F446880

General Info

Members Datasets Scaffolds Average Seq Length
451 227 902 236

Family's Representative Sequence

Representative Sequence 3300049823|Ga0501044_0363157|Ga0501044_0363157_374_1138
Length 254
Sequence MASGPVIPDFGRGSSCVRDNGLFCWGWVKDNWSDTLQPALLQHIALTVIAVAIGTVIAFTLALAAHRRGWIATPVVAITGLLYTIPSLALFQLLVPLTGLSRTTAEVALVSYTLLILFRNMLAGLSGVPGEVRDAARGMGMTERQLLWKVELPLALPLIFGGIRTAAVYVIATATLGSVAGADTLGNVIVDQATYHLSGVIGASICVAVLALLFELLFAGLQRAVTPRGLRKHRRRTPAEAGTTVVGTAAAETV

Samples

Sample ID Description Type Environment
1 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
2 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
76 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
118 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
127 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
137 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
140 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
141 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
142 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
143 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
144 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
145 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
148 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
149 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
150 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
151 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
152 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
165 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
166 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
171 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
172 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
173 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
201 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
202 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
203 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
204 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
205 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
206 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
207 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
208 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
209 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
210 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
211 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
212 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
220 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
221 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
222 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
223 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
227 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0.44
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.22
Nodule 0
Rhizoplane 13.08
Rhizosphere 83.81
Stem 0
Stem Tuber 0
Unclassified 2.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501044_0363157 3300049823 Bacteria 1366
2 ARSoilOldRDRAFT_c002325 3300000044 Bacteria 1682
3 JGI24739J22299_10043290 3300001989 Bacteria 1489
4 Ga0070658_10125013 3300005327 Bacteria 2140
5 Ga0070658_10403762 3300005327 Bacteria 1174
6 Ga0070683_100012389 3300005329 Bacteria 7410
7 Ga0070683_100045839 3300005329 Bacteria 4036
8 Ga0070683_100200035 3300005329 Bacteria 1897
9 Ga0070683_100474877 3300005329 Bacteria 1194
10 Ga0070670_100099704 3300005331 Bacteria 2499
11 Ga0070680_100010423 3300005336 Bacteria 7166
12 Ga0070680_100148800 3300005336 Bacteria 1965
13 Ga0070682_100001938 3300005337 Bacteria 11550
14 Ga0070682_100266811 3300005337 Bacteria 1242
15 Ga0070682_100276631 3300005337 Bacteria 1222
16 Ga0068868_100052013 3300005338 Bacteria 3225
17 Ga0070660_100027047 3300005339 Bacteria 4278
18 Ga0070660_100048345 3300005339 Bacteria 3267
19 Ga0070660_100186375 3300005339 Bacteria 1680
20 Ga0070660_100442056 3300005339 Bacteria 1078
21 Ga0070691_10038218 3300005341 Bacteria 2266
22 Ga0070692_10014948 3300005345 Bacteria 3660
23 Ga0070669_100006327 3300005353 Bacteria 8536
24 Ga0070675_100041107 3300005354 Bacteria 3777
25 Ga0070671_100228444 3300005355 Bacteria 1579
26 Ga0070674_100053826 3300005356 Bacteria 2781
27 Ga0070673_100406759 3300005364 Unclassified 1218
28 Ga0070659_100000037 3300005366 Bacteria 113379
29 Ga0070659_100367626 3300005366 Bacteria 1209
30 Ga0070659_100425809 3300005366 Bacteria 1123
31 Ga0070709_10668146 3300005434 Bacteria 806
32 Ga0070714_100226180 3300005435 Bacteria 1722
33 Ga0070710_10000004 3300005437 Bacteria 270399
34 Ga0070700_100068517 3300005441 Bacteria 2256
35 Ga0070700_100167790 3300005441 Bacteria 1518
36 Ga0070694_100593713 3300005444 Bacteria 891
37 Ga0070678_100077407 3300005456 Bacteria 2509
38 Ga0070678_100444063 3300005456 Bacteria 1135
39 Ga0070678_100868700 3300005456 Bacteria 823
40 Ga0070662_100022650 3300005457 Bacteria 4303
41 Ga0070681_10082379 3300005458 Bacteria 3172
42 Ga0070681_10178251 3300005458 Bacteria 2047
43 Ga0070685_10279215 3300005466 Bacteria 1117
44 Ga0070698_100035274 3300005471 Bacteria 5173
45 Ga0070699_100020628 3300005518 Bacteria 5686
46 Ga0070699_100517094 3300005518 Bacteria 1085
47 Ga0070679_100008627 3300005530 Bacteria 9607
48 Ga0070679_100083838 3300005530 Bacteria 3175
49 Ga0070679_100487539 3300005530 Bacteria 1177
50 Ga0070684_100008837 3300005535 Bacteria 7899
51 Ga0070684_100344805 3300005535 Bacteria 1369
52 Ga0070684_100688498 3300005535 Bacteria 953
53 Ga0070684_100780093 3300005535 Bacteria 893
54 Ga0068853_100347032 3300005539 Bacteria 1380
55 Ga0070693_100036595 3300005547 Bacteria 2730
56 Ga0070665_100001101 3300005548 Bacteria 33337
57 Ga0070704_100030617 3300005549 Bacteria 3608
58 Ga0070704_100480615 3300005549 Bacteria 1075
59 Ga0070664_100040282 3300005564 Bacteria 3938
60 Ga0068857_100037242 3300005577 Bacteria 4309
61 Ga0068856_100007544 3300005614 Bacteria 10613
62 Ga0070702_100104215 3300005615 Bacteria 1746
63 Ga0068852_100543680 3300005616 Unclassified 1161
64 Ga0068861_100358896 3300005719 Bacteria 1281
65 Ga0068870_10218218 3300005840 Bacteria 1166
66 Ga0081455_10048893 3300005937 Bacteria 3650
67 Ga0081455_10167011 3300005937 Bacteria 1680
68 Ga0081455_10176876 3300005937 Bacteria 1619
69 Ga0081455_10194927 3300005937 Bacteria 1522
70 Ga0081455_10205148 3300005937 Bacteria 1473
71 Ga0070717_10015274 3300006028 Bacteria 5927
72 Ga0075365_10038903 3300006038 Bacteria 3094
73 Ga0075368_10113692 3300006042 Bacteria 1117
74 Ga0075363_100125110 3300006048 Bacteria 1439
75 Ga0075364_10074727 3300006051 Bacteria 2235
76 Ga0070712_100151511 3300006175 Bacteria 1781
77 Ga0075367_10153879 3300006178 Bacteria 1428
78 Ga0075370_10086936 3300006353 Bacteria 1801
79 Ga0075428_100002047 3300006844 Bacteria 21753
80 Ga0075430_100002970 3300006846 Bacteria 14203
81 Ga0075430_100152134 3300006846 Bacteria 1927
82 Ga0075429_100106248 3300006880 Bacteria 2452
83 Ga0068865_100549271 3300006881 Bacteria 970
84 Ga0105240_10228599 3300009093 Bacteria 2163
85 Ga0111539_10066668 3300009094 Bacteria 4252
86 Ga0111539_10427872 3300009094 Bacteria 1542
87 Ga0111539_10596462 3300009094 Bacteria 1286
88 Ga0105245_10001062 3300009098 Bacteria 24876
89 Ga0105245_10510380 3300009098 Bacteria 1219
90 Ga0105245_10569272 3300009098 Unclassified 1156
91 Ga0105245_10611647 3300009098 Bacteria 1117
92 Ga0105245_10680476 3300009098 Bacteria 1061
93 Ga0114129_10005183 3300009147 Bacteria 18351
94 Ga0114129_10669380 3300009147 Bacteria 1338
95 Ga0114129_10719886 3300009147 Bacteria 1281
96 Ga0105243_10095047 3300009148 Bacteria 2462
97 Ga0105242_10618027 3300009176 Bacteria 1049
98 Ga0105237_10160257 3300009545 Bacteria 2248
99 Ga0105238_10167182 3300009551 Bacteria 2175
100 Ga0105249_10684780 3300009553 Bacteria 1084
101 Ga0105239_10025303 3300010375 Bacteria 6536
102 Ga0105246_10161552 3300011119 Bacteria 1707
103 Ga0105246_10404525 3300011119 Bacteria 1134
104 Ga0105246_10506908 3300011119 Bacteria 1026
105 Ga0157373_10223827 3300013100 Bacteria 1328
106 Ga0157370_10235472 3300013104 Bacteria 1694
107 Ga0157369_10014930 3300013105 Bacteria 8766
108 Ga0157374_10077699 3300013296 Bacteria 3142
109 Ga0157372_10018666 3300013307 Bacteria 7461
110 Ga0157372_10158725 3300013307 Bacteria 2613
111 Ga0157372_10230783 3300013307 Bacteria 2146
112 Ga0157375_11241725 3300013308 Bacteria 875
113 Ga0157375_11720222 3300013308 Bacteria 743
114 Ga0157380_10525863 3300014326 Bacteria 1155
115 Ga0157377_10044865 3300014745 Bacteria 2467
116 Ga0157377_10065677 3300014745 Bacteria 2085
117 Ga0157376_10037321 3300014969 Bacteria 3943
118 Ga0206356_10076763 3300020070 Bacteria 1351
119 Ga0206353_10214256 3300020082 Bacteria 1360
120 Ga0213875_10000039 3300021388 Bacteria 156845
121 Ga0207692_10000002 3300025898 Bacteria 453100
122 Ga0207688_10035434 3300025901 Bacteria 2765
123 Ga0207643_10055320 3300025908 Bacteria 2257
124 Ga0207643_10082453 3300025908 Bacteria 1865
125 Ga0207707_10011821 3300025912 Bacteria 7590
126 Ga0207707_10092884 3300025912 Bacteria 2636
127 Ga0207693_10407148 3300025915 Unclassified 1063
128 Ga0207663_10407697 3300025916 Bacteria 1041
129 Ga0207660_10128651 3300025917 Bacteria 1926
130 Ga0207657_10036721 3300025919 Bacteria 4383
131 Ga0207657_10063578 3300025919 Bacteria 3154
132 Ga0207657_10088288 3300025919 Bacteria 2592
133 Ga0207649_10211259 3300025920 Bacteria 1377
134 Ga0207652_10001925 3300025921 Bacteria 17959
135 Ga0207652_10054287 3300025921 Bacteria 3444
136 Ga0207652_10411392 3300025921 Bacteria 1220
137 Ga0207646_10323252 3300025922 Bacteria 1394
138 Ga0207681_10004529 3300025923 Bacteria 8557
139 Ga0207694_10131917 3300025924 Bacteria 2003
140 Ga0207659_10090004 3300025926 Bacteria 2290
141 Ga0207659_10525781 3300025926 Bacteria 1003
142 Ga0207687_10293939 3300025927 Bacteria 1306
143 Ga0207664_10266795 3300025929 Bacteria 1499
144 Ga0207644_10332379 3300025931 Bacteria 1231
145 Ga0207690_10000404 3300025932 Bacteria 28563
146 Ga0207690_10334469 3300025932 Bacteria 1194
147 Ga0207706_10290620 3300025933 Bacteria 1425
148 Ga0207706_10447236 3300025933 Bacteria 1118
149 Ga0207709_10155089 3300025935 Bacteria 1590
150 Ga0207669_10081550 3300025937 Bacteria 2073
151 Ga0207704_10194710 3300025938 Bacteria 1478
152 Ga0207691_10054356 3300025940 Bacteria 3653
153 Ga0207661_10000167 3300025944 Bacteria 42604
154 Ga0207661_10042516 3300025944 Bacteria 3583
155 Ga0207661_10148992 3300025944 Bacteria 2021
156 Ga0207667_10287744 3300025949 Bacteria 1679
157 Ga0207668_10008716 3300025972 Bacteria 6058
158 Ga0207677_10058007 3300026023 Bacteria 2663
159 Ga0207677_10113588 3300026023 Bacteria 2022
160 Ga0207639_10260944 3300026041 Bacteria 1515
161 Ga0207708_10039294 3300026075 Bacteria 3605
162 Ga0207708_10044735 3300026075 Bacteria 3373
163 Ga0207702_10010285 3300026078 Bacteria 7837
164 Ga0207702_10504974 3300026078 Bacteria 1179
165 Ga0207702_10580079 3300026078 Unclassified 1099
166 Ga0207648_10087287 3300026089 Bacteria 2722
167 Ga0207648_10682835 3300026089 Bacteria 951
168 Ga0207674_10164165 3300026116 Bacteria 2175
169 Ga0207674_10390397 3300026116 Bacteria 1345
170 Ga0207675_100415627 3300026118 Bacteria 1328
171 Ga0207683_10281935 3300026121 Bacteria 1518
172 Ga0207698_10288127 3300026142 Bacteria 1522
173 Ga0207698_10347025 3300026142 Bacteria 1400
174 Ga0207428_10000327 3300027907 Bacteria 61752
175 Ga0268266_10003738 3300028379 Bacteria 14964
176 Ga0268266_10071841 3300028379 Bacteria 3000
177 Ga0268264_10836953 3300028381 Bacteria 921
178 Ga0265319_1006947 3300028563 Bacteria 5159
179 Ga0265334_10020057 3300028573 Bacteria 2741
180 Ga0265334_10056028 3300028573 Bacteria 1498
181 Ga0265318_10004101 3300028577 Bacteria 7140
182 Ga0265318_10005549 3300028577 Bacteria 5918
183 Ga0265322_10035041 3300028654 Bacteria 1430
184 Ga0265338_10076065 3300028800 Bacteria 2845
185 Ga0265338_10091110 3300028800 Bacteria 2520
186 Ga0265320_10017081 3300031240 Bacteria 4041
187 Ga0265325_10076345 3300031241 Bacteria 1672
188 Ga0265329_10035697 3300031242 Bacteria 1604
189 Ga0265331_10045744 3300031250 Bacteria 2112
190 Ga0265327_10040633 3300031251 Bacteria 2513
191 Ga0265316_10054248 3300031344 Bacteria 3138
192 Ga0265314_10034922 3300031711 Bacteria 3669
193 Ga0265314_10040139 3300031711 Bacteria 3362
194 Ga0265342_10074004 3300031712 Bacteria 1980
195 Ga0307405_10031616 3300031731 Bacteria 3118
196 Ga0307410_10249781 3300031852 Bacteria 1378
197 Ga0307406_10065201 3300031901 Bacteria 2366
198 Ga0307406_10240278 3300031901 Bacteria 1358
199 Ga0307412_10044340 3300031911 Bacteria 2901
200 Ga0307409_100008998 3300031995 Bacteria 6106
201 Ga0307409_100027563 3300031995 Bacteria 4028
202 Ga0307415_100053576 3300032126 Bacteria 2749
203 Ga0307415_100098518 3300032126 Bacteria 2137
204 Ga0307415_100454053 3300032126 Bacteria 1109
205 Ga0373959_0003532 3300034820 Bacteria 2496
206 Ga0373960_0071808 3300035121 Bacteria 1072
207 Ga0373931_0035948 3300035691 Bacteria 2579
208 Ga0373925_0185940 3300037068 Bacteria 1647
209 Ga0395899_0225289 3300037312 Bacteria 1297
210 Ga0395900_0010458 3300037418 Bacteria 9488
211 Ga0395900_0169647 3300037418 Bacteria 2222
212 Ga0395900_0296262 3300037418 Bacteria 1605
213 Ga0395898_0015967 3300037466 Bacteria 7693
214 Ga0395898_0119496 3300037466 Bacteria 2525
215 Ga0395905_0128446 3300037471 Bacteria 2384
216 Ga0395905_0409698 3300037471 Bacteria 1251
217 Ga0436364_1255310 3300037853 Bacteria 65530
218 Ga0395901_0002874 3300038443 Bacteria 17387
219 Ga0395901_0576501 3300038443 Bacteria 1137
220 Ga0436363_0273228 3300039450 Unclassified 972
221 Ga0450910_023814 3300042147 Bacteria 937
222 Ga0466969_0062360 3300044656 Bacteria 1809
223 Ga0466966_0015595 3300044684 Bacteria 5022
224 Ga0466966_0090586 3300044684 Bacteria 1899
225 Ga0466966_0174147 3300044684 Bacteria 1307
226 Ga0466961_0119529 3300044693 Unclassified 1655
227 Ga0466963_0004742 3300044694 Bacteria 7936
228 Ga0466964_0016368 3300044706 Bacteria 2831
229 Ga0466970_0022640 3300044765 Bacteria 3280
230 Ga0466970_0305100 3300044765 Bacteria 898
231 Ga0466960_0007711 3300044901 Bacteria 4386
232 Ga0466959_0021682 3300045049 Bacteria 4742
233 Ga0466959_0073681 3300045049 Bacteria 2470
234 Ga0466967_0029456 3300045976 Bacteria 4594
235 Ga0466967_0092574 3300045976 Bacteria 2749
236 Ga0466967_0191704 3300045976 Bacteria 1932
237 Ga0466967_0246542 3300045976 Bacteria 1705
238 Ga0466967_0471369 3300045976 Bacteria 1229
239 Ga0495629_0018265 3300046459 Bacteria 5022
240 Ga0495582_0148781 3300046473 Bacteria 1329
241 Ga0495594_0485009 3300046499 Bacteria 702
242 Ga0495618_0642255 3300046514 Unclassified 628
243 Ga0495630_0236403 3300046517 Bacteria 1396
244 Ga0495644_0051813 3300046523 Bacteria 1541
245 Ga0495665_0213328 3300046531 Bacteria 999
246 Ga0495586_0125267 3300046535 Unclassified 1437
247 Ga0495656_0029413 3300046615 Bacteria 2212
248 Ga0495634_0068713 3300046642 Bacteria 2339
249 Ga0495613_0072830 3300046689 Bacteria 2504
250 Ga0495674_0118918 3300047319 Bacteria 2234
251 Ga0495672_0007457 3300047320 Bacteria 8227
252 Ga0495676_0109865 3300047321 Bacteria 2025
253 Ga0496100_0027755 3300048903 Bacteria 3484
254 Ga0496100_0495869 3300048903 Bacteria 940
255 Ga0496101_0086267 3300048904 Bacteria 2328
256 Ga0496101_0347750 3300048904 Bacteria 1165
257 Ga0496101_0609036 3300048904 Bacteria 863
258 Ga0496102_0047810 3300048905 Bacteria 3889
259 Ga0496102_0113584 3300048905 Bacteria 2527
260 Ga0496102_0179019 3300048905 Bacteria 1997
261 Ga0496104_0055459 3300048907 Bacteria 3747
262 Ga0496104_0218016 3300048907 Bacteria 1820
263 Ga0496104_0247278 3300048907 Bacteria 1696
264 Ga0496104_0744906 3300048907 Unclassified 887
265 Ga0496105_0019892 3300048908 Bacteria 5418
266 Ga0496105_0161249 3300048908 Bacteria 1841
267 Ga0496105_0200928 3300048908 Bacteria 1627
268 Ga0496106_0028516 3300048909 Bacteria 4158
269 Ga0496107_0037415 3300048910 Bacteria 3482
270 Ga0496107_0076791 3300048910 Bacteria 2433
271 Ga0496107_0088591 3300048910 Bacteria 2259
272 Ga0496108_0005534 3300048911 Bacteria 10220
273 Ga0496108_0007021 3300048911 Bacteria 9119
274 Ga0496108_0013874 3300048911 Bacteria 6572
275 Ga0496108_0216711 3300048911 Bacteria 1662
276 Ga0496108_0294722 3300048911 Bacteria 1413
277 Ga0496108_0418501 3300048911 Bacteria 1170
278 Ga0496108_0563896 3300048911 Bacteria 993
279 Ga0496109_0001184 3300048912 Bacteria 21648
280 Ga0496109_0002433 3300048912 Bacteria 15585
281 Ga0496109_0025985 3300048912 Bacteria 5218
282 Ga0496109_0077245 3300048912 Bacteria 3064
283 Ga0496109_0289498 3300048912 Bacteria 1544
284 Ga0496109_0320357 3300048912 Bacteria 1463
285 Ga0496109_0587242 3300048912 Bacteria 1050
286 Ga0496110_0000295 3300048913 Bacteria 32671
287 Ga0496110_0003923 3300048913 Bacteria 11444
288 Ga0496110_0005461 3300048913 Bacteria 9971
289 Ga0496110_0033152 3300048913 Bacteria 4465
290 Ga0496110_0061229 3300048913 Bacteria 3321
291 Ga0496111_0000688 3300048914 Bacteria 17832
292 Ga0496111_0001191 3300048914 Bacteria 14498
293 Ga0496111_0003284 3300048914 Bacteria 9992
294 Ga0496111_0048784 3300048914 Bacteria 3051
295 Ga0496111_0353336 3300048914 Bacteria 1088
296 Ga0496112_0058815 3300048915 Bacteria 3786
297 Ga0496112_0096651 3300048915 Bacteria 2924
298 Ga0496112_0130297 3300048915 Bacteria 2486
299 Ga0496112_0144709 3300048915 Bacteria 2345
300 Ga0496112_0274144 3300048915 Bacteria 1635
301 Ga0496112_0275041 3300048915 Bacteria 1632
302 Ga0496112_0390079 3300048915 Bacteria 1333
303 Ga0496112_0605786 3300048915 Bacteria 1027
304 Ga0496113_0027746 3300048916 Bacteria 4063
305 Ga0496113_0038190 3300048916 Bacteria 3530
306 Ga0496113_0050383 3300048916 Bacteria 3104
307 Ga0496113_0132177 3300048916 Bacteria 1959
308 Ga0496114_0055606 3300048917 Bacteria 3301
309 Ga0496114_0441582 3300048917 Bacteria 1152
310 Ga0496114_0522702 3300048917 Bacteria 1049
311 Ga0496115_0076133 3300048918 Bacteria 2727
312 Ga0496124_0075559 3300048927 Bacteria 2783
313 Ga0501031_0000472 3300049568 Bacteria 23386
314 Ga0501031_0010960 3300049568 Bacteria 5906
315 Ga0501031_0167978 3300049568 Bacteria 1433
316 Ga0501032_0049040 3300049569 Bacteria 2850
317 Ga0501032_0173566 3300049569 Bacteria 1413
318 Ga0501033_0036087 3300049570 Bacteria 3705
319 Ga0501033_0045182 3300049570 Bacteria 3279
320 Ga0501033_0343978 3300049570 Bacteria 1045
321 Ga0501036_0025668 3300049572 Bacteria 4972
322 Ga0501036_0032546 3300049572 Bacteria 4406
323 Ga0501036_0088897 3300049572 Bacteria 2610
324 Ga0501036_0344599 3300049572 Bacteria 1244
325 Ga0501037_0056556 3300049573 Bacteria 2864
326 Ga0501037_0282384 3300049573 Bacteria 1156
327 Ga0501038_0010702 3300049574 Bacteria 8388
328 Ga0501038_0014194 3300049574 Bacteria 7257
329 Ga0501038_0071153 3300049574 Bacteria 2951
330 Ga0501038_0092003 3300049574 Bacteria 2540
331 Ga0501039_0031873 3300049575 Bacteria 4063
332 Ga0501039_0066383 3300049575 Bacteria 2800
333 Ga0501039_0075917 3300049575 Bacteria 2613
334 Ga0501039_0159625 3300049575 Bacteria 1772
335 Ga0501040_0004783 3300049576 Bacteria 8786
336 Ga0501040_0006862 3300049576 Bacteria 7379
337 Ga0501040_0017064 3300049576 Bacteria 4816
338 Ga0501040_0160904 3300049576 Bacteria 1587
339 Ga0501040_0335925 3300049576 Bacteria 1081
340 Ga0501041_0005307 3300049577 Bacteria 7536
341 Ga0501041_0011535 3300049577 Bacteria 5225
342 Ga0501041_0026966 3300049577 Bacteria 3460
343 Ga0501041_0135376 3300049577 Bacteria 1535
344 Ga0501042_0025734 3300049578 Bacteria 4135
345 Ga0501042_0073446 3300049578 Bacteria 2446
346 Ga0501042_0188774 3300049578 Bacteria 1486
347 Ga0501043_0098871 3300049579 Bacteria 2294
348 Ga0501043_0185336 3300049579 Bacteria 1620
349 Ga0501043_0260403 3300049579 Bacteria 1334
350 Ga0501046_0004270 3300049580 Bacteria 13012
351 Ga0501046_0045249 3300049580 Bacteria 3498
352 Ga0501046_0196030 3300049580 Bacteria 1504
353 Ga0501048_0000291 3300049582 Bacteria 34151
354 Ga0501048_0032378 3300049582 Bacteria 3778
355 Ga0501048_0066063 3300049582 Bacteria 2557
356 Ga0501048_0084999 3300049582 Bacteria 2231
357 Ga0501048_0442120 3300049582 Bacteria 931
358 Ga0501068_0007758 3300049584 Bacteria 5944
359 Ga0501068_0024640 3300049584 Bacteria 3534
360 Ga0501068_0031038 3300049584 Bacteria 3173
361 Ga0501068_0044968 3300049584 Bacteria 2660
362 Ga0501069_0020410 3300049585 Bacteria 3590
363 Ga0501069_0049174 3300049585 Bacteria 2343
364 Ga0501069_0155026 3300049585 Bacteria 1317
365 Ga0501070_0014142 3300049586 Bacteria 6716
366 Ga0501070_0032158 3300049586 Bacteria 4392
367 Ga0501071_0000863 3300049587 Bacteria 16333
368 Ga0501071_0027980 3300049587 Bacteria 3969
369 Ga0501071_0031979 3300049587 Bacteria 3733
370 Ga0501071_0055085 3300049587 Bacteria 2870
371 Ga0501071_0112787 3300049587 Bacteria 2010
372 Ga0501072_0004058 3300049588 Bacteria 11086
373 Ga0501072_0004088 3300049588 Bacteria 11041
374 Ga0501072_0017716 3300049588 Bacteria 5477
375 Ga0501072_0055030 3300049588 Bacteria 3136
376 Ga0501072_0067973 3300049588 Bacteria 2812
377 Ga0501073_0159645 3300049589 Bacteria 1562
378 Ga0501073_0231469 3300049589 Bacteria 1276
379 Ga0501073_0724163 3300049589 Bacteria 686
380 Ga0501074_0005662 3300049590 Bacteria 9003
381 Ga0501074_0011159 3300049590 Bacteria 6527
382 Ga0501074_0012472 3300049590 Bacteria 6177
383 Ga0501075_0002451 3300049591 Bacteria 12364
384 Ga0501075_0012643 3300049591 Bacteria 6003
385 Ga0501075_0016444 3300049591 Bacteria 5330
386 Ga0501075_0053799 3300049591 Bacteria 3027
387 Ga0501075_0124752 3300049591 Bacteria 1960
388 Ga0501075_0198537 3300049591 Bacteria 1530
389 Ga0501076_0003419 3300049592 Bacteria 11132
390 Ga0501076_0005028 3300049592 Bacteria 9461
391 Ga0501076_0008899 3300049592 Bacteria 7386
392 Ga0501076_0042421 3300049592 Bacteria 3581
393 Ga0501076_0364301 3300049592 Bacteria 1187
394 Ga0501076_0502229 3300049592 Bacteria 1000
395 Ga0501077_0032655 3300049593 Bacteria 3313
396 Ga0501077_0041700 3300049593 Bacteria 2920
397 Ga0501077_0090645 3300049593 Bacteria 1937
398 Ga0501077_0095317 3300049593 Bacteria 1886
399 Ga0501079_0013666 3300049741 Bacteria 6191
400 Ga0501079_0030178 3300049741 Bacteria 4166
401 Ga0501079_0038088 3300049741 Bacteria 3708
402 Ga0501079_0065629 3300049741 Bacteria 2800
403 Ga0501080_0015752 3300049742 Bacteria 6973
404 Ga0501080_0067409 3300049742 Bacteria 3328
405 Ga0501080_0108847 3300049742 Bacteria 2568
406 Ga0501080_0163713 3300049742 Bacteria 2053
407 Ga0501081_0005783 3300049743 Bacteria 8007
408 Ga0501081_0009533 3300049743 Bacteria 6331
409 Ga0501081_0016956 3300049743 Bacteria 4814
410 Ga0501081_0029652 3300049743 Bacteria 3698
411 Ga0501081_0082265 3300049743 Bacteria 2255
412 Ga0501083_0045147 3300049744 Bacteria 2981
413 Ga0501083_0104226 3300049744 Bacteria 1869
414 Ga0501083_0406666 3300049744 Bacteria 886
415 Ga0501035_0005720 3300049822 Bacteria 11725
416 Ga0501035_0065895 3300049822 Bacteria 3215
417 Ga0501035_0095785 3300049822 Bacteria 2609
418 Ga0501035_0115251 3300049822 Bacteria 2352
419 Ga0501044_0760012 3300049823 Bacteria 851
420 Ga0501045_0000333 3300049824 Bacteria 27815
421 Ga0501045_0001389 3300049824 Bacteria 16150
422 Ga0501045_0032047 3300049824 Bacteria 3807
423 nmdc:mga03n38_174026_c1 3300050490 Bacteria 1098
424 nmdc:mga0yw44_50152_c1 3300050492 Bacteria 2523
425 nmdc:mga06z11_182577_c1 3300050494 Bacteria 1210
426 nmdc:mga04h51_67313_c1 3300050495 Bacteria 1242
427 nmdc:mga05p37_351381_c1 3300050507 Bacteria 1736
428 nmdc:mga05p37_545936_c1 3300050507 Bacteria 1320
429 nmdc:mga09592_315291_c1 3300050508 Bacteria 1355
430 nmdc:mga0qj67_5646_c1 3300050509 Bacteria 9150
431 nmdc:mga08y16_162846_c1 3300050511 Bacteria 2318
432 nmdc:mga08y16_47256_c1 3300050511 Bacteria 4505
433 nmdc:mga08y16_90973_c1 3300050511 Bacteria 3180
434 Ga0501084_0002562 3300054114 Bacteria 14642
435 Ga0501084_0021851 3300054114 Bacteria 5336
436 Ga0501084_0026286 3300054114 Bacteria 4855
437 Ga0501084_0036925 3300054114 Bacteria 4082
438 Ga0501084_0070626 3300054114 Bacteria 2923
439 Ga0501084_0106986 3300054114 Bacteria 2350
440 Ga0501084_0432038 3300054114 Bacteria 1113
441 Ga0501082_0012032 3300060353 Bacteria 7438
442 Ga0501082_0076344 3300060353 Bacteria 2888
443 Ga0501082_0083744 3300060353 Bacteria 2751
444 Ga0501082_0091187 3300060353 Bacteria 2631
445 Ga0466962_0022016 3300061719 Bacteria 3062
446 Ga0530510_0011844 3300061734 Bacteria 6121
447 Ga0530510_0016922 3300061734 Bacteria 5164
448 Ga0530510_0031515 3300061734 Bacteria 3812
449 Ga0530510_0078088 3300061734 Bacteria 2406
450 Ga0530510_0218775 3300061734 Bacteria 1415
451 Ga0530510_0306410 3300061734 Bacteria 1189
452 Ga0501044_0363157
453 ARSoilOldRDRAFT_c002325
454 JGI24739J22299_10043290
455 Ga0070658_10125013
456 Ga0070658_10403762
457 Ga0070683_100012389
458 Ga0070683_100045839
459 Ga0070683_100200035
460 Ga0070683_100474877
461 Ga0070670_100099704
462 Ga0070680_100010423
463 Ga0070680_100148800
464 Ga0070682_100001938
465 Ga0070682_100266811
466 Ga0070682_100276631
467 Ga0068868_100052013
468 Ga0070660_100027047
469 Ga0070660_100048345
470 Ga0070660_100186375
471 Ga0070660_100442056
472 Ga0070691_10038218
473 Ga0070692_10014948
474 Ga0070669_100006327
475 Ga0070675_100041107
476 Ga0070671_100228444
477 Ga0070674_100053826
478 Ga0070673_100406759
479 Ga0070659_100000037
480 Ga0070659_100367626
481 Ga0070659_100425809
482 Ga0070709_10668146
483 Ga0070714_100226180
484 Ga0070710_10000004
485 Ga0070700_100068517
486 Ga0070700_100167790
487 Ga0070694_100593713
488 Ga0070678_100077407
489 Ga0070678_100444063
490 Ga0070678_100868700
491 Ga0070662_100022650
492 Ga0070681_10082379
493 Ga0070681_10178251
494 Ga0070685_10279215
495 Ga0070698_100035274
496 Ga0070699_100020628
497 Ga0070699_100517094
498 Ga0070679_100008627
499 Ga0070679_100083838
500 Ga0070679_100487539
501 Ga0070684_100008837
502 Ga0070684_100344805
503 Ga0070684_100688498
504 Ga0070684_100780093
505 Ga0068853_100347032
506 Ga0070693_100036595
507 Ga0070665_100001101
508 Ga0070704_100030617
509 Ga0070704_100480615
510 Ga0070664_100040282
511 Ga0068857_100037242
512 Ga0068856_100007544
513 Ga0070702_100104215
514 Ga0068852_100543680
515 Ga0068861_100358896
516 Ga0068870_10218218
517 Ga0081455_10048893
518 Ga0081455_10167011
519 Ga0081455_10176876
520 Ga0081455_10194927
521 Ga0081455_10205148
522 Ga0070717_10015274
523 Ga0075365_10038903
524 Ga0075368_10113692
525 Ga0075363_100125110
526 Ga0075364_10074727
527 Ga0070712_100151511
528 Ga0075367_10153879
529 Ga0075370_10086936
530 Ga0075428_100002047
531 Ga0075430_100002970
532 Ga0075430_100152134
533 Ga0075429_100106248
534 Ga0068865_100549271
535 Ga0105240_10228599
536 Ga0111539_10066668
537 Ga0111539_10427872
538 Ga0111539_10596462
539 Ga0105245_10001062
540 Ga0105245_10510380
541 Ga0105245_10569272
542 Ga0105245_10611647
543 Ga0105245_10680476
544 Ga0114129_10005183
545 Ga0114129_10669380
546 Ga0114129_10719886
547 Ga0105243_10095047
548 Ga0105242_10618027
549 Ga0105237_10160257
550 Ga0105238_10167182
551 Ga0105249_10684780
552 Ga0105239_10025303
553 Ga0105246_10161552
554 Ga0105246_10404525
555 Ga0105246_10506908
556 Ga0157373_10223827
557 Ga0157370_10235472
558 Ga0157369_10014930
559 Ga0157374_10077699
560 Ga0157372_10018666
561 Ga0157372_10158725
562 Ga0157372_10230783
563 Ga0157375_11241725
564 Ga0157375_11720222
565 Ga0157380_10525863
566 Ga0157377_10044865
567 Ga0157377_10065677
568 Ga0157376_10037321
569 Ga0206356_10076763
570 Ga0206353_10214256
571 Ga0213875_10000039
572 Ga0207692_10000002
573 Ga0207688_10035434
574 Ga0207643_10055320
575 Ga0207643_10082453
576 Ga0207707_10011821
577 Ga0207707_10092884
578 Ga0207693_10407148
579 Ga0207663_10407697
580 Ga0207660_10128651
581 Ga0207657_10036721
582 Ga0207657_10063578
583 Ga0207657_10088288
584 Ga0207649_10211259
585 Ga0207652_10001925
586 Ga0207652_10054287
587 Ga0207652_10411392
588 Ga0207646_10323252
589 Ga0207681_10004529
590 Ga0207694_10131917
591 Ga0207659_10090004
592 Ga0207659_10525781
593 Ga0207687_10293939
594 Ga0207664_10266795
595 Ga0207644_10332379
596 Ga0207690_10000404
597 Ga0207690_10334469
598 Ga0207706_10290620
599 Ga0207706_10447236
600 Ga0207709_10155089
601 Ga0207669_10081550
602 Ga0207704_10194710
603 Ga0207691_10054356
604 Ga0207661_10000167
605 Ga0207661_10042516
606 Ga0207661_10148992
607 Ga0207667_10287744
608 Ga0207668_10008716
609 Ga0207677_10058007
610 Ga0207677_10113588
611 Ga0207639_10260944
612 Ga0207708_10039294
613 Ga0207708_10044735
614 Ga0207702_10010285
615 Ga0207702_10504974
616 Ga0207702_10580079
617 Ga0207648_10087287
618 Ga0207648_10682835
619 Ga0207674_10164165
620 Ga0207674_10390397
621 Ga0207675_100415627
622 Ga0207683_10281935
623 Ga0207698_10288127
624 Ga0207698_10347025
625 Ga0207428_10000327
626 Ga0268266_10003738
627 Ga0268266_10071841
628 Ga0268264_10836953
629 Ga0265319_1006947
630 Ga0265334_10020057
631 Ga0265334_10056028
632 Ga0265318_10004101
633 Ga0265318_10005549
634 Ga0265322_10035041
635 Ga0265338_10076065
636 Ga0265338_10091110
637 Ga0265320_10017081
638 Ga0265325_10076345
639 Ga0265329_10035697
640 Ga0265331_10045744
641 Ga0265327_10040633
642 Ga0265316_10054248
643 Ga0265314_10034922
644 Ga0265314_10040139
645 Ga0265342_10074004
646 Ga0307405_10031616
647 Ga0307410_10249781
648 Ga0307406_10065201
649 Ga0307406_10240278
650 Ga0307412_10044340
651 Ga0307409_100008998
652 Ga0307409_100027563
653 Ga0307415_100053576
654 Ga0307415_100098518
655 Ga0307415_100454053
656 Ga0373959_0003532
657 Ga0373960_0071808
658 Ga0373931_0035948
659 Ga0373925_0185940
660 Ga0395899_0225289
661 Ga0395900_0010458
662 Ga0395900_0169647
663 Ga0395900_0296262
664 Ga0395898_0015967
665 Ga0395898_0119496
666 Ga0395905_0128446
667 Ga0395905_0409698
668 Ga0436364_1255310
669 Ga0395901_0002874
670 Ga0395901_0576501
671 Ga0436363_0273228
672 Ga0450910_023814
673 Ga0466969_0062360
674 Ga0466966_0015595
675 Ga0466966_0090586
676 Ga0466966_0174147
677 Ga0466961_0119529
678 Ga0466963_0004742
679 Ga0466964_0016368
680 Ga0466970_0022640
681 Ga0466970_0305100
682 Ga0466960_0007711
683 Ga0466959_0021682
684 Ga0466959_0073681
685 Ga0466967_0029456
686 Ga0466967_0092574
687 Ga0466967_0191704
688 Ga0466967_0246542
689 Ga0466967_0471369
690 Ga0495629_0018265
691 Ga0495582_0148781
692 Ga0495594_0485009
693 Ga0495618_0642255
694 Ga0495630_0236403
695 Ga0495644_0051813
696 Ga0495665_0213328
697 Ga0495586_0125267
698 Ga0495656_0029413
699 Ga0495634_0068713
700 Ga0495613_0072830
701 Ga0495674_0118918
702 Ga0495672_0007457
703 Ga0495676_0109865
704 Ga0496100_0027755
705 Ga0496100_0495869
706 Ga0496101_0086267
707 Ga0496101_0347750
708 Ga0496101_0609036
709 Ga0496102_0047810
710 Ga0496102_0113584
711 Ga0496102_0179019
712 Ga0496104_0055459
713 Ga0496104_0218016
714 Ga0496104_0247278
715 Ga0496104_0744906
716 Ga0496105_0019892
717 Ga0496105_0161249
718 Ga0496105_0200928
719 Ga0496106_0028516
720 Ga0496107_0037415
721 Ga0496107_0076791
722 Ga0496107_0088591
723 Ga0496108_0005534
724 Ga0496108_0007021
725 Ga0496108_0013874
726 Ga0496108_0216711
727 Ga0496108_0294722
728 Ga0496108_0418501
729 Ga0496108_0563896
730 Ga0496109_0001184
731 Ga0496109_0002433
732 Ga0496109_0025985
733 Ga0496109_0077245
734 Ga0496109_0289498
735 Ga0496109_0320357
736 Ga0496109_0587242
737 Ga0496110_0000295
738 Ga0496110_0003923
739 Ga0496110_0005461
740 Ga0496110_0033152
741 Ga0496110_0061229
742 Ga0496111_0000688
743 Ga0496111_0001191
744 Ga0496111_0003284
745 Ga0496111_0048784
746 Ga0496111_0353336
747 Ga0496112_0058815
748 Ga0496112_0096651
749 Ga0496112_0130297
750 Ga0496112_0144709
751 Ga0496112_0274144
752 Ga0496112_0275041
753 Ga0496112_0390079
754 Ga0496112_0605786
755 Ga0496113_0027746
756 Ga0496113_0038190
757 Ga0496113_0050383
758 Ga0496113_0132177
759 Ga0496114_0055606
760 Ga0496114_0441582
761 Ga0496114_0522702
762 Ga0496115_0076133
763 Ga0496124_0075559
764 Ga0501031_0000472
765 Ga0501031_0010960
766 Ga0501031_0167978
767 Ga0501032_0049040
768 Ga0501032_0173566
769 Ga0501033_0036087
770 Ga0501033_0045182
771 Ga0501033_0343978
772 Ga0501036_0025668
773 Ga0501036_0032546
774 Ga0501036_0088897
775 Ga0501036_0344599
776 Ga0501037_0056556
777 Ga0501037_0282384
778 Ga0501038_0010702
779 Ga0501038_0014194
780 Ga0501038_0071153
781 Ga0501038_0092003
782 Ga0501039_0031873
783 Ga0501039_0066383
784 Ga0501039_0075917
785 Ga0501039_0159625
786 Ga0501040_0004783
787 Ga0501040_0006862
788 Ga0501040_0017064
789 Ga0501040_0160904
790 Ga0501040_0335925
791 Ga0501041_0005307
792 Ga0501041_0011535
793 Ga0501041_0026966
794 Ga0501041_0135376
795 Ga0501042_0025734
796 Ga0501042_0073446
797 Ga0501042_0188774
798 Ga0501043_0098871
799 Ga0501043_0185336
800 Ga0501043_0260403
801 Ga0501046_0004270
802 Ga0501046_0045249
803 Ga0501046_0196030
804 Ga0501048_0000291
805 Ga0501048_0032378
806 Ga0501048_0066063
807 Ga0501048_0084999
808 Ga0501048_0442120
809 Ga0501068_0007758
810 Ga0501068_0024640
811 Ga0501068_0031038
812 Ga0501068_0044968
813 Ga0501069_0020410
814 Ga0501069_0049174
815 Ga0501069_0155026
816 Ga0501070_0014142
817 Ga0501070_0032158
818 Ga0501071_0000863
819 Ga0501071_0027980
820 Ga0501071_0031979
821 Ga0501071_0055085
822 Ga0501071_0112787
823 Ga0501072_0004058
824 Ga0501072_0004088
825 Ga0501072_0017716
826 Ga0501072_0055030
827 Ga0501072_0067973
828 Ga0501073_0159645
829 Ga0501073_0231469
830 Ga0501073_0724163
831 Ga0501074_0005662
832 Ga0501074_0011159
833 Ga0501074_0012472
834 Ga0501075_0002451
835 Ga0501075_0012643
836 Ga0501075_0016444
837 Ga0501075_0053799
838 Ga0501075_0124752
839 Ga0501075_0198537
840 Ga0501076_0003419
841 Ga0501076_0005028
842 Ga0501076_0008899
843 Ga0501076_0042421
844 Ga0501076_0364301
845 Ga0501076_0502229
846 Ga0501077_0032655
847 Ga0501077_0041700
848 Ga0501077_0090645
849 Ga0501077_0095317
850 Ga0501079_0013666
851 Ga0501079_0030178
852 Ga0501079_0038088
853 Ga0501079_0065629
854 Ga0501080_0015752
855 Ga0501080_0067409
856 Ga0501080_0108847
857 Ga0501080_0163713
858 Ga0501081_0005783
859 Ga0501081_0009533
860 Ga0501081_0016956
861 Ga0501081_0029652
862 Ga0501081_0082265
863 Ga0501083_0045147
864 Ga0501083_0104226
865 Ga0501083_0406666
866 Ga0501035_0005720
867 Ga0501035_0065895
868 Ga0501035_0095785
869 Ga0501035_0115251
870 Ga0501044_0760012
871 Ga0501045_0000333
872 Ga0501045_0001389
873 Ga0501045_0032047
874 nmdc:mga03n38_174026_c1
875 nmdc:mga0yw44_50152_c1
876 nmdc:mga06z11_182577_c1
877 nmdc:mga04h51_67313_c1
878 nmdc:mga05p37_351381_c1
879 nmdc:mga05p37_545936_c1
880 nmdc:mga09592_315291_c1
881 nmdc:mga0qj67_5646_c1
882 nmdc:mga08y16_162846_c1
883 nmdc:mga08y16_47256_c1
884 nmdc:mga08y16_90973_c1
885 Ga0501084_0002562
886 Ga0501084_0021851
887 Ga0501084_0026286
888 Ga0501084_0036925
889 Ga0501084_0070626
890 Ga0501084_0106986
891 Ga0501084_0432038
892 Ga0501082_0012032
893 Ga0501082_0076344
894 Ga0501082_0083744
895 Ga0501082_0091187
896 Ga0466962_0022016
897 Ga0530510_0011844
898 Ga0530510_0016922
899 Ga0530510_0031515
900 Ga0530510_0078088
901 Ga0530510_0218775
902 Ga0530510_0306410

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

50

230

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.8651 39 222
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8473 35 231
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.8286 44 234
7ahc-assembly1.cif.gz_B opua apo inward-facing 0.8206 36 222
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.8082 48 234
ID Description Score Start End Superfamily
af_Q47539_71_268_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.941 48 234 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9408 41 231 1.10.3720.10
af_P14176_140_330_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9183 45 231 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9179 41 231 1.10.3720.10
af_O69722_23_210_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.904 44 229 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7L4YTD3-F1-model_v4 ABC transporter permease subunit 0.9493 11 240 GO:0005886
GO:0031460
GO:0055085
AF-A0A1D8G493-F1-model_v4 Carnitine transport permease protein OpuCB 0.9458 24 241 GO:0005886
GO:0031460
GO:0055085
AF-A0A7Z6XIU3-F1-model_v4 ABC transporter permease 0.9423 47 239 GO:0005886
GO:0031460
GO:0055085
AF-A0A0M8VJR2-F1-model_v4 ABC transporter permease 0.9415 47 240 GO:0005886
GO:0031460
GO:0055085
AF-A0A1E7LAL4-F1-model_v4 ABC transporter permease 0.9403 29 238 GO:0005886
GO:0031460
GO:0055085

Map