F446899

General Info

Members Datasets Scaffolds Average Seq Length
451 293 902 155

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8003400568|8003401080
Length 172
Sequence IQRVARASVTVDGRVTGEIGAGLLALVCAERGDTESEAERLLAKLLGYRVFSDAAGKMNLPVRDIDGQGTPGGLLVVSQFTLAADTNSGTRPSFTPAASPQDGRRLYEHFVARARAAHPEVQTGEFGAMMQVSLVNDGPVTFWLRVPPSSPPPSPSSVPFRPSSTPPRAANP

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
6 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
14 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
15 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
16 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
17 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
18 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
19 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
20 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
21 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
22 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
23 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
24 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
25 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
26 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
50 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
51 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
52 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
63 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
67 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
68 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
69 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
78 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
79 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
82 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
83 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
109 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
112 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
117 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
118 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
119 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
124 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
125 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
126 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
127 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
133 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
134 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
135 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
136 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
137 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
138 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
139 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044650 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E Metagenome Unclassified
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
144 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
145 3300044671 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E Metagenome Unclassified
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
152 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
153 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
158 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
167 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
168 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
169 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
170 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
173 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
174 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
175 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
176 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
177 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
178 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
179 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
180 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
181 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
182 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
200 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
201 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
207 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
208 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
209 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
210 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
215 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
249 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
250 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
257 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
258 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
259 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
260 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
261 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
262 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
263 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
264 2596583598 Ralstonia sp. UNCCL144 Isolate Unclassified
265 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
266 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
267 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
268 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
269 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
270 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
271 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
272 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
273 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
274 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
275 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
276 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
277 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
278 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
279 2885266251 Ralstonia sp. SET104 Isolate Nodule
280 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
281 2900577576 Ralstonia sp. TCR112 Isolate Rhizosphere
282 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
283 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
284 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
285 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
286 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
287 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
288 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
289 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
290 2928058823 Ralstonia sp. 1138 Isolate Unclassified
291 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
292 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
293 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.91
Metatranscriptomes 0.89
Isolates 8.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.73
Nodule 2.44
Rhizoplane 0.67
Rhizosphere 65.85
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10002290 3300001979 Bacteria 8705
2 JGI24740J21852_10002535 3300001979 Bacteria 8244
3 JGI25155J39150_1000918 3300002704 Bacteria 3920
4 JGI25156J39149_1000453 3300002705 Bacteria 24978
5 JGI25154J39366_1000767 3300002738 Bacteria 14236
6 JGI25157J39369_1000350 3300002741 Bacteria 32509
7 JGI25151J46595_10004512 3300003187 Bacteria 7352
8 JGI25151J46595_10005793 3300003187 Bacteria 6324
9 rootH1_10063653 3300003316 Bacteria 3308
10 rootL2_10068963 3300003322 Bacteria 1099
11 rootL2_10221673 3300003322 Bacteria 1250
12 rootH1_10234802 3300003323 Bacteria 2219
13 Ga0055538_1000010 3300003751 Bacteria 376599
14 Ga0055538_1006843 3300003751 Bacteria 1079
15 Ga0055539_1000015 3300003752 Bacteria 376599
16 Ga0055539_1000230 3300003752 Bacteria 39333
17 Ga0055533_1000018 3300003756 Bacteria 376599
18 Ga0055532_1000006 3300003758 Bacteria 451244
19 Ga0055532_1000018 3300003758 Bacteria 305466
20 Ga0055532_1001886 3300003758 Bacteria 5060
21 Ga0055525_1000020 3300003759 Bacteria 376599
22 Ga0055525_1001288 3300003759 Bacteria 5164
23 Ga0055527_1001187 3300003760 Bacteria 5895
24 Ga0055535_1000004 3300003761 Bacteria 451244
25 Ga0055535_1002317 3300003761 Bacteria 6942
26 Ga0055535_1012186 3300003761 Bacteria 1323
27 Ga0055542_1002199 3300003762 Bacteria 6942
28 Ga0055529_1000022 3300003763 Bacteria 320108
29 Ga0055529_1000625 3300003763 Bacteria 26308
30 Ga0055526_1005208 3300003771 Bacteria 7552
31 Ga0055526_1005987 3300003771 Bacteria 6759
32 Ga0055526_1010584 3300003771 Bacteria 4272
33 Ga0055526_1025217 3300003771 Bacteria 1914
34 Ga0055537_1014387 3300003773 Bacteria 1439
35 Ga0055524_1000300 3300003775 Bacteria 47498
36 Ga0055524_1015271 3300003775 Bacteria 2807
37 Ga0055536_1000110 3300003781 Bacteria 72378
38 Ga0055534_1001581 3300003784 Bacteria 8839
39 Ga0055534_1007859 3300003784 Bacteria 2484
40 Ga0055528_1001544 3300003790 Bacteria 13858
41 Ga0055541_1000011 3300003841 Bacteria 376599
42 Ga0055541_1000983 3300003841 Bacteria 6680
43 Ga0055541_1010345 3300003841 Bacteria 1409
44 Ga0070670_100194855 3300005331 Bacteria 1760
45 Ga0070680_100163204 3300005336 Bacteria 1873
46 Ga0070660_100163369 3300005339 Bacteria 1795
47 Ga0070689_100173987 3300005340 Bacteria 1745
48 Ga0070689_101432740 3300005340 Bacteria 625
49 Ga0070661_100000012 3300005344 Bacteria 167998
50 Ga0070659_100002113 3300005366 Bacteria 14157
51 Ga0070714_101775385 3300005435 Bacteria 602
52 Ga0070713_101288200 3300005436 Bacteria 708
53 Ga0070663_100000003 3300005455 Bacteria 260492
54 Ga0070699_100161893 3300005518 Bacteria 1981
55 Ga0068855_100002320 3300005563 Bacteria 23525
56 Ga0068855_100022029 3300005563 Bacteria 7639
57 Ga0068855_100286390 3300005563 Bacteria 1828
58 Ga0070664_100000003 3300005564 Bacteria 325604
59 Ga0068857_100031165 3300005577 Bacteria 4712
60 Ga0068857_100636644 3300005577 Bacteria 1010
61 Ga0068854_100000063 3300005578 Bacteria 77198
62 Ga0068854_100011534 3300005578 Bacteria 5760
63 Ga0068856_100000011 3300005614 Bacteria 170419
64 Ga0068856_100234912 3300005614 Bacteria 1849
65 Ga0068856_100306155 3300005614 Bacteria 1607
66 Ga0070702_100055242 3300005615 Bacteria 2289
67 Ga0068852_100316822 3300005616 Bacteria 1514
68 Ga0068852_100435807 3300005616 Bacteria 1295
69 Ga0068860_100978866 3300005843 Unclassified 863
70 Ga0068862_100572072 3300005844 Bacteria 1081
71 Ga0075428_100068497 3300006844 Bacteria 3882
72 Ga0075428_100169999 3300006844 Bacteria 2363
73 Ga0075428_100966215 3300006844 Bacteria 902
74 Ga0075430_100020692 3300006846 Bacteria 5596
75 Ga0075430_100041998 3300006846 Bacteria 3867
76 Ga0075431_100194759 3300006847 Bacteria 2075
77 Ga0075431_100817197 3300006847 Bacteria 905
78 Ga0075429_100048252 3300006880 Bacteria 3703
79 Ga0079104_1020736 3300006946 Bacteria 1804
80 Ga0099826_10000014 3300006948 Bacteria 258520
81 Ga0105244_10058126 3300009036 Bacteria 1953
82 Ga0105240_10049734 3300009093 Bacteria 5289
83 Ga0114129_10107505 3300009147 Bacteria 3853
84 Ga0114129_11475783 3300009147 Bacteria 836
85 Ga0105237_10003535 3300009545 Bacteria 18521
86 Ga0105237_10141792 3300009545 Bacteria 2397
87 Ga0105238_10000004 3300009551 Bacteria 390514
88 Ga0105239_10001658 3300010375 Bacteria 29346
89 Ga0157373_10003075 3300013100 Bacteria 12601
90 Ga0157371_10000083 3300013102 Bacteria 149633
91 Ga0157371_10034044 3300013102 Bacteria 3658
92 Ga0157371_10101853 3300013102 Bacteria 2037
93 Ga0157370_10000141 3300013104 Bacteria 87406
94 Ga0157370_10701583 3300013104 Bacteria 924
95 Ga0157369_10005761 3300013105 Bacteria 14399
96 Ga0157369_10008911 3300013105 Bacteria 11495
97 Ga0157369_10515671 3300013105 Bacteria 1237
98 Ga0157380_11464258 3300014326 Bacteria 735
99 Ga0182008_10113350 3300014497 Bacteria 1344
100 Ga0182006_1002269 3300015261 Bacteria 10613
101 Ga0182006_1008829 3300015261 Bacteria 4552
102 Ga0182006_1035771 3300015261 Bacteria 1977
103 Ga0182006_1067296 3300015261 Bacteria 1337
104 Ga0182007_10047333 3300015262 Bacteria 1422
105 Ga0206351_10566569 3300020077 Bacteria 13430
106 Ga0154015_1250340 3300020610 Bacteria 7819
107 Ga0213872_10022132 3300021361 Bacteria 2927
108 Ga0209435_100007 3300025206 Bacteria 516857
109 Ga0209784_100025 3300025224 Bacteria 376681
110 Ga0209784_100150 3300025224 Bacteria 63516
111 Ga0209784_100322 3300025224 Bacteria 24386
112 Ga0209566_100002 3300025225 Bacteria 2614868
113 Ga0209566_100025 3300025225 Bacteria 376681
114 Ga0209566_100430 3300025225 Bacteria 31511
115 Ga0209566_101454 3300025225 Bacteria 6903
116 Ga0209674_100010 3300025226 Bacteria 1038638
117 Ga0209674_100042 3300025226 Bacteria 376681
118 Ga0209674_100050 3300025226 Bacteria 341738
119 Ga0209672_100028 3300025228 Bacteria 341962
120 Ga0209672_100218 3300025228 Bacteria 44911
121 Ga0209147_100015 3300025229 Bacteria 565073
122 Ga0209147_100017 3300025229 Bacteria 516857
123 Ga0209147_100163 3300025229 Bacteria 90494
124 Ga0209563_100004 3300025230 Bacteria 1814108
125 Ga0209563_100026 3300025230 Bacteria 559453
126 Ga0209563_100046 3300025230 Bacteria 376681
127 Ga0209563_111520 3300025230 Bacteria 1245
128 Ga0209437_100088 3300025233 Bacteria 251174
129 Ga0209258_100021 3300025242 Bacteria 565073
130 Ga0209258_100191 3300025242 Bacteria 125980
131 Ga0209258_100215 3300025242 Bacteria 114444
132 Ga0209646_1000044 3300025246 Bacteria 334596
133 Ga0209646_1000287 3300025246 Bacteria 43455
134 Ga0209026_1000353 3300025250 Bacteria 43358
135 Ga0209677_100007 3300025253 Bacteria 1021332
136 Ga0209677_100027 3300025253 Bacteria 376681
137 Ga0209677_109915 3300025253 Bacteria 1649
138 Ga0209148_1000081 3300025254 Bacteria 273676
139 Ga0209148_1015087 3300025254 Bacteria 1357
140 Ga0209759_1000255 3300025256 Bacteria 78459
141 Ga0209759_1002139 3300025256 Bacteria 9106
142 Ga0209759_1004428 3300025256 Bacteria 5253
143 Ga0209565_1000045 3300025263 Bacteria 226864
144 Ga0209565_1001433 3300025263 Bacteria 10537
145 Ga0209455_1000028 3300025272 Bacteria 565073
146 Ga0209455_1000050 3300025272 Bacteria 373239
147 Ga0209455_1001834 3300025272 Bacteria 8913
148 Ga0209673_1000038 3300025273 Bacteria 312957
149 Ga0209673_1033363 3300025273 Bacteria 1571
150 Ga0209675_1000247 3300025291 Bacteria 53629
151 Ga0209675_1001062 3300025291 Bacteria 17035
152 Ga0209675_1007825 3300025291 Bacteria 4026
153 Ga0209676_1000064 3300025292 Bacteria 321700
154 Ga0209025_1000690 3300025294 Bacteria 57778
155 Ga0209025_1000899 3300025294 Bacteria 46148
156 Ga0209025_1001826 3300025294 Bacteria 25060
157 Ga0209025_1003032 3300025294 Bacteria 16573
158 Ga0209025_1086988 3300025294 Bacteria 1037
159 Ga0209564_1000462 3300025295 Bacteria 68050
160 Ga0209564_1002165 3300025295 Bacteria 16560
161 Ga0209564_1002213 3300025295 Bacteria 16207
162 Ga0209564_1012531 3300025295 Bacteria 3687
163 Ga0209758_1028384 3300025297 Bacteria 2368
164 Ga0209256_1000105 3300025299 Bacteria 188238
165 Ga0209256_1000193 3300025299 Bacteria 117486
166 Ga0209051_1007154 3300025303 Bacteria 6150
167 Ga0207647_10039744 3300025904 Bacteria 2966
168 Ga0207695_10000965 3300025913 Bacteria 51285
169 Ga0207695_10004143 3300025913 Bacteria 19908
170 Ga0207695_10005275 3300025913 Bacteria 17229
171 Ga0207695_10038700 3300025913 Bacteria 5131
172 Ga0207671_10011604 3300025914 Bacteria 7153
173 Ga0207671_10014499 3300025914 Bacteria 6225
174 Ga0207671_10088588 3300025914 Bacteria 2328
175 Ga0207660_10216819 3300025917 Bacteria 1500
176 Ga0207657_10000051 3300025919 Bacteria 109129
177 Ga0207657_10196191 3300025919 Bacteria 1626
178 Ga0207649_10000302 3300025920 Bacteria 37899
179 Ga0207694_10000021 3300025924 Bacteria 300246
180 Ga0207694_10006205 3300025924 Bacteria 9125
181 Ga0207690_10000034 3300025932 Bacteria 149574
182 Ga0207690_10002311 3300025932 Bacteria 11623
183 Ga0207706_11221404 3300025933 Bacteria 624
184 Ga0207679_10000007 3300025945 Bacteria 460140
185 Ga0207679_10388185 3300025945 Bacteria 1225
186 Ga0207667_10002387 3300025949 Bacteria 23501
187 Ga0207667_10007930 3300025949 Bacteria 12673
188 Ga0207667_10015720 3300025949 Bacteria 8583
189 Ga0207640_10000224 3300025981 Bacteria 39760
190 Ga0207640_10319070 3300025981 Bacteria 1236
191 Ga0207678_10000011 3300026067 Bacteria 147685
192 Ga0207678_10000508 3300026067 Bacteria 35274
193 Ga0207702_10000054 3300026078 Bacteria 137192
194 Ga0207702_10265437 3300026078 Bacteria 1618
195 Ga0207702_10623150 3300026078 Bacteria 1060
196 Ga0207702_10914696 3300026078 Bacteria 869
197 Ga0207674_10068543 3300026116 Bacteria 3570
198 Ga0207674_10085333 3300026116 Bacteria 3153
199 Ga0207698_10055626 3300026142 Bacteria 3051
200 Ga0207698_10072858 3300026142 Bacteria 2732
201 Ga0207698_11478002 3300026142 Bacteria 695
202 Ga0209281_1009603 3300027111 Bacteria 2261
203 Ga0209371_1002213 3300027312 Bacteria 11288
204 Ga0209999_1023086 3300027543 Bacteria 1146
205 Ga0209282_1000048 3300027666 Bacteria 111312
206 Ga0209971_1008092 3300027682 Bacteria 2495
207 Ga0209966_1023380 3300027695 Bacteria 1214
208 Ga0209974_10004385 3300027876 Bacteria 5016
209 Ga0268265_10662749 3300028380 Bacteria 1004
210 Ga0268256_1001949 3300030500 Bacteria 11289
211 Ga0265332_10000005 3300031238 Bacteria 377525
212 Ga0265328_10038229 3300031239 Bacteria 1772
213 Ga0265314_10592030 3300031711 Bacteria 572
214 Ga0307406_11820400 3300031901 Bacteria 542
215 Ga0307412_10112062 3300031911 Bacteria 1950
216 Ga0307412_10325234 3300031911 Bacteria 1225
217 Ga0307416_100557373 3300032002 Bacteria 1220
218 Ga0307416_101067953 3300032002 Bacteria 911
219 Ga0307411_10347291 3300032005 Bacteria 1208
220 Ga0307510_10529549 3300033180 Bacteria 623
221 Ga0373953_0225548 3300035117 Bacteria 812
222 Ga0373947_0372692 3300035725 Bacteria 960
223 Ga0373937_0493547 3300036401 Bacteria 1163
224 Ga0395899_0000008 3300037312 Bacteria 567572
225 Ga0395899_0017199 3300037312 Bacteria 5509
226 Ga0395899_0141060 3300037312 Bacteria 1714
227 Ga0395900_0000055 3300037418 Bacteria 219875
228 Ga0395900_0007708 3300037418 Bacteria 11102
229 Ga0395900_0021085 3300037418 Bacteria 6659
230 Ga0395900_0242036 3300037418 Bacteria 1809
231 Ga0395898_0000119 3300037466 Bacteria 209937
232 Ga0395898_0000792 3300037466 Bacteria 53811
233 Ga0395898_0031349 3300037466 Bacteria 5312
234 Ga0395905_0008058 3300037471 Bacteria 10405
235 Ga0395901_0000003 3300038443 Bacteria 701538
236 Ga0395901_0000180 3300038443 Bacteria 81881
237 Ga0395901_0011306 3300038443 Bacteria 9043
238 Ga0436361_0646906 3300039447 Bacteria 15462
239 Ga0436361_1186364 3300039447 Bacteria 1292
240 Ga0439441_000069 3300042001 Bacteria 7942
241 Ga0450896_024987 3300042133 Bacteria 887
242 Ga0439435_0003513 3300042436 Bacteria 3271
243 Ga0439444_0016910 3300042437 Bacteria 1246
244 Ga0439460_0000098 3300042461 Bacteria 14369
245 Ga0450893_0006439 3300042532 Bacteria 1898
246 Ga0451577_0082266 3300042876 Bacteria 2872
247 Ga0451577_1223799 3300042876 Bacteria 669
248 Ga0466986_0134721 3300044650 Bacteria 1680
249 Ga0466969_0036568 3300044656 Bacteria 2480
250 Ga0466969_0060050 3300044656 Bacteria 1848
251 Ga0466972_0071999 3300044658 Bacteria 1648
252 Ga0466973_0065731 3300044659 Bacteria 3256
253 Ga0466978_0126000 3300044671 Bacteria 1578
254 Ga0453683_0445875 3300044673 Bacteria 837
255 Ga0466965_0002158 3300044683 Bacteria 8272
256 Ga0466965_0081959 3300044683 Bacteria 1631
257 Ga0466966_0000016 3300044684 Bacteria 127214
258 Ga0466966_0107383 3300044684 Bacteria 1722
259 Ga0466961_0000380 3300044693 Bacteria 28624
260 Ga0466961_0000829 3300044693 Bacteria 19323
261 Ga0466961_0054526 3300044693 Bacteria 2549
262 Ga0466961_0113975 3300044693 Bacteria 1699
263 Ga0466961_0130595 3300044693 Bacteria 1574
264 Ga0466963_0001462 3300044694 Bacteria 12752
265 Ga0466963_0016895 3300044694 Bacteria 4545
266 Ga0466971_0000717 3300044719 Bacteria 13254
267 Ga0466971_0007862 3300044719 Bacteria 4645
268 Ga0466968_0152201 3300044735 Bacteria 1064
269 Ga0466968_0154713 3300044735 Bacteria 1055
270 Ga0466970_0058088 3300044765 Bacteria 2070
271 Ga0466970_0088865 3300044765 Bacteria 1675
272 Ga0466970_0152758 3300044765 Bacteria 1275
273 Ga0466957_0069912 3300044842 Bacteria 2169
274 Ga0466957_0079255 3300044842 Bacteria 2044
275 Ga0466959_0119331 3300045049 Bacteria 1876
276 Ga0466959_0129415 3300045049 Bacteria 1789
277 Ga0466959_0195781 3300045049 Bacteria 1408
278 Ga0466958_0011200 3300045836 Bacteria 5045
279 Ga0466958_0349657 3300045836 Bacteria 951
280 Ga0466967_0855969 3300045976 Bacteria 903
281 Ga0495590_0001487 3300046457 Bacteria 10085
282 Ga0495651_0581874 3300046462 Bacteria 708
283 Ga0495653_0044938 3300046463 Bacteria 3426
284 Ga0495653_0085361 3300046463 Bacteria 2322
285 Ga0495580_0054003 3300046472 Bacteria 2834
286 Ga0495582_0004506 3300046473 Bacteria 7833
287 Ga0495605_0004939 3300046474 Bacteria 7791
288 Ga0495664_0865445 3300046477 Bacteria 529
289 Ga0495594_0011918 3300046499 Bacteria 4523
290 Ga0495596_0006299 3300046500 Bacteria 5485
291 Ga0495607_0014138 3300046501 Bacteria 5208
292 Ga0495606_0250622 3300046507 Bacteria 982
293 Ga0495606_0310359 3300046507 Bacteria 851
294 Ga0495606_0407706 3300046507 Bacteria 706
295 Ga0495610_0003749 3300046512 Bacteria 11632
296 Ga0495616_0010536 3300046513 Bacteria 5347
297 Ga0495630_0078395 3300046517 Bacteria 2491
298 Ga0495643_0004269 3300046522 Bacteria 10082
299 Ga0495666_0009148 3300046526 Bacteria 4954
300 Ga0495642_0007420 3300046528 Bacteria 4203
301 Ga0495642_0042246 3300046528 Bacteria 1857
302 Ga0495642_0111878 3300046528 Bacteria 1168
303 Ga0495642_0545929 3300046528 Bacteria 514
304 Ga0495652_0017699 3300046529 Bacteria 6360
305 Ga0495665_0002254 3300046531 Bacteria 10445
306 Ga0495586_0009090 3300046535 Bacteria 5286
307 Ga0495587_0014948 3300046536 Bacteria 4855
308 Ga0495609_0015701 3300046538 Bacteria 3540
309 Ga0495621_0087851 3300046539 Bacteria 1168
310 Ga0495597_0006610 3300046542 Bacteria 5979
311 Ga0495597_0031451 3300046542 Bacteria 2415
312 Ga0495622_0112840 3300046557 Bacteria 1244
313 Ga0495667_0022186 3300046559 Bacteria 4278
314 Ga0495656_0236626 3300046615 Bacteria 918
315 Ga0495634_0005208 3300046642 Bacteria 10046
316 Ga0495625_0024676 3300046660 Bacteria 4571
317 Ga0495661_0167552 3300046665 Bacteria 1174
318 Ga0495623_0014299 3300046679 Bacteria 5140
319 Ga0495669_0096339 3300046684 Bacteria 1371
320 Ga0495624_0042398 3300046690 Bacteria 2908
321 Ga0495671_0002656 3300046692 Bacteria 11224
322 Ga0495649_0140819 3300046694 Bacteria 1270
323 Ga0495649_0243495 3300046694 Bacteria 925
324 Ga0495600_0020372 3300046809 Bacteria 4243
325 Ga0495581_0044977 3300047315 Bacteria 2553
326 Ga0495604_0006893 3300047317 Bacteria 9006
327 Ga0495636_0057634 3300047318 Bacteria 1636
328 Ga0495672_0149369 3300047320 Bacteria 1213
329 Ga0495680_0178879 3300047322 Bacteria 1532
330 Ga0495687_025944 3300047443 Bacteria 2762
331 Ga0495675_0014919 3300047444 Bacteria 4912
332 Ga0495685_087959 3300047447 Bacteria 1031
333 Ga0495686_0000689 3300047472 Bacteria 45733
334 Ga0495602_0000668 3300048088 Bacteria 32140
335 Ga0496102_0455614 3300048905 Bacteria 1200
336 Ga0496110_0425298 3300048913 Bacteria 1211
337 Ga0496116_0008195 3300048919 Bacteria 9113
338 Ga0496116_0020542 3300048919 Bacteria 5012
339 Ga0496116_0185792 3300048919 Bacteria 1106
340 Ga0496117_0412175 3300048920 Bacteria 678
341 Ga0496121_0028592 3300048924 Bacteria 5187
342 Ga0496121_0087928 3300048924 Bacteria 2438
343 Ga0496121_0201972 3300048924 Bacteria 1416
344 Ga0496122_0005665 3300048925 Bacteria 14746
345 Ga0496123_0006518 3300048926 Bacteria 11284
346 Ga0496123_0326959 3300048926 Bacteria 721
347 Ga0496124_0603480 3300048927 Bacteria 713
348 Ga0496125_0116879 3300048928 Bacteria 1914
349 Ga0496126_0645260 3300048929 Bacteria 829
350 Ga0496126_0714754 3300048929 Bacteria 777
351 Ga0495682_0044282 3300049460 Bacteria 1628
352 Ga0501031_0087115 3300049568 Bacteria 2036
353 Ga0501033_0028909 3300049570 Bacteria 4165
354 Ga0501034_0000385 3300049571 Bacteria 75496
355 Ga0501034_0853346 3300049571 Bacteria 801
356 Ga0501036_0000143 3300049572 Bacteria 46212
357 Ga0501036_1065566 3300049572 Bacteria 661
358 Ga0501037_0093499 3300049573 Bacteria 2174
359 Ga0501037_0512561 3300049573 Bacteria 813
360 Ga0501038_0037719 3300049574 Bacteria 4236
361 Ga0501039_0002957 3300049575 Bacteria 12717
362 Ga0501039_0486332 3300049575 Bacteria 969
363 Ga0501040_0180603 3300049576 Bacteria 1496
364 Ga0501040_0222351 3300049576 Bacteria 1343
365 Ga0501040_0413433 3300049576 Bacteria 969
366 Ga0501041_0000077 3300049577 Bacteria 37874
367 Ga0501041_0011202 3300049577 Bacteria 5297
368 Ga0501042_0001448 3300049578 Bacteria 13966
369 Ga0501042_0226708 3300049578 Bacteria 1348
370 Ga0501046_0002404 3300049580 Bacteria 17563
371 Ga0501048_0039589 3300049582 Bacteria 3381
372 Ga0501067_0708964 3300049583 Bacteria 566
373 Ga0501068_0085594 3300049584 Bacteria 1940
374 Ga0501070_0075384 3300049586 Bacteria 2793
375 Ga0501071_0623874 3300049587 Bacteria 829
376 Ga0501071_0950159 3300049587 Bacteria 663
377 Ga0501072_0006085 3300049588 Bacteria 9210
378 Ga0501074_0001413 3300049590 Bacteria 15985
379 Ga0501074_0962992 3300049590 Bacteria 600
380 Ga0501075_0000037 3300049591 Bacteria 54884
381 Ga0501075_0606439 3300049591 Bacteria 835
382 Ga0501076_0008430 3300049592 Bacteria 7554
383 Ga0501076_1008113 3300049592 Bacteria 686
384 Ga0501077_0000650 3300049593 Bacteria 21092
385 Ga0501079_0006631 3300049741 Bacteria 8706
386 Ga0501079_0258361 3300049741 Bacteria 1361
387 Ga0501079_0348377 3300049741 Bacteria 1160
388 Ga0501080_0753564 3300049742 Bacteria 856
389 Ga0501081_0002547 3300049743 Bacteria 11494
390 Ga0501081_0754118 3300049743 Bacteria 731
391 Ga0501083_0430928 3300049744 Bacteria 858
392 Ga0501283_047682 3300049779 Bacteria 754
393 Ga0501035_0011272 3300049822 Bacteria 8283
394 Ga0501044_0160672 3300049823 Bacteria 2224
395 Ga0501045_0000124 3300049824 Bacteria 40147
396 nmdc:mga05p37_356454_c1 3300050507 Bacteria 1721
397 nmdc:mga09592_125091_c1 3300050508 Bacteria 2210
398 nmdc:mga0qj67_4781_c1 3300050509 Bacteria 9845
399 nmdc:mga0qj67_7581_c1 3300050509 Bacteria 8017
400 nmdc:mga06r32_381291_c1 3300050510 Bacteria 1393
401 nmdc:mga06r32_622588_c1 3300050510 Bacteria 1049
402 nmdc:mga06r32_950775_c1 3300050510 Bacteria 814
403 Ga0500646_0110181 3300053090 Bacteria 874
404 Ga0500650_0150801 3300053098 Unclassified 1075
405 Ga0500618_004372 3300053125 Bacteria 4541
406 Ga0500618_006772 3300053125 Bacteria 3334
407 Ga0501084_0019079 3300054114 Bacteria 5711
408 Ga0501084_1495408 3300054114 Bacteria 565
409 Ga0587088_000970 3300059508 Bacteria 2765
410 Ga0587072_000474 3300059643 Bacteria 4065
411 Ga0501082_0001666 3300060353 Bacteria 19573
412 Ga0466962_0002634 3300061719 Bacteria 8528
413 Ga0466962_0094227 3300061719 Bacteria 1436
414 Ga0530510_0000278 3300061734 Bacteria 32315
415 8003401080 8003400568 Bacteria 5535898
416 2511386595 2511231026 Bacteria 5225445
417 2513953985 2513237150 Bacteria 6553639
418 2514040106 2513237165 Bacteria 6771773
419 2521561135 2521172590 Bacteria 5047645
420 2550694742 2548876994 Bacteria 4904866
421 2553005987 2551306416 Bacteria 6152985
422 2597030794 2596583598 Bacteria 5251611
423 2599447024 2599185178 Bacteria 5365746
424 2765567570 2765235838 Bacteria 5445269
425 2808982988 2808606386 Bacteria 4471946
426 2809130507 2808606415 Bacteria 4576710
427 2809150016 2808606419 Bacteria 4576925
428 2819593848 2818991445 Bacteria 4955017
429 2819617514 2818991449 Bacteria 5518009
430 2834641238 2834641062 Bacteria 5559922
431 2839099514 2839094727 Bacteria 5534556
432 2852621765 2852618963 Bacteria 4577824
433 2858692640 2858688981 Bacteria 8184122
434 2884814423 2884811622 Bacteria 5552861
435 2884839676 2884836552 Bacteria 5219991
436 2884856513 2884852848 Bacteria 5221161
437 2885268959 2885266251 Bacteria 4796748
438 2896158879 2896154374 Bacteria 5221518
439 2900582274 2900577576 Bacteria 5438534
440 2904442234 2904439833 Bacteria 5931679
441 2904533513 2904530477 Bacteria 5876334
442 2904586468 2904584206 Bacteria 6028872
443 2904591719 2904589729 Bacteria 6113573
444 2904602128 2904601388 Bacteria 5884906
445 2919051211 2919046199 Bacteria 5567169
446 2919083533 2919079590 Bacteria 5946433
447 2923514975 2923510766 Bacteria 5926163
448 2928061274 2928058823 Bacteria 5520022
449 2928133537 2928130867 Bacteria 5467269
450 2928151793 2928147474 Bacteria 6512076
451 644746777 644736347 Bacteria 6476522
452 JGI24740J21852_10002290
453 JGI24740J21852_10002535
454 JGI25155J39150_1000918
455 JGI25156J39149_1000453
456 JGI25154J39366_1000767
457 JGI25157J39369_1000350
458 JGI25151J46595_10004512
459 JGI25151J46595_10005793
460 rootH1_10063653
461 rootL2_10068963
462 rootL2_10221673
463 rootH1_10234802
464 Ga0055538_1000010
465 Ga0055538_1006843
466 Ga0055539_1000015
467 Ga0055539_1000230
468 Ga0055533_1000018
469 Ga0055532_1000006
470 Ga0055532_1000018
471 Ga0055532_1001886
472 Ga0055525_1000020
473 Ga0055525_1001288
474 Ga0055527_1001187
475 Ga0055535_1000004
476 Ga0055535_1002317
477 Ga0055535_1012186
478 Ga0055542_1002199
479 Ga0055529_1000022
480 Ga0055529_1000625
481 Ga0055526_1005208
482 Ga0055526_1005987
483 Ga0055526_1010584
484 Ga0055526_1025217
485 Ga0055537_1014387
486 Ga0055524_1000300
487 Ga0055524_1015271
488 Ga0055536_1000110
489 Ga0055534_1001581
490 Ga0055534_1007859
491 Ga0055528_1001544
492 Ga0055541_1000011
493 Ga0055541_1000983
494 Ga0055541_1010345
495 Ga0070670_100194855
496 Ga0070680_100163204
497 Ga0070660_100163369
498 Ga0070689_100173987
499 Ga0070689_101432740
500 Ga0070661_100000012
501 Ga0070659_100002113
502 Ga0070714_101775385
503 Ga0070713_101288200
504 Ga0070663_100000003
505 Ga0070699_100161893
506 Ga0068855_100002320
507 Ga0068855_100022029
508 Ga0068855_100286390
509 Ga0070664_100000003
510 Ga0068857_100031165
511 Ga0068857_100636644
512 Ga0068854_100000063
513 Ga0068854_100011534
514 Ga0068856_100000011
515 Ga0068856_100234912
516 Ga0068856_100306155
517 Ga0070702_100055242
518 Ga0068852_100316822
519 Ga0068852_100435807
520 Ga0068860_100978866
521 Ga0068862_100572072
522 Ga0075428_100068497
523 Ga0075428_100169999
524 Ga0075428_100966215
525 Ga0075430_100020692
526 Ga0075430_100041998
527 Ga0075431_100194759
528 Ga0075431_100817197
529 Ga0075429_100048252
530 Ga0079104_1020736
531 Ga0099826_10000014
532 Ga0105244_10058126
533 Ga0105240_10049734
534 Ga0114129_10107505
535 Ga0114129_11475783
536 Ga0105237_10003535
537 Ga0105237_10141792
538 Ga0105238_10000004
539 Ga0105239_10001658
540 Ga0157373_10003075
541 Ga0157371_10000083
542 Ga0157371_10034044
543 Ga0157371_10101853
544 Ga0157370_10000141
545 Ga0157370_10701583
546 Ga0157369_10005761
547 Ga0157369_10008911
548 Ga0157369_10515671
549 Ga0157380_11464258
550 Ga0182008_10113350
551 Ga0182006_1002269
552 Ga0182006_1008829
553 Ga0182006_1035771
554 Ga0182006_1067296
555 Ga0182007_10047333
556 Ga0206351_10566569
557 Ga0154015_1250340
558 Ga0213872_10022132
559 Ga0209435_100007
560 Ga0209784_100025
561 Ga0209784_100150
562 Ga0209784_100322
563 Ga0209566_100002
564 Ga0209566_100025
565 Ga0209566_100430
566 Ga0209566_101454
567 Ga0209674_100010
568 Ga0209674_100042
569 Ga0209674_100050
570 Ga0209672_100028
571 Ga0209672_100218
572 Ga0209147_100015
573 Ga0209147_100017
574 Ga0209147_100163
575 Ga0209563_100004
576 Ga0209563_100026
577 Ga0209563_100046
578 Ga0209563_111520
579 Ga0209437_100088
580 Ga0209258_100021
581 Ga0209258_100191
582 Ga0209258_100215
583 Ga0209646_1000044
584 Ga0209646_1000287
585 Ga0209026_1000353
586 Ga0209677_100007
587 Ga0209677_100027
588 Ga0209677_109915
589 Ga0209148_1000081
590 Ga0209148_1015087
591 Ga0209759_1000255
592 Ga0209759_1002139
593 Ga0209759_1004428
594 Ga0209565_1000045
595 Ga0209565_1001433
596 Ga0209455_1000028
597 Ga0209455_1000050
598 Ga0209455_1001834
599 Ga0209673_1000038
600 Ga0209673_1033363
601 Ga0209675_1000247
602 Ga0209675_1001062
603 Ga0209675_1007825
604 Ga0209676_1000064
605 Ga0209025_1000690
606 Ga0209025_1000899
607 Ga0209025_1001826
608 Ga0209025_1003032
609 Ga0209025_1086988
610 Ga0209564_1000462
611 Ga0209564_1002165
612 Ga0209564_1002213
613 Ga0209564_1012531
614 Ga0209758_1028384
615 Ga0209256_1000105
616 Ga0209256_1000193
617 Ga0209051_1007154
618 Ga0207647_10039744
619 Ga0207695_10000965
620 Ga0207695_10004143
621 Ga0207695_10005275
622 Ga0207695_10038700
623 Ga0207671_10011604
624 Ga0207671_10014499
625 Ga0207671_10088588
626 Ga0207660_10216819
627 Ga0207657_10000051
628 Ga0207657_10196191
629 Ga0207649_10000302
630 Ga0207694_10000021
631 Ga0207694_10006205
632 Ga0207690_10000034
633 Ga0207690_10002311
634 Ga0207706_11221404
635 Ga0207679_10000007
636 Ga0207679_10388185
637 Ga0207667_10002387
638 Ga0207667_10007930
639 Ga0207667_10015720
640 Ga0207640_10000224
641 Ga0207640_10319070
642 Ga0207678_10000011
643 Ga0207678_10000508
644 Ga0207702_10000054
645 Ga0207702_10265437
646 Ga0207702_10623150
647 Ga0207702_10914696
648 Ga0207674_10068543
649 Ga0207674_10085333
650 Ga0207698_10055626
651 Ga0207698_10072858
652 Ga0207698_11478002
653 Ga0209281_1009603
654 Ga0209371_1002213
655 Ga0209999_1023086
656 Ga0209282_1000048
657 Ga0209971_1008092
658 Ga0209966_1023380
659 Ga0209974_10004385
660 Ga0268265_10662749
661 Ga0268256_1001949
662 Ga0265332_10000005
663 Ga0265328_10038229
664 Ga0265314_10592030
665 Ga0307406_11820400
666 Ga0307412_10112062
667 Ga0307412_10325234
668 Ga0307416_100557373
669 Ga0307416_101067953
670 Ga0307411_10347291
671 Ga0307510_10529549
672 Ga0373953_0225548
673 Ga0373947_0372692
674 Ga0373937_0493547
675 Ga0395899_0000008
676 Ga0395899_0017199
677 Ga0395899_0141060
678 Ga0395900_0000055
679 Ga0395900_0007708
680 Ga0395900_0021085
681 Ga0395900_0242036
682 Ga0395898_0000119
683 Ga0395898_0000792
684 Ga0395898_0031349
685 Ga0395905_0008058
686 Ga0395901_0000003
687 Ga0395901_0000180
688 Ga0395901_0011306
689 Ga0436361_0646906
690 Ga0436361_1186364
691 Ga0439441_000069
692 Ga0450896_024987
693 Ga0439435_0003513
694 Ga0439444_0016910
695 Ga0439460_0000098
696 Ga0450893_0006439
697 Ga0451577_0082266
698 Ga0451577_1223799
699 Ga0466986_0134721
700 Ga0466969_0036568
701 Ga0466969_0060050
702 Ga0466972_0071999
703 Ga0466973_0065731
704 Ga0466978_0126000
705 Ga0453683_0445875
706 Ga0466965_0002158
707 Ga0466965_0081959
708 Ga0466966_0000016
709 Ga0466966_0107383
710 Ga0466961_0000380
711 Ga0466961_0000829
712 Ga0466961_0054526
713 Ga0466961_0113975
714 Ga0466961_0130595
715 Ga0466963_0001462
716 Ga0466963_0016895
717 Ga0466971_0000717
718 Ga0466971_0007862
719 Ga0466968_0152201
720 Ga0466968_0154713
721 Ga0466970_0058088
722 Ga0466970_0088865
723 Ga0466970_0152758
724 Ga0466957_0069912
725 Ga0466957_0079255
726 Ga0466959_0119331
727 Ga0466959_0129415
728 Ga0466959_0195781
729 Ga0466958_0011200
730 Ga0466958_0349657
731 Ga0466967_0855969
732 Ga0495590_0001487
733 Ga0495651_0581874
734 Ga0495653_0044938
735 Ga0495653_0085361
736 Ga0495580_0054003
737 Ga0495582_0004506
738 Ga0495605_0004939
739 Ga0495664_0865445
740 Ga0495594_0011918
741 Ga0495596_0006299
742 Ga0495607_0014138
743 Ga0495606_0250622
744 Ga0495606_0310359
745 Ga0495606_0407706
746 Ga0495610_0003749
747 Ga0495616_0010536
748 Ga0495630_0078395
749 Ga0495643_0004269
750 Ga0495666_0009148
751 Ga0495642_0007420
752 Ga0495642_0042246
753 Ga0495642_0111878
754 Ga0495642_0545929
755 Ga0495652_0017699
756 Ga0495665_0002254
757 Ga0495586_0009090
758 Ga0495587_0014948
759 Ga0495609_0015701
760 Ga0495621_0087851
761 Ga0495597_0006610
762 Ga0495597_0031451
763 Ga0495622_0112840
764 Ga0495667_0022186
765 Ga0495656_0236626
766 Ga0495634_0005208
767 Ga0495625_0024676
768 Ga0495661_0167552
769 Ga0495623_0014299
770 Ga0495669_0096339
771 Ga0495624_0042398
772 Ga0495671_0002656
773 Ga0495649_0140819
774 Ga0495649_0243495
775 Ga0495600_0020372
776 Ga0495581_0044977
777 Ga0495604_0006893
778 Ga0495636_0057634
779 Ga0495672_0149369
780 Ga0495680_0178879
781 Ga0495687_025944
782 Ga0495675_0014919
783 Ga0495685_087959
784 Ga0495686_0000689
785 Ga0495602_0000668
786 Ga0496102_0455614
787 Ga0496110_0425298
788 Ga0496116_0008195
789 Ga0496116_0020542
790 Ga0496116_0185792
791 Ga0496117_0412175
792 Ga0496121_0028592
793 Ga0496121_0087928
794 Ga0496121_0201972
795 Ga0496122_0005665
796 Ga0496123_0006518
797 Ga0496123_0326959
798 Ga0496124_0603480
799 Ga0496125_0116879
800 Ga0496126_0645260
801 Ga0496126_0714754
802 Ga0495682_0044282
803 Ga0501031_0087115
804 Ga0501033_0028909
805 Ga0501034_0000385
806 Ga0501034_0853346
807 Ga0501036_0000143
808 Ga0501036_1065566
809 Ga0501037_0093499
810 Ga0501037_0512561
811 Ga0501038_0037719
812 Ga0501039_0002957
813 Ga0501039_0486332
814 Ga0501040_0180603
815 Ga0501040_0222351
816 Ga0501040_0413433
817 Ga0501041_0000077
818 Ga0501041_0011202
819 Ga0501042_0001448
820 Ga0501042_0226708
821 Ga0501046_0002404
822 Ga0501048_0039589
823 Ga0501067_0708964
824 Ga0501068_0085594
825 Ga0501070_0075384
826 Ga0501071_0623874
827 Ga0501071_0950159
828 Ga0501072_0006085
829 Ga0501074_0001413
830 Ga0501074_0962992
831 Ga0501075_0000037
832 Ga0501075_0606439
833 Ga0501076_0008430
834 Ga0501076_1008113
835 Ga0501077_0000650
836 Ga0501079_0006631
837 Ga0501079_0258361
838 Ga0501079_0348377
839 Ga0501080_0753564
840 Ga0501081_0002547
841 Ga0501081_0754118
842 Ga0501083_0430928
843 Ga0501283_047682
844 Ga0501035_0011272
845 Ga0501044_0160672
846 Ga0501045_0000124
847 nmdc:mga05p37_356454_c1
848 nmdc:mga09592_125091_c1
849 nmdc:mga0qj67_4781_c1
850 nmdc:mga0qj67_7581_c1
851 nmdc:mga06r32_381291_c1
852 nmdc:mga06r32_622588_c1
853 nmdc:mga06r32_950775_c1
854 Ga0500646_0110181
855 Ga0500650_0150801
856 Ga0500618_004372
857 Ga0500618_006772
858 Ga0501084_0019079
859 Ga0501084_1495408
860 Ga0587088_000970
861 Ga0587072_000474
862 Ga0501082_0001666
863 Ga0466962_0002634
864 Ga0466962_0094227
865 Ga0530510_0000278
866 8003401080
867 2511386595
868 2513953985
869 2514040106
870 2521561135
871 2550694742
872 2553005987
873 2597030794
874 2599447024
875 2765567570
876 2808982988
877 2809130507
878 2809150016
879 2819593848
880 2819617514
881 2834641238
882 2839099514
883 2852621765
884 2858692640
885 2884814423
886 2884839676
887 2884856513
888 2885268959
889 2896158879
890 2900582274
891 2904442234
892 2904533513
893 2904586468
894 2904591719
895 2904602128
896 2919051211
897 2919083533
898 2923514975
899 2928061274
900 2928133537
901 2928151793
902 644746777

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02580

Tyr_Deacylase

D-Tyr-tRNA(Tyr) deacylase

1

145

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9782 1 150
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9732 1 150
1j7g-assembly1.cif.gz_A-2 structure of yihz from haemophilus influenzae (hi0670), a d-tyr-trna(tyr) deacylase 0.9715 1 150
1jke-assembly1.cif.gz_A d-tyr trnatyr deacylase from escherichia coli 0.9667 1 150
2dbo-assembly1.cif.gz_A-2 crystal structure of d-tyr-trna(tyr) deacylase from aquifex aeolicus 0.9567 1 149
ID Description Score Start End Superfamily
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9782 1 150 3.50.80.10
1j7gA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9715 1 150 3.50.80.10
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9567 1 149 3.50.80.10
af_Q2FXU2_1_149_3.50.80.10 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9437 1 150 3.50.80.10
2dboA00 Alpha Beta;3-Layer(bba) Sandwich;D-tyrosyl-trna(Tyr) Deacylase; Chain: A;;D-tyrosyl-tRNA(Tyr) deacylase 0.9255 1 149 3.50.80.10
ID Description Score Start End GO Terms
AF-A0A375EPC6-F1-model_v4 deleted 0.9926 1 152
AF-B2AH66-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) 0.991 1 152 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A661D976-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.9873 1 150 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A1A7BZC6-F1-model_v4 D-aminoacyl-tRNA deacylase (DTD) (EC 3.1.1.96) (Gly-tRNA(Ala) deacylase) (EC 3.1.1.-) 0.987 1 153 GO:0000049
GO:0005737
GO:0019478
GO:0043908
GO:0051500
GO:0106026
AF-A0A158IJZ5-F1-model_v4 D-tyrosyl-tRNA(Tyr) deacylase 0.9869 14 152 GO:0005737
GO:0051500

Map