300005563 Bacteria 14931
130 Ga0068855_100017429 3300005563 Bacteria 8639
131 Ga0068855_100141020 3300005563 Bacteria 2747
132 Ga0070664_100001516 3300005564 Bacteria 18524
133 Ga0070664_101740912 3300005564 Unclassified 591
134 Ga0068857_100010759 3300005577 Bacteria 7963
135 Ga0068854_100171933 3300005578 Bacteria 1686
136 Ga0068854_100719594 3300005578 Unclassified 863
137 Ga0068854_100725598 3300005578 Unclassified 860
138 Ga0068856_100109675 3300005614 Bacteria 2756
139 Ga0068856_100154602 3300005614 Bacteria 2304
140 Ga0068856_100252610 3300005614 Bacteria 1778
141 Ga0068856_100310740 3300005614 Bacteria 1594
142 Ga0068856_100551149 3300005614 Unclassified 1174
143 Ga0070702_100074408 3300005615 Bacteria 2015
144 Ga0070702_100183636 3300005615 Bacteria 1371
145 Ga0068852_100122257 3300005616 Bacteria 2386
146 Ga0068852_100918451 3300005616 Unclassified 893
147 Ga0068852_101299149 3300005616 Unclassified 749
148 Ga0068852_101323925 3300005616 Unclassified 742
149 Ga0068852_101970845 3300005616 Unclassified 606
150 Ga0068859_100074087 3300005617 Bacteria 3443
151 Ga0068864_100477668 3300005618 Bacteria 1196
152 Ga0068866_10060308 3300005718 Bacteria 1966
153 Ga0068861_100128020 3300005719 Unclassified 2057
154 Ga0068861_101344770 3300005719 Unclassified 696
155 Ga0068863_100290454 3300005841 Unclassified 1585
156 Ga0068858_100278121 3300005842 Bacteria 1594
157 Ga0068858_100386639 3300005842 Bacteria 1343
158 Ga0068858_100608224 3300005842 Bacteria 1061
159 Ga0068860_100610651 3300005843 Bacteria 1097
160 Ga0068862_100234207 3300005844 Bacteria 1667
161 Ga0081455_10240573 3300005937 Bacteria 1330
162 Ga0070716_100033001 3300006173 Bacteria 2828
163 Ga0070716_100182300 3300006173 Unclassified 1380
164 Ga0068871_100868859 3300006358 Bacteria 835
165 Ga0075428_100825148 3300006844 Bacteria 985
166 Ga0075433_10016451 3300006852 Bacteria 6098
167 Ga0075433_10394662 3300006852 Unclassified 1221
168 Ga0075434_100052491 3300006871 Bacteria 4051
169 Ga0075434_100083234 3300006871 Bacteria 3197
170 Ga0068865_100045437 3300006881 Unclassified 3011
171 Ga0075436_100060180 3300006914 Bacteria 2623
172 Ga0075436_100089739 3300006914 Bacteria 2136
173 Ga0075436_100803196 3300006914 Bacteria 701
174 Ga0075436_100957344 3300006914 Unclassified 642
175 Ga0097620_100074086 3300006931 Bacteria 3443
176 Ga0075435_100041866 3300007076 Bacteria 3662
177 Ga0075435_100496439 3300007076 Unclassified 1055
178 Ga0099795_10024061 3300007788 Viruses 2027
179 Ga0099795_10040366 3300007788 Bacteria 1657
180 Ga0105240_10041532 3300009093 Bacteria 5870
181 Ga0105240_10191212 3300009093 Bacteria 2407
182 Ga0105240_10575312 3300009093 Bacteria 1243
183 Ga0105240_11164903 3300009093 Unclassified 818
184 Ga0105240_11995775 3300009093 Unclassified 603
185 Ga0105245_10006776 3300009098 Bacteria 10043
186 Ga0105245_10012231 3300009098 Bacteria 7467
187 Ga0105245_10061039 3300009098 Unclassified 3397
188 Ga0105245_10113464 3300009098 Bacteria 2523
189 Ga0105245_10233760 3300009098 Bacteria 1779
190 Ga0114129_10071962 3300009147 Bacteria 4820
191 Ga0114129_10144743 3300009147 Bacteria 3256
192 Ga0105243_10218764 3300009148 Bacteria 1682
193 Ga0105241_10622300 3300009174 Unclassified 977
194 Ga0105242_10004781 3300009176 Bacteria 10477
195 Ga0105242_10079654 3300009176 Unclassified 2736
196 Ga0105242_10934951 3300009176 Bacteria 870
197 Ga0105242_11128896 3300009176 Unclassified 799
198 Ga0105242_12220737 3300009176 Unclassified 594
199 Ga0105248_10000289 3300009177 Bacteria 59500
200 Ga0105248_10063145 3300009177 Bacteria 4157
201 Ga0105248_10525369 3300009177 Bacteria 1335
202 Ga0105248_10698277 3300009177 Bacteria 1145
203 Ga0105248_11483051 3300009177 Bacteria 768
204 Ga0105248_12689305 3300009177 Unclassified 567
205 Ga0105237_10000291 3300009545 Bacteria 69396
206 Ga0105237_10029124 3300009545 Bacteria 5617
207 Ga0105238_10017420 3300009551 Bacteria 7301
208 Ga0105238_10099879 3300009551 Bacteria 2885
209 Ga0105249_10000338 3300009553 Bacteria 47285
210 Ga0105249_10480431 3300009553 Bacteria 1285
211 Ga0105249_11204759 3300009553 Bacteria 828
212 Ga0099796_10029192 3300010159 Unclassified 1777
213 Ga0105239_10182759 3300010375 Bacteria 2346
214 Ga0105239_10344125 3300010375 Bacteria 1683
215 Ga0105239_10645596 3300010375 Bacteria 1209
216 Ga0105239_11008127 3300010375 Unclassified 957
217 Ga0105239_12814337 3300010375 Unclassified 568
218 Ga0157373_10189438 3300013100 Bacteria 1450
219 Ga0157373_10335397 3300013100 Unclassified 1077
220 Ga0157370_10125415 3300013104 Unclassified 2397
221 Ga0157370_10172311 3300013104 Bacteria 2011
222 Ga0157369_10066763 3300013105 Unclassified 3869
223 Ga0157369_10097532 3300013105 Unclassified 3136
224 Ga0157369_10346806 3300013105 Unclassified 1542
225 Ga0157369_10400893 3300013105 Bacteria 1423
226 Ga0157369_10429814 3300013105 Bacteria 1369
227 Ga0157374_10459377 3300013296 Bacteria 1275
228 Ga0157374_10628165 3300013296 Unclassified 1085
229 Ga0157378_10003158 3300013297 Bacteria 14648
230 Ga0157378_10003743 3300013297 Bacteria 13481
231 Ga0157378_10023134 3300013297 Bacteria 5469
232 Ga0157378_10581752 3300013297 Bacteria 1129
233 Ga0157378_11628231 3300013297 Unclassified 692
234 Ga0163162_10335766 3300013306 Bacteria 1644
235 Ga0157372_10010522 3300013307 Bacteria 9845
236 Ga0157372_10011795 3300013307 Bacteria 9309
237 Ga0157372_10031822 3300013307 Bacteria 5780
238 Ga0157372_10088364 3300013307 Bacteria 3519
239 Ga0157372_10305087 3300013307 Bacteria 1852
240 Ga0157372_10359056 3300013307 Bacteria 1698
241 Ga0157372_10386581 3300013307 Unclassified 1630
242 Ga0157372_10449570 3300013307 Bacteria 1502
243 Ga0157375_10011474 3300013308 Bacteria 7827
244 Ga0157375_11909358 3300013308 Bacteria 705
245 Ga0163163_10524323 3300014325 Bacteria 1247
246 Ga0157380_10739945 3300014326 Bacteria 993
247 Ga0157377_10009597 3300014745 Bacteria 4757
248 Ga0157379_10896052 3300014968 Bacteria 841
249 Ga0182005_1201290 3300015265 Unclassified 599
250 Ga0206353_10883918 3300020082 Unclassified 674
251 Ga0213876_10292275 3300021384 Unclassified 866
252 Ga0213875_10054917 3300021388 Bacteria 1865
253 Ga0207642_10009574 3300025899 Bacteria 3378
254 Ga0207642_10050432 3300025899 Unclassified 1877
255 Ga0207688_10130384 3300025901 Bacteria 1474
256 Ga0207680_10619276 3300025903 Unclassified 774
257 Ga0207699_10016735 3300025906 Bacteria 3843
258 Ga0207699_10123055 3300025906 Bacteria 1681
259 Ga0207645_10006576 3300025907 Bacteria 8318
260 Ga0207645_10047587 3300025907 Bacteria 2738
261 Ga0207645_10579857 3300025907 Unclassified 761
262 Ga0207654_10220257 3300025911 Unclassified 1258
263 Ga0207707_10001728 3300025912 Bacteria 20055
264 Ga0207707_10032943 3300025912 Bacteria 4536
265 Ga0207707_10041066 3300025912 Bacteria 4039
266 Ga0207707_10047936 3300025912 Bacteria 3722
267 Ga0207707_10148893 3300025912 Unclassified 2047
268 Ga0207707_10256194 3300025912 Bacteria 1519
269 Ga0207707_10311286 3300025912 Unclassified 1360
270 Ga0207707_10398419 3300025912 Bacteria 1182
271 Ga0207695_10058625 3300025913 Unclassified 3996
272 Ga0207695_10079782 3300025913 Bacteria 3316
273 Ga0207695_10124331 3300025913 Unclassified 2544
274 Ga0207695_10459440 3300025913 Bacteria 1156
275 Ga0207671_10007691 3300025914 Bacteria 9304
276 Ga0207693_10958018 3300025915 Unclassified 655
277 Ga0207660_10039271 3300025917 Bacteria 3308
278 Ga0207660_10107777 3300025917 Bacteria 2091
279 Ga0207660_10116985 3300025917 Bacteria 2014
280 Ga0207660_10479924 3300025917 Bacteria 1007
281 Ga0207660_11336568 3300025917 Unclassified 581
282 Ga0207662_10022599 3300025918 Bacteria 3607
283 Ga0207662_10370807 3300025918 Unclassified 965
284 Ga0207657_10258139 3300025919 Unclassified 1387
285 Ga0207657_11229156 3300025919 Archaea 568
286 Ga0207649_10005395 3300025920 Bacteria 6923
287 Ga0207649_11210840 3300025920 Unclassified 597
288 Ga0207652_10003387 3300025921 Bacteria 13172
289 Ga0207652_10026050 3300025921 Unclassified 4867
290 Ga0207652_10088318 3300025921 Unclassified 2720
291 Ga0207652_10094414 3300025921 Unclassified 2634
292 Ga0207652_10109416 3300025921 Bacteria 2450
293 Ga0207652_10112426 3300025921 Bacteria 2417
294 Ga0207652_10198263 3300025921 Bacteria 1807
295 Ga0207652_10350438 3300025921 Bacteria 1332
296 Ga0207652_10389404 3300025921 Bacteria 1258
297 Ga0207652_10428568 3300025921 Bacteria 1193
298 Ga0207646_10010691 3300025922 Bacteria 8934
299 Ga0207646_11168960 3300025922 Bacteria 675
300 Ga0207681_10018228 3300025923 Bacteria 4422
301 Ga0207681_10569899 3300025923 Unclassified 933
302 Ga0207694_10272098 3300025924 Bacteria 1389
303 Ga0207659_10000073 3300025926 Bacteria 64021
304 Ga0207687_10143860 3300025927 Bacteria 1812
305 Ga0207687_10207671 3300025927 Bacteria 1535
306 Ga0207687_10290527 3300025927 Bacteria 1314
307 Ga0207687_10371387 3300025927 Unclassified 1170
308 Ga0207687_10612866 3300025927 Unclassified 918
309 Ga0207687_10614915 3300025927 Bacteria 917
310 Ga0207664_10058879 3300025929 Bacteria 3058
311 Ga0207690_11070277 3300025932 Unclassified 672
312 Ga0207706_10010967 3300025933 Bacteria 8263
313 Ga0207706_10028481 3300025933 Bacteria 4989
314 Ga0207706_10225385 3300025933 Bacteria 1641
315 Ga0207686_10048041 3300025934 Bacteria 2641
316 Ga0207686_10099666 3300025934 Bacteria 1937
317 Ga0207686_11629297 3300025934 Unclassified 533
318 Ga0207670_11246264 3300025936 Bacteria 630
319 Ga0207669_10088030 3300025937 Unclassified 2013
320 Ga0207704_10242602 3300025938 Bacteria 1347
321 Ga0207704_10953606 3300025938 Unclassified 724
322 Ga0207665_10003227 3300025939 Bacteria 10922
323 Ga0207665_10314231 3300025939 Unclassified 1174
324 Ga0207691_10184147 3300025940 Bacteria 1824
325 Ga0207711_10000265 3300025941 Bacteria 56633
326 Ga0207711_10022698 3300025941 Bacteria 5249
327 Ga0207711_10324800 3300025941 Unclassified 1422
328 Ga0207711_11837787 3300025941 Bacteria 549
329 Ga0207661_10013579 3300025944 Bacteria 5947
330 Ga0207661_10031420 3300025944 Bacteria 4102
331 Ga0207661_10974938 3300025944 Bacteria 781
332 Ga0207679_10008403 3300025945 Bacteria 6577
333 Ga0207679_10375012 3300025945 Bacteria 1246
334 Ga0207679_10853924 3300025945 Unclassified 831
335 Ga0207667_10008749 3300025949 Bacteria 12001
336 Ga0207667_10160528 3300025949 Unclassified 2312
337 Ga0207667_10362382 3300025949 Unclassified 1478
338 Ga0207651_10030057 3300025960 Bacteria 3453
339 Ga0207651_10373377 3300025960 Bacteria 1207
340 Ga0207651_11322939 3300025960 Unclassified 648
341 Ga0207712_10000872 3300025961 Bacteria 21924
342 Ga0207712_10084886 3300025961 Bacteria 2315
343 Ga0207712_10779039 3300025961 Bacteria 840
344 Ga0207712_11611061 3300025961 Unclassified 582
345 Ga0207640_10425011 3300025981 Unclassified 1088
346 Ga0207640_10746773 3300025981 Bacteria 843
347 Ga0207640_11019329 3300025981 Unclassified 729
348 Ga0207658_10000020 3300025986 Bacteria 202984
349 Ga0207658_10350923 3300025986 Unclassified 1285
350 Ga0207677_10017594 3300026023 Bacteria 4267
351 Ga0207677_10096118 3300026023 Bacteria 2167
352 Ga0207703_10601074 3300026035 Bacteria 1040
353 Ga0207639_10004713 3300026041 Bacteria 9182
354 Ga0207639_10903594 3300026041 Unclassified 825
355 Ga0207639_11145417 3300026041 Bacteria 730
356 Ga0207678_10000010 3300026067 Bacteria 149258
357 Ga0207708_10001320 3300026075 Bacteria 18634
358 Ga0207702_10027227 3300026078 Bacteria 4748
359 Ga0207702_10228322 3300026078 Bacteria 1738
360 Ga0207702_10348847 3300026078 Unclassified 1416
361 Ga0207702_11535329 3300026078 Unclassified 659
362 Ga0207641_10273520 3300026088 Unclassified 1586
363 Ga0207641_11704523 3300026088 Unclassified 632
364 Ga0207648_10023071 3300026089 Bacteria 5581
365 Ga0207648_10064453 3300026089 Bacteria 3194
366 Ga0207648_10117882 3300026089 Unclassified 2333
367 Ga0207648_10276499 3300026089 Unclassified 1501
368 Ga0207676_11147981 3300026095 Bacteria 769
369 Ga0207674_10001487 3300026116 Bacteria 30252
370 Ga0207675_100051308 3300026118 Bacteria 3848
371 Ga0207675_100480638 3300026118 Unclassified 1235
372 Ga0207675_101125080 3300026118 Unclassified 805
373 Ga0207698_10010863 3300026142 Bacteria 5877
374 Ga0207698_10403904 3300026142 Bacteria 1306
375 Ga0207698_10416273 3300026142 Bacteria 1288
376 Ga0207698_10643612 3300026142 Bacteria 1049
377 Ga0209967_1001389 3300027364 Bacteria 3102
378 Ga0210000_1007053 3300027462 Unclassified 1641
379 Ga0209968_1015667 3300027526 Unclassified 1201
380 Ga0209970_1090548 3300027614 Unclassified 580
381 Ga0209966_1133016 3300027695 Unclassified 575
382 Ga0373948_0023358 3300034817 Bacteria 1199
383 Ga0373950_0036262 3300034818 Bacteria 930
384 Ga0373958_0000572 3300034819 Bacteria 4574
385 Ga0373959_0003689 3300034820 Unclassified 2452
386 Ga0373938_0000235 3300034957 Bacteria 8644
387 Ga0373928_0004433 3300035084 Bacteria 2673
388 Ga0373929_0002931 3300035085 Bacteria 3111
389 Ga0373940_0000853 3300035088 Bacteria 5110
390 Ga0373949_0015234 3300035090 Bacteria 1715
391 Ga0373951_0004979 3300035091 Bacteria 3113
392 Ga0373951_0043530 3300035091 Bacteria 1089
393 Ga0373952_0010527 3300035092 Bacteria 1789
394 Ga0373932_0012470 3300035112 Bacteria 2093
395 Ga0373960_0021302 3300035121 Bacteria 1722
396 Ga0373960_0122133 3300035121 Unclassified 865
397 Ga0373942_0001335 3300035207 Bacteria 6401
398 Ga0373942_0297768 3300035207 Unclassified 559
399 Ga0373961_0024157 3300035241 Bacteria 1642
400 Ga0373962_0001684 3300035242 Bacteria 5254
401 Ga0373931_0008621 3300035691 Bacteria 4844
402 Ga0373931_0039636 3300035691 Bacteria 2468
403 Ga0373931_0118723 3300035691 Bacteria 1509
404 Ga0373931_0913931 3300035691 Unclassified 590
405 Ga0373927_0009495 3300035695 Bacteria 6523
406 Ga0373937_0744210 3300036401 Unclassified 928
407 Ga0436364_0290793 3300037853 Bacteria 1267
408 Ga0436365_0931492 3300039437 Bacteria 11326
409 Ga0436365_1061046 3300039437 Bacteria 927
410 Ga0451576_0061516 3300045051 Bacteria 3915
411 Ga0451576_0670278 3300045051 Bacteria 1090
412 Ga0495629_0006086 3300046459 Bacteria 8965
413 Ga0495580_0013960 3300046472 Bacteria 6111
414 Ga0495582_0162867 3300046473 Bacteria 1269
415 Ga0495582_0278020 3300046473 Bacteria 961
416 Ga0495594_0026579 3300046499 Bacteria 3115
417 Ga0495594_0233464 3300046499 Unclassified 1048
418 Ga0495665_0246234 3300046531 Bacteria 921
419 Ga0495587_0665226 3300046536 Bacteria 572
420 Ga0495645_0823815 3300046543 Unclassified 555
421 Ga0495588_0453935 3300046674 Unclassified 672
422 Ga0495658_0555238 3300046683 Bacteria 735
423 Ga0495669_0404318 3300046684 Bacteria 662
424 Ga0495581_0384302 3300047315 Bacteria 819
425 Ga0496106_0901768 3300048909 Bacteria 698
426 Ga0496109_0418053 3300048912 Unclassified 1267
427 Ga0496112_0005755 3300048915 Bacteria 10779
428 Ga0496112_0067381 3300048915 Unclassified 3533
429 Ga0496112_0189703 3300048915 Bacteria 2018
430 Ga0496113_1505584 3300048916 Bacteria 519
431 Ga0496117_0180362 3300048920 Bacteria 1214
432 Ga0496118_0218348 3300048921 Bacteria 1112
433 Ga0496121_0147390 3300048924 Bacteria 1737
434 Ga0496122_0000037 3300048925 Bacteria 304495
435 Ga0496123_0000083 3300048926 Bacteria 188730
436 Ga0496126_0611700 3300048929 Bacteria 857
437 Ga0501033_0560402 3300049570 Bacteria 786
438 Ga0501042_0649606 3300049578 Bacteria 767
439 Ga0501043_0769176 3300049579 Bacteria 699
440 Ga0501046_0659635 3300049580 Bacteria 739
441 Ga0501047_0504779 3300049581 Unclassified 1036
442 Ga0501048_0899981 3300049582 Bacteria 636
443 Ga0501073_0647736 3300049589 Bacteria 729
444 Ga0501044_0818500 3300049823 Unclassified 810
445 nmdc:mga0rr50_1093618_c1 3300050513 Unclassified 678
446 nmdc:mga0rr50_11226_c1 3300050513 Bacteria 5721
447 nmdc:mga08x19_114444_c1 3300050514 Unclassified 1802
448 nmdc:mga08x19_386303_c1 3300050514 Bacteria 981
449 nmdc:mga08x19_403464_c1 3300050514 Bacteria 959
450 nmdc:mga08x19_52917_c1 3300050514 Bacteria 2612
451 Ga0500652_177736 3300053131 Bacteria 873

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046674 Ga0495588_0453935 Ga0495588_0453935_11_397 125
2 3300005471 Ga0070698_100020643 Ga0070698_1000206435 127
3 3300005546 Ga0070696_100836146 Ga0070696_1008361462 127
4 3300006844 Ga0075428_100825148 Ga0075428_1008251482 127
5 3300009147 Ga0114129_10144743 Ga0114129_101447432 127
6 3300005339 Ga0070660_100743775 Ga0070660_1007437751 128
7 3300005458 Ga0070681_10151458 Ga0070681_101514582 128
8 3300005530 Ga0070679_100326568 Ga0070679_1003265682 128
9 3300005535 Ga0070684_100220701 Ga0070684_1002207012 128
10 3300006914 Ga0075436_100060180 Ga0075436_1000601802 128
11 3300021384 Ga0213876_10292275 Ga0213876_102922752 128
12 3300025912 Ga0207707_10256194 Ga0207707_102561942 128
13 3300025919 Ga0207657_11229156 Ga0207657_112291561 128
14 3300025921 Ga0207652_10389404 Ga0207652_103894042 128
15 3300039437 Ga0436365_0931492 Ga0436365_0931492_3674_4069 128
16 3300048929 Ga0496126_0611700 Ga0496126_0611700_14_415 128
17 3300050514 nmdc:mga08x19_386303_c1 nmdc:mga08x19_386303_c1_154_540 128
18 3300050514 nmdc:mga08x19_52917_c1 nmdc:mga08x19_52917_c1_1773_2159 128
19 3300005290 Ga0065712_10204667 Ga0065712_102046672 129
20 3300005330 Ga0070690_101002092 Ga0070690_1010020921 129
21 3300005335 Ga0070666_10384018 Ga0070666_103840182 129
22 3300005355 Ga0070671_100443073 Ga0070671_1004430732 129
23 3300005364 Ga0070673_100577876 Ga0070673_1005778762 129
24 3300005367 Ga0070667_100510915 Ga0070667_1005109152 129
25 3300005535 Ga0070684_100060033 Ga0070684_1000600332 129
26 3300005547 Ga0070693_100821635 Ga0070693_1008216351 129
27 3300005614 Ga0068856_100109675 Ga0068856_1001096755 129
28 3300005616 Ga0068852_101323925 Ga0068852_1013239252 129
29 3300005618 Ga0068864_100477668 Ga0068864_1004776681 129
30 3300005842 Ga0068858_100386639 Ga0068858_1003866392 129
31 3300009098 Ga0105245_10006776 Ga0105245_1000677610 129
32 3300009148 Ga0105243_10218764 Ga0105243_102187643 129
33 3300009176 Ga0105242_10004781 Ga0105242_1000478111 129
34 3300009176 Ga0105242_12220737 Ga0105242_122207371 129
35 3300009177 Ga0105248_10063145 Ga0105248_100631454 129
36 3300009553 Ga0105249_10480431 Ga0105249_104804312 129
37 3300013100 Ga0157373_10335397 Ga0157373_103353972 129
38 3300013105 Ga0157369_10400893 Ga0157369_104008933 129
39 3300013296 Ga0157374_10628165 Ga0157374_106281652 129
40 3300013297 Ga0157378_11628231 Ga0157378_116282312 129
41 3300013306 Ga0163162_10335766 Ga0163162_103357662 129
42 3300013307 Ga0157372_10088364 Ga0157372_100883644 129
43 3300013307 Ga0157372_10449570 Ga0157372_104495702 129
44 3300013308 Ga0157375_10011474 Ga0157375_100114749 129
45 3300014968 Ga0157379_10896052 Ga0157379_108960522 129
46 3300025912 Ga0207707_10398419 Ga0207707_103984192 129
47 3300025927 Ga0207687_10290527 Ga0207687_102905272 129
48 3300025934 Ga0207686_10048041 Ga0207686_100480413 129
49 3300025934 Ga0207686_10099666 Ga0207686_100996663 129
50 3300025941 Ga0207711_10324800 Ga0207711_103248003 129
51 3300025944 Ga0207661_10974938 Ga0207661_109749382 129
52 3300025960 Ga0207651_11322939 Ga0207651_113229391 129
53 3300025961 Ga0207712_10084886 Ga0207712_100848862 129
54 3300025986 Ga0207658_10350923 Ga0207658_103509232 129
55 3300026078 Ga0207702_10027227 Ga0207702_100272272 129
56 3300026118 Ga0207675_101125080 Ga0207675_1011250802 129
57 3300035691 Ga0373931_0913931 Ga0373931_0913931_158_556 129
58 3300045051 Ga0451576_0670278 Ga0451576_0670278_112_510 129
59 3300048909 Ga0496106_0901768 Ga0496106_0901768_289_687 129
60 3300048915 Ga0496112_0005755 Ga0496112_0005755_7864_8262 129
61 3300048916 Ga0496113_1505584 Ga0496113_1505584_29_427 129
62 3300005290 Ga0065712_10183929 Ga0065712_101839292 130
63 3300005293 Ga0065715_10093526 Ga0065715_100935266 130
64 3300005336 Ga0070680_100361764 Ga0070680_1003617641 130
65 3300005337 Ga0070682_100003946 Ga0070682_1000039464 130
66 3300005444 Ga0070694_100037340 Ga0070694_1000373403 130
67 3300005457 Ga0070662_100154174 Ga0070662_1001541743 130
68 3300005530 Ga0070679_100292596 Ga0070679_1002925963 130
69 3300005530 Ga0070679_100478624 Ga0070679_1004786242 130
70 3300005535 Ga0070684_100624914 Ga0070684_1006249142 130
71 3300005539 Ga0068853_101062058 Ga0068853_1010620581 130
72 3300005545 Ga0070695_100030103 Ga0070695_1000301034 130
73 3300005547 Ga0070693_100434234 Ga0070693_1004342341 130
74 3300005549 Ga0070704_101861994 Ga0070704_1018619941 130
75 3300005563 Ga0068855_100005903 Ga0068855_1000059039 130
76 3300005578 Ga0068854_100719594 Ga0068854_1007195941 130
77 3300005614 Ga0068856_100551149 Ga0068856_1005511492 130
78 3300007788 Ga0099795_10040366 Ga0099795_100403662 130
79 3300010375 Ga0105239_10344125 Ga0105239_103441253 130
80 3300010375 Ga0105239_10645596 Ga0105239_106455962 130
81 3300010375 Ga0105239_12814337 Ga0105239_128143371 130
82 3300013105 Ga0157369_10097532 Ga0157369_100975323 130
83 3300013105 Ga0157369_10346806 Ga0157369_103468063 130
84 3300013307 Ga0157372_10010522 Ga0157372_100105229 130
85 3300013307 Ga0157372_10386581 Ga0157372_103865813 130
86 3300025913 Ga0207695_10124331 Ga0207695_101243314 130
87 3300025921 Ga0207652_10350438 Ga0207652_103504381 130
88 3300025921 Ga0207652_10428568 Ga0207652_104285681 130
89 3300025927 Ga0207687_10612866 Ga0207687_106128662 130
90 3300025933 Ga0207706_10225385 Ga0207706_102253851 130
91 3300025949 Ga0207667_10362382 Ga0207667_103623823 130
92 3300025961 Ga0207712_11611061 Ga0207712_116110611 130
93 3300026041 Ga0207639_11145417 Ga0207639_111454171 130
94 3300035691 Ga0373931_0039636 Ga0373931_0039636_641_1042 130
95 3300036401 Ga0373937_0744210 Ga0373937_0744210_362_763 130
96 3300046459 Ga0495629_0006086 Ga0495629_0006086_4495_4896 130
97 3300046473 Ga0495582_0278020 Ga0495582_0278020_256_657 130
98 3300046536 Ga0495587_0665226 Ga0495587_0665226_63_464 130
99 3300046543 Ga0495645_0823815 Ga0495645_0823815_37_438 130
100 3300046683 Ga0495658_0555238 Ga0495658_0555238_85_486 130
101 3300047315 Ga0495581_0384302 Ga0495581_0384302_37_438 130
102 3300005336 Ga0070680_100773022 Ga0070680_1007730222 131
103 3300014325 Ga0163163_10524323 Ga0163163_105243232 131
104 3300005367 Ga0070667_100000040 Ga0070667_100000040130 132
105 3300005455 Ga0070663_100000031 Ga0070663_10000003135 132
106 3300005539 Ga0068853_100004928 Ga0068853_1000049283 132
107 3300005616 Ga0068852_100918451 Ga0068852_1009184513 132
108 3300009093 Ga0105240_10575312 Ga0105240_105753124 132
109 3300009177 Ga0105248_10000289 Ga0105248_1000028925 132
110 3300009545 Ga0105237_10000291 Ga0105237_1000029129 132
111 3300009553 Ga0105249_10000338 Ga0105249_1000033813 132
112 3300010375 Ga0105239_10182759 Ga0105239_101827592 132
113 3300025914 Ga0207671_10007691 Ga0207671_100076918 132
114 3300025941 Ga0207711_10000265 Ga0207711_1000026533 132
115 3300025961 Ga0207712_10000872 Ga0207712_1000087213 132
116 3300025986 Ga0207658_10000020 Ga0207658_1000002090 132
117 3300026041 Ga0207639_10004713 Ga0207639_1000471312 132
118 3300026067 Ga0207678_10000010 Ga0207678_10000010105 132
119 3300026088 Ga0207641_11704523 Ga0207641_117045232 132
120 3300026142 Ga0207698_10416273 Ga0207698_104162731 132
121 3300048920 Ga0496117_0180362 Ga0496117_0180362_441_854 132
122 3300048921 Ga0496118_0218348 Ga0496118_0218348_51_464 132
123 3300048924 Ga0496121_0147390 Ga0496121_0147390_914_1327 132
124 3300048925 Ga0496122_0000037 Ga0496122_0000037_153032_153445 132
125 3300048926 Ga0496123_0000083 Ga0496123_0000083_114543_114956 132
126 3300005339 Ga0070660_100219566 Ga0070660_1002195662 134
127 3300005340 Ga0070689_100291365 Ga0070689_1002913653 134
128 3300005341 Ga0070691_10046119 Ga0070691_100461194 134
129 3300005343 Ga0070687_100036163 Ga0070687_1000361634 134
130 3300005343 Ga0070687_100088734 Ga0070687_1000887343 134
131 3300005344 Ga0070661_100228081 Ga0070661_1002280814 134
132 3300005353 Ga0070669_100048184 Ga0070669_1000481842 134
133 3300005364 Ga0070673_100009117 Ga0070673_1000091173 134
134 3300005366 Ga0070659_101214042 Ga0070659_1012140421 134
135 3300005367 Ga0070667_100116200 Ga0070667_1001162001 134
136 3300005438 Ga0070701_10077313 Ga0070701_100773132 134
137 3300005440 Ga0070705_100216863 Ga0070705_1002168632 134
138 3300005441 Ga0070700_100356191 Ga0070700_1003561912 134
139 3300005458 Ga0070681_10012229 Ga0070681_1001222910 134
140 3300005459 Ga0068867_100061007 Ga0068867_1000610073 134
141 3300005530 Ga0070679_100134951 Ga0070679_1001349513 134
142 3300005530 Ga0070679_100528400 Ga0070679_1005284002 134
143 3300005535 Ga0070684_100714159 Ga0070684_1007141592 134
144 3300005543 Ga0070672_100007932 Ga0070672_1000079326 134
145 3300005544 Ga0070686_100188248 Ga0070686_1001882483 134
146 3300005544 Ga0070686_100525899 Ga0070686_1005258992 134
147 3300005545 Ga0070695_100025027 Ga0070695_1000250274 134
148 3300005578 Ga0068854_100171933 Ga0068854_1001719333 134
149 3300005614 Ga0068856_100310740 Ga0068856_1003107404 134
150 3300005615 Ga0070702_100074408 Ga0070702_1000744083 134
151 3300005616 Ga0068852_100122257 Ga0068852_1001222575 134
152 3300005616 Ga0068852_101970845 Ga0068852_1019708451 134
153 3300005617 Ga0068859_100074087 Ga0068859_1000740872 134
154 3300005719 Ga0068861_101344770 Ga0068861_1013447702 134
155 3300005841 Ga0068863_100290454 Ga0068863_1002904541 134
156 3300005842 Ga0068858_100278121 Ga0068858_1002781213 134
157 3300005842 Ga0068858_100608224 Ga0068858_1006082242 134
158 3300005843 Ga0068860_100610651 Ga0068860_1006106512 134
159 3300005844 Ga0068862_100234207 Ga0068862_1002342072 134
160 3300006871 Ga0075434_100052491 Ga0075434_1000524914 134
161 3300006931 Ga0097620_100074086 Ga0097620_1000740862 134
162 3300007076 Ga0075435_100041866 Ga0075435_1000418661 134
163 3300009093 Ga0105240_11164903 Ga0105240_111649032 134
164 3300009098 Ga0105245_10113464 Ga0105245_101134643 134
165 3300009176 Ga0105242_10934951 Ga0105242_109349512 134
166 3300009177 Ga0105248_10525369 Ga0105248_105253692 134
167 3300009177 Ga0105248_10698277 Ga0105248_106982772 134
168 3300009551 Ga0105238_10099879 Ga0105238_100998794 134
169 3300009553 Ga0105249_11204759 Ga0105249_112047592 134
170 3300013105 Ga0157369_10429814 Ga0157369_104298142 134
171 3300013297 Ga0157378_10581752 Ga0157378_105817522 134
172 3300013307 Ga0157372_10359056 Ga0157372_103590565 134
173 3300013308 Ga0157375_11909358 Ga0157375_119093581 134
174 3300020082 Ga0206353_10883918 Ga0206353_108839181 134
175 3300025901 Ga0207688_10130384 Ga0207688_101303842 134
176 3300025903 Ga0207680_10619276 Ga0207680_106192762 134
177 3300025907 Ga0207645_10006576 Ga0207645_100065764 134
178 3300025912 Ga0207707_10047936 Ga0207707_100479361 134
179 3300025913 Ga0207695_10459440 Ga0207695_104594403 134
180 3300025917 Ga0207660_11336568 Ga0207660_113365681 134
181 3300025918 Ga0207662_10022599 Ga0207662_100225993 134
182 3300025920 Ga0207649_11210840 Ga0207649_112108401 134
183 3300025921 Ga0207652_10026050 Ga0207652_100260502 134
184 3300025921 Ga0207652_10094414 Ga0207652_100944141 134
185 3300025923 Ga0207681_10569899 Ga0207681_105698992 134
186 3300025927 Ga0207687_10614915 Ga0207687_106149152 134
187 3300025932 Ga0207690_11070277 Ga0207690_110702771 134
188 3300025933 Ga0207706_10028481 Ga0207706_100284814 134
189 3300025936 Ga0207670_11246264 Ga0207670_112462642 134
190 3300025938 Ga0207704_10242602 Ga0207704_102426022 134
191 3300025940 Ga0207691_10184147 Ga0207691_101841472 134
192 3300025941 Ga0207711_10022698 Ga0207711_100226984 134
193 3300025945 Ga0207679_10375012 Ga0207679_103750122 134
194 3300025960 Ga0207651_10030057 Ga0207651_100300573 134
195 3300025961 Ga0207712_10779039 Ga0207712_107790392 134
196 3300025981 Ga0207640_10425011 Ga0207640_104250112 134
197 3300025981 Ga0207640_10746773 Ga0207640_107467731 134
198 3300026035 Ga0207703_10601074 Ga0207703_106010742 134
199 3300026088 Ga0207641_10273520 Ga0207641_102735203 134
200 3300026089 Ga0207648_10023071 Ga0207648_100230713 134
201 3300026118 Ga0207675_100051308 Ga0207675_1000513084 134
202 3300026142 Ga0207698_10403904 Ga0207698_104039044 134
203 3300035091 Ga0373951_0043530 Ga0373951_0043530_559_969 134
204 3300035207 Ga0373942_0297768 Ga0373942_0297768_68_478 134
205 3300035241 Ga0373961_0024157 Ga0373961_0024157_879_1289 134
206 3300035691 Ga0373931_0118723 Ga0373931_0118723_51_461 134
207 3300048912 Ga0496109_0418053 Ga0496109_0418053_669_1079 134
208 3300048915 Ga0496112_0189703 Ga0496112_0189703_720_1130 134
209 3300049570 Ga0501033_0560402 Ga0501033_0560402_170_583 134
210 3300049578 Ga0501042_0649606 Ga0501042_0649606_85_495 134
211 3300049579 Ga0501043_0769176 Ga0501043_0769176_251_664 134
212 3300049580 Ga0501046_0659635 Ga0501046_0659635_300_710 134
213 3300049581 Ga0501047_0504779 Ga0501047_0504779_560_973 134
214 3300049582 Ga0501048_0899981 Ga0501048_0899981_206_616 134
215 3300049589 Ga0501073_0647736 Ga0501073_0647736_293_706 134
216 3300049823 Ga0501044_0818500 Ga0501044_0818500_20_433 134
217 3300050513 nmdc:mga0rr50_11226_c1 nmdc:mga0rr50_11226_c1_887_1297 134
218 3300053131 Ga0500652_177736 Ga0500652_177736_312_725 134
219 3300005445 Ga0070708_100003138 Ga0070708_1000031389 135
220 3300005467 Ga0070706_100130102 Ga0070706_1001301023 135
221 3300005468 Ga0070707_100198095 Ga0070707_1001980952 135
222 3300005536 Ga0070697_101829626 Ga0070697_1018296261 135
223 3300005564 Ga0070664_101740912 Ga0070664_1017409121 135
224 3300005614 Ga0068856_100154602 Ga0068856_1001546023 135
225 3300009174 Ga0105241_10622300 Ga0105241_106223002 135
226 3300009545 Ga0105237_10029124 Ga0105237_100291245 135
227 3300013104 Ga0157370_10125415 Ga0157370_101254152 135
228 3300013105 Ga0157369_10066763 Ga0157369_100667633 135
229 3300013307 Ga0157372_10031822 Ga0157372_100318222 135
230 3300015265 Ga0182005_1201290 Ga0182005_12012901 135
231 3300025906 Ga0207699_10123055 Ga0207699_101230552 135
232 3300025911 Ga0207654_10220257 Ga0207654_102202572 135
233 3300025913 Ga0207695_10058625 Ga0207695_100586252 135
234 3300025915 Ga0207693_10958018 Ga0207693_109580181 135
235 3300025922 Ga0207646_11168960 Ga0207646_111689601 135
236 3300025945 Ga0207679_10853924 Ga0207679_108539242 135
237 3300025949 Ga0207667_10160528 Ga0207667_101605282 135
238 3300035695 Ga0373927_0009495 Ga0373927_0009495_3582_3998 135
239 3300039437 Ga0436365_1061046 Ga0436365_1061046_453_860 135
240 3300046472 Ga0495580_0013960 Ga0495580_0013960_444_860 135
241 3300046473 Ga0495582_0162867 Ga0495582_0162867_180_596 135
242 3300046499 Ga0495594_0026579 Ga0495594_0026579_53_469 135
243 3300046499 Ga0495594_0233464 Ga0495594_0233464_220_639 135
244 3300046531 Ga0495665_0246234 Ga0495665_0246234_156_572 135
245 3300005329 Ga0070683_100058108 Ga0070683_1000581085 136
246 3300025917 Ga0207660_10107777 Ga0207660_101077772 136
247 3300025921 Ga0207652_10112426 Ga0207652_101124262 136
248 3300005354 Ga0070675_100000029 Ga0070675_10000002983 137
249 3300005535 Ga0070684_100759750 Ga0070684_1007597502 137
250 3300005545 Ga0070695_100153953 Ga0070695_1001539531 137
251 3300005547 Ga0070693_100141019 Ga0070693_1001410191 137
252 3300009177 Ga0105248_12689305 Ga0105248_126893051 137
253 3300014745 Ga0157377_10009597 Ga0157377_100095971 137
254 3300021388 Ga0213875_10054917 Ga0213875_100549172 137
255 3300025926 Ga0207659_10000073 Ga0207659_100000736 137
256 3300034817 Ga0373948_0023358 Ga0373948_0023358_237_668 137
257 3300034818 Ga0373950_0036262 Ga0373950_0036262_153_584 137
258 3300034819 Ga0373958_0000572 Ga0373958_0000572_2015_2446 137
259 3300034957 Ga0373938_0000235 Ga0373938_0000235_7491_7922 137
260 3300035084 Ga0373928_0004433 Ga0373928_0004433_551_982 137
261 3300035085 Ga0373929_0002931 Ga0373929_0002931_139_570 137
262 3300035088 Ga0373940_0000853 Ga0373940_0000853_3336_3767 137
263 3300035090 Ga0373949_0015234 Ga0373949_0015234_1024_1455 137
264 3300035091 Ga0373951_0004979 Ga0373951_0004979_355_786 137
265 3300035092 Ga0373952_0010527 Ga0373952_0010527_1196_1627 137
266 3300035112 Ga0373932_0012470 Ga0373932_0012470_238_669 137
267 3300035121 Ga0373960_0021302 Ga0373960_0021302_159_590 137
268 3300035207 Ga0373942_0001335 Ga0373942_0001335_5417_5848 137
269 3300035242 Ga0373962_0001684 Ga0373962_0001684_4055_4486 137
270 3300035691 Ga0373931_0008621 Ga0373931_0008621_2900_3331 137
271 3300037853 Ga0436364_0290793 Ga0436364_0290793_200_616 137
272 3300045051 Ga0451576_0061516 Ga0451576_0061516_1580_2011 137
273 3300048915 Ga0496112_0067381 Ga0496112_0067381_2455_2874 137
274 3300005330 Ga0070690_100495675 Ga0070690_1004956751 138
275 3300005330 Ga0070690_101398583 Ga0070690_1013985831 138
276 3300005338 Ga0068868_100113891 Ga0068868_1001138911 138
277 3300005364 Ga0070673_100422129 Ga0070673_1004221291 138
278 3300005445 Ga0070708_100001445 Ga0070708_1000014458 138
279 3300005445 Ga0070708_100205326 Ga0070708_1002053263 138
280 3300005457 Ga0070662_100005351 Ga0070662_1000053511 138
281 3300005459 Ga0068867_100043431 Ga0068867_1000434312 138
282 3300005459 Ga0068867_100693155 Ga0068867_1006931551 138
283 3300005467 Ga0070706_100117029 Ga0070706_1001170292 138
284 3300005468 Ga0070707_100010321 Ga0070707_1000103215 138
285 3300005518 Ga0070699_100695741 Ga0070699_1006957412 138
286 3300005544 Ga0070686_100098633 Ga0070686_1000986331 138
287 3300005578 Ga0068854_100725598 Ga0068854_1007255982 138
288 3300005719 Ga0068861_100128020 Ga0068861_1001280202 138
289 3300006881 Ga0068865_100045437 Ga0068865_1000454372 138
290 3300007076 Ga0075435_100496439 Ga0075435_1004964392 138
291 3300009098 Ga0105245_10061039 Ga0105245_100610392 138
292 3300009176 Ga0105242_10079654 Ga0105242_100796542 138
293 3300009177 Ga0105248_11483051 Ga0105248_114830512 138
294 3300013297 Ga0157378_10003743 Ga0157378_1000374312 138
295 3300014326 Ga0157380_10739945 Ga0157380_107399452 138
296 3300025899 Ga0207642_10009574 Ga0207642_100095743 138
297 3300025907 Ga0207645_10047587 Ga0207645_100475871 138
298 3300025918 Ga0207662_10370807 Ga0207662_103708071 138
299 3300025922 Ga0207646_10010691 Ga0207646_1001069111 138
300 3300025923 Ga0207681_10018228 Ga0207681_100182283 138
301 3300025927 Ga0207687_10371387 Ga0207687_103713872 138
302 3300025933 Ga0207706_10010967 Ga0207706_100109679 138
303 3300025934 Ga0207686_11629297 Ga0207686_116292971 138
304 3300025938 Ga0207704_10953606 Ga0207704_109536062 138
305 3300025941 Ga0207711_11837787 Ga0207711_118377871 138
306 3300025960 Ga0207651_10373377 Ga0207651_103733772 138
307 3300025981 Ga0207640_11019329 Ga0207640_110193292 138
308 3300026023 Ga0207677_10096118 Ga0207677_100961183 138
309 3300026075 Ga0207708_10001320 Ga0207708_100013202 138
310 3300026089 Ga0207648_10064453 Ga0207648_100644534 138
311 3300026089 Ga0207648_10117882 Ga0207648_101178823 138
312 3300026118 Ga0207675_100480638 Ga0207675_1004806382 138
313 3300050513 nmdc:mga0rr50_1093618_c1 nmdc:mga0rr50_1093618_c1_199_624 138
314 3300005328 Ga0070676_10023665 Ga0070676_100236652 139
315 3300005328 Ga0070676_10216372 Ga0070676_102163721 139
316 3300005329 Ga0070683_100004042 Ga0070683_1000040422 139
317 3300005334 Ga0068869_100567764 Ga0068869_1005677642 139
318 3300005336 Ga0070680_100038934 Ga0070680_1000389344 139
319 3300005336 Ga0070680_100084214 Ga0070680_1000842142 139
320 3300005336 Ga0070680_101116354 Ga0070680_1011163541 139
321 3300005337 Ga0070682_100001389 Ga0070682_1000013894 139
322 3300005337 Ga0070682_101445027 Ga0070682_1014450271 139
323 3300005338 Ga0068868_100774318 Ga0068868_1007743181 139
324 3300005339 Ga0070660_100262809 Ga0070660_1002628092 139
325 3300005341 Ga0070691_10172029 Ga0070691_101720292 139
326 3300005344 Ga0070661_100010103 Ga0070661_1000101037 139
327 3300005354 Ga0070675_101266573 Ga0070675_1012665731 139
328 3300005356 Ga0070674_100365026 Ga0070674_1003650262 139
329 3300005366 Ga0070659_100101054 Ga0070659_1001010541 139
330 3300005434 Ga0070709_10012888 Ga0070709_100128885 139
331 3300005435 Ga0070714_100015991 Ga0070714_1000159913 139
332 3300005437 Ga0070710_10005596 Ga0070710_100055962 139
333 3300005445 Ga0070708_100107159 Ga0070708_1001071593 139
334 3300005456 Ga0070678_100745180 Ga0070678_1007451802 139
335 3300005457 Ga0070662_100652524 Ga0070662_1006525242 139
336 3300005458 Ga0070681_10000409 Ga0070681_1000040915 139
337 3300005458 Ga0070681_10046938 Ga0070681_100469383 139
338 3300005458 Ga0070681_10054795 Ga0070681_100547952 139
339 3300005458 Ga0070681_10178525 Ga0070681_101785252 139
340 3300005459 Ga0068867_100028688 Ga0068867_1000286886 139
341 3300005468 Ga0070707_100075635 Ga0070707_1000756352 139
342 3300005518 Ga0070699_100547243 Ga0070699_1005472432 139
343 3300005530 Ga0070679_100004585 Ga0070679_1000045856 139
344 3300005530 Ga0070679_100026477 Ga0070679_1000264771 139
345 3300005530 Ga0070679_100057869 Ga0070679_1000578695 139
346 3300005530 Ga0070679_100667078 Ga0070679_1006670782 139
347 3300005535 Ga0070684_100001569 Ga0070684_10000156914 139
348 3300005536 Ga0070697_100079176 Ga0070697_1000791763 139
349 3300005536 Ga0070697_100305260 Ga0070697_1003052602 139
350 3300005536 Ga0070697_100343613 Ga0070697_1003436131 139
351 3300005546 Ga0070696_100315419 Ga0070696_1003154191 139
352 3300005547 Ga0070693_100001273 Ga0070693_1000012731 139
353 3300005547 Ga0070693_100462742 Ga0070693_1004627421 139
354 3300005547 Ga0070693_101377337 Ga0070693_1013773371 139
355 3300005549 Ga0070704_100319108 Ga0070704_1003191082 139
356 3300005563 Ga0068855_100141020 Ga0068855_1001410202 139
357 3300005564 Ga0070664_100001516 Ga0070664_10000151620 139
358 3300005577 Ga0068857_100010759 Ga0068857_1000107596 139
359 3300005614 Ga0068856_100252610 Ga0068856_1002526101 139
360 3300005615 Ga0070702_100183636 Ga0070702_1001836362 139
361 3300005718 Ga0068866_10060308 Ga0068866_100603083 139
362 3300005937 Ga0081455_10240573 Ga0081455_102405732 139
363 3300006173 Ga0070716_100033001 Ga0070716_1000330013 139
364 3300006173 Ga0070716_100182300 Ga0070716_1001823002 139
365 3300006358 Ga0068871_100868859 Ga0068871_1008688591 139
366 3300006852 Ga0075433_10016451 Ga0075433_100164518 139
367 3300006852 Ga0075433_10394662 Ga0075433_103946622 139
368 3300006871 Ga0075434_100083234 Ga0075434_1000832343 139
369 3300006914 Ga0075436_100089739 Ga0075436_1000897393 139
370 3300006914 Ga0075436_100803196 Ga0075436_1008031961 139
371 3300006914 Ga0075436_100957344 Ga0075436_1009573442 139
372 3300009093 Ga0105240_10191212 Ga0105240_101912122 139
373 3300009093 Ga0105240_11995775 Ga0105240_119957751 139
374 3300009098 Ga0105245_10233760 Ga0105245_102337601 139
375 3300009147 Ga0114129_10071962 Ga0114129_100719623 139
376 3300009176 Ga0105242_11128896 Ga0105242_111288962 139
377 3300009551 Ga0105238_10017420 Ga0105238_100174205 139
378 3300013100 Ga0157373_10189438 Ga0157373_101894382 139
379 3300013104 Ga0157370_10172311 Ga0157370_101723111 139
380 3300013297 Ga0157378_10003158 Ga0157378_100031586 139
381 3300013307 Ga0157372_10305087 Ga0157372_103050873 139
382 3300025899 Ga0207642_10050432 Ga0207642_100504323 139
383 3300025906 Ga0207699_10016735 Ga0207699_100167354 139
384 3300025907 Ga0207645_10579857 Ga0207645_105798571 139
385 3300025912 Ga0207707_10001728 Ga0207707_1000172813 139
386 3300025912 Ga0207707_10041066 Ga0207707_100410662 139
387 3300025912 Ga0207707_10148893 Ga0207707_101488932 139
388 3300025912 Ga0207707_10311286 Ga0207707_103112861 139
389 3300025913 Ga0207695_10079782 Ga0207695_100797822 139
390 3300025917 Ga0207660_10039271 Ga0207660_100392714 139
391 3300025917 Ga0207660_10116985 Ga0207660_101169852 139
392 3300025917 Ga0207660_10479924 Ga0207660_104799242 139
393 3300025919 Ga0207657_10258139 Ga0207657_102581392 139
394 3300025920 Ga0207649_10005395 Ga0207649_100053957 139
395 3300025921 Ga0207652_10003387 Ga0207652_100033877 139
396 3300025921 Ga0207652_10088318 Ga0207652_100883181 139
397 3300025921 Ga0207652_10109416 Ga0207652_101094161 139
398 3300025921 Ga0207652_10198263 Ga0207652_101982631 139
399 3300025924 Ga0207694_10272098 Ga0207694_102720982 139
400 3300025927 Ga0207687_10143860 Ga0207687_101438601 139
401 3300025929 Ga0207664_10058879 Ga0207664_100588792 139
402 3300025937 Ga0207669_10088030 Ga0207669_100880303 139
403 3300025939 Ga0207665_10003227 Ga0207665_100032277 139
404 3300025939 Ga0207665_10314231 Ga0207665_103142312 139
405 3300025944 Ga0207661_10013579 Ga0207661_100135792 139
406 3300025944 Ga0207661_10031420 Ga0207661_100314203 139
407 3300025945 Ga0207679_10008403 Ga0207679_100084033 139
408 3300026023 Ga0207677_10017594 Ga0207677_100175942 139
409 3300026078 Ga0207702_10228322 Ga0207702_102283222 139
410 3300026078 Ga0207702_10348847 Ga0207702_103488471 139
411 3300026078 Ga0207702_11535329 Ga0207702_115353291 139
412 3300026089 Ga0207648_10276499 Ga0207648_102764992 139
413 3300026095 Ga0207676_11147981 Ga0207676_111479812 139
414 3300026116 Ga0207674_10001487 Ga0207674_100014875 139
415 3300026142 Ga0207698_10010863 Ga0207698_100108633 139
416 3300027364 Ga0209967_1001389 Ga0209967_10013892 139
417 3300027462 Ga0210000_1007053 Ga0210000_10070531 139
418 3300027526 Ga0209968_1015667 Ga0209968_10156672 139
419 3300027614 Ga0209970_1090548 Ga0209970_10905481 139
420 3300027695 Ga0209966_1133016 Ga0209966_11330161 139
421 3300034820 Ga0373959_0003689 Ga0373959_0003689_1504_1926 139
422 3300035121 Ga0373960_0122133 Ga0373960_0122133_409_831 139
423 3300046684 Ga0495669_0404318 Ga0495669_0404318_114_539 139
424 3300050514 nmdc:mga08x19_114444_c1 nmdc:mga08x19_114444_c1_1297_1719 139
425 3300050514 nmdc:mga08x19_403464_c1 nmdc:mga08x19_403464_c1_306_731 139
426 2162886011 MRS1b_contig_3251030 MRS1b_0066.00001560 140
427 3300005290 Ga0065712_10121751 Ga0065712_101217512 140
428 3300005293 Ga0065715_10160962 Ga0065715_101609621 140
429 3300005337 Ga0070682_100262355 Ga0070682_1002623552 140
430 3300005345 Ga0070692_10240716 Ga0070692_102407162 140
431 3300005434 Ga0070709_10683670 Ga0070709_106836701 140
432 3300005458 Ga0070681_10030436 Ga0070681_100304361 140
433 3300005536 Ga0070697_100265233 Ga0070697_1002652331 140
434 3300005539 Ga0068853_100176370 Ga0068853_1001763702 140
435 3300005545 Ga0070695_100001915 Ga0070695_1000019152 140
436 3300005545 Ga0070695_100409479 Ga0070695_1004094791 140
437 3300005563 Ga0068855_100017429 Ga0068855_1000174293 140
438 3300005616 Ga0068852_101299149 Ga0068852_1012991491 140
439 3300007788 Ga0099795_10024061 Ga0099795_100240612 140
440 3300009093 Ga0105240_10041532 Ga0105240_100415323 140
441 3300009098 Ga0105245_10012231 Ga0105245_100122313 140
442 3300010159 Ga0099796_10029192 Ga0099796_100291922 140
443 3300010375 Ga0105239_11008127 Ga0105239_110081272 140
444 3300013296 Ga0157374_10459377 Ga0157374_104593772 140
445 3300013297 Ga0157378_10023134 Ga0157378_100231343 140
446 3300013307 Ga0157372_10011795 Ga0157372_100117957 140
447 3300025912 Ga0207707_10032943 Ga0207707_100329436 140
448 3300025927 Ga0207687_10207671 Ga0207687_102076711 140
449 3300025949 Ga0207667_10008749 Ga0207667_100087496 140
450 3300026041 Ga0207639_10903594 Ga0207639_109035942 140
451 3300026142 Ga0207698_10643612 Ga0207698_106436122 140

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

11

133

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8404 16 138
2rbb-assembly1.cif.gz_B crystal structure of a glyoxalase/bleomycin resistance protein/dioxygenase family enzyme from burkholderia phytofirmans psjn 0.8063 19 140
3vcx-assembly1.cif.gz_A crystal structure of a putative glyoxalase/bleomycin resistance protein from rhodopseudomonas palustris cga009 0.8025 16 138
4nvs-assembly1.cif.gz_A crystal structure of the q18cp6_clod6 protein from glyoxalase family. northeast structural genomics consortium target cfr3 0.7989 15 138
2p7k-assembly1.cif.gz_B crystal structure of genomically encoded fosfomycin resistance protein, fosx, from listeria monocytogenes (hexagonal form) 0.7741 15 140
ID Description Score Start End Superfamily
2pjsB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9131 91 137 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8769 89 138 3.30.720.110
3bt3B02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8129 88 140 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8091 87 140 3.30.720.110
4nvsA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8074 16 138 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A7V9T107-F1-model_v4 VOC family protein 0.9976 15 140
AF-A0A1Q7QJQ6-F1-model_v4 VOC domain-containing protein 0.9974 14 140
AF-A0A2V7HVK1-F1-model_v4 VOC domain-containing protein 0.9816 25 140
AF-A0A2V7HVK1-F1-model_v4 VOC domain-containing protein 0.9652 25 140
AF-A0A2V9UV26-F1-model_v4 VOC domain-containing protein 0.9651 14 140

Feature Viewer

pLDDT pTM Quality
91.95 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map