F446934

General Info

Members Datasets Scaffolds Average Seq Length
452 255 904 186

Family's Representative Sequence

Representative Sequence 3300005547|Ga0070693_100000793|Ga0070693_10000079314
Length 197
Sequence MGKGAGDEVTVPRALDIVIALLALAVLSPVLLIAAVAIKLGSRGPVFYRQRRVGLRGEEFEMLKLRTMVAGSDPVGVGSVVTRDDPRVTAAGRLLRRTSLDEIPNLVNVLRGEMAIVGPRPTIPAQVVDYTPRQRRRHEVRPGITGWAQVQGRAGIPWEERIELDLEYVDRRGIVLDARILAKTVWLLVSGHGLAPD

Samples

Sample ID Description Type Environment
1 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
46 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
130 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
131 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
132 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
133 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
136 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
145 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
152 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
164 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
165 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
166 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
173 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
183 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
197 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
198 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
199 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
200 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
201 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
202 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
203 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
204 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
205 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
226 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
227 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
228 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
249 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
251 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
252 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
253 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
254 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.55
Nodule 0
Rhizoplane 12.61
Rhizosphere 83.41
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070693_100000793 3300005547 Bacteria 13960
2 JGI24740J21852_10015307 3300001979 Bacteria 2805
3 JGI24748J21848_1000153 3300002074 Bacteria 10692
4 JGI24034J26672_10000074 3300002239 Bacteria 24671
5 JGI25406J46586_10105820 3300003203 Bacteria 836
6 JGI25404J52841_10001611 3300003659 Bacteria 4027
7 Ga0070676_10250304 3300005328 Bacteria 1182
8 Ga0070683_100000190 3300005329 Bacteria 41133
9 Ga0070683_100006423 3300005329 Bacteria 9858
10 Ga0070683_100026488 3300005329 Bacteria 5222
11 Ga0070666_10099750 3300005335 Bacteria 2000
12 Ga0070680_100086792 3300005336 Bacteria 2587
13 Ga0070682_100000016 3300005337 Bacteria 239799
14 Ga0070682_100000029 3300005337 Bacteria 183516
15 Ga0070682_100546446 3300005337 Bacteria 906
16 Ga0068868_100000451 3300005338 Bacteria 27446
17 Ga0070691_10000006 3300005341 Bacteria 66177
18 Ga0070661_100000217 3300005344 Bacteria 47669
19 Ga0070661_100756556 3300005344 Bacteria 795
20 Ga0070668_100004533 3300005347 Bacteria 10308
21 Ga0070668_100125493 3300005347 Bacteria 2056
22 Ga0070668_100175933 3300005347 Bacteria 1745
23 Ga0070675_100000429 3300005354 Bacteria 28542
24 Ga0070674_100000033 3300005356 Bacteria 63982
25 Ga0070673_100061197 3300005364 Bacteria 2986
26 Ga0070688_100000225 3300005365 Bacteria 29663
27 Ga0070688_100000468 3300005365 Bacteria 20469
28 Ga0070659_100005667 3300005366 Bacteria 8978
29 Ga0070659_100104945 3300005366 Bacteria 2277
30 Ga0070667_100036060 3300005367 Bacteria 4145
31 Ga0070667_100213761 3300005367 Bacteria 1715
32 Ga0070713_100000091 3300005436 Bacteria 57496
33 Ga0070713_100229527 3300005436 Bacteria 1687
34 Ga0070700_100074195 3300005441 Bacteria 2179
35 Ga0070663_100160536 3300005455 Bacteria 1730
36 Ga0070678_100035596 3300005456 Bacteria 3478
37 Ga0070662_100000008 3300005457 Bacteria 168754
38 Ga0070681_10003882 3300005458 Bacteria 14072
39 Ga0068867_100000179 3300005459 Bacteria 41694
40 Ga0070685_10000028 3300005466 Bacteria 90128
41 Ga0070685_10000124 3300005466 Bacteria 49061
42 Ga0070685_10054812 3300005466 Bacteria 2315
43 Ga0070685_10235147 3300005466 Bacteria 1207
44 Ga0070679_100000823 3300005530 Bacteria 26958
45 Ga0070684_100038395 3300005535 Bacteria 4113
46 Ga0070684_100120662 3300005535 Bacteria 2358
47 Ga0070684_100147585 3300005535 Bacteria 2129
48 Ga0070684_100583644 3300005535 Bacteria 1039
49 Ga0068853_100001640 3300005539 Bacteria 16358
50 Ga0070665_100000725 3300005548 Bacteria 43927
51 Ga0070665_100940886 3300005548 Bacteria 877
52 Ga0070665_101127227 3300005548 Bacteria 796
53 Ga0070664_100068607 3300005564 Bacteria 3032
54 Ga0068854_100001877 3300005578 Bacteria 12812
55 Ga0068856_100000403 3300005614 Bacteria 47397
56 Ga0068856_100012776 3300005614 Bacteria 8130
57 Ga0068856_100175097 3300005614 Bacteria 2158
58 Ga0068859_101033536 3300005617 Bacteria 903
59 Ga0068864_100000044 3300005618 Bacteria 157919
60 Ga0068866_10000002 3300005718 Bacteria 394090
61 Ga0068861_100174200 3300005719 Bacteria 1785
62 Ga0068851_10001306 3300005834 Bacteria 10862
63 Ga0068863_100000080 3300005841 Bacteria 106670
64 Ga0068863_100348404 3300005841 Bacteria 1442
65 Ga0068858_100000042 3300005842 Bacteria 132482
66 Ga0068858_100191811 3300005842 Bacteria 1931
67 Ga0068862_100003975 3300005844 Bacteria 12550
68 Ga0081455_10002828 3300005937 Bacteria 20434
69 Ga0081540_1000115 3300005983 Bacteria 84188
70 Ga0081540_1110476 3300005983 Bacteria 1163
71 Ga0081539_10014578 3300005985 Bacteria 5800
72 Ga0081539_10015825 3300005985 Bacteria 5444
73 Ga0075363_100069026 3300006048 Bacteria 1917
74 Ga0075364_10139681 3300006051 Bacteria 1629
75 Ga0070715_10000015 3300006163 Bacteria 152816
76 Ga0070712_100001773 3300006175 Bacteria 13212
77 Ga0068871_100373681 3300006358 Bacteria 1265
78 Ga0075431_100167373 3300006847 Bacteria 2259
79 Ga0075433_10000031 3300006852 Bacteria 55735
80 Ga0075433_10014844 3300006852 Bacteria 6375
81 Ga0068865_100000020 3300006881 Bacteria 104487
82 Ga0068865_100447576 3300006881 Bacteria 1067
83 Ga0097620_101033527 3300006931 Bacteria 903
84 Ga0105240_10114751 3300009093 Bacteria 3253
85 Ga0105245_10000045 3300009098 Bacteria 134057
86 Ga0105245_10000150 3300009098 Bacteria 66121
87 Ga0105245_10000327 3300009098 Bacteria 44888
88 Ga0105247_10000712 3300009101 Bacteria 25919
89 Ga0105247_10110317 3300009101 Bacteria 1770
90 Ga0105243_10003341 3300009148 Bacteria 13017
91 Ga0105241_10185238 3300009174 Bacteria 1730
92 Ga0105242_10002594 3300009176 Bacteria 14161
93 Ga0105242_10199509 3300009176 Bacteria 1776
94 Ga0105248_10000803 3300009177 Bacteria 35169
95 Ga0105238_10000240 3300009551 Bacteria 61138
96 Ga0105249_10000095 3300009553 Bacteria 121300
97 Ga0105249_10003887 3300009553 Bacteria 12906
98 Ga0105249_10363249 3300009553 Bacteria 1470
99 Ga0105239_10084325 3300010375 Bacteria 3499
100 Ga0105239_10388796 3300010375 Bacteria 1578
101 Ga0157371_10001294 3300013102 Bacteria 26350
102 Ga0157370_10014499 3300013104 Bacteria 8056
103 Ga0157370_10810460 3300013104 Bacteria 852
104 Ga0157369_10000037 3300013105 Bacteria 190395
105 Ga0157374_10000668 3300013296 Bacteria 30198
106 Ga0157374_10048215 3300013296 Bacteria 3953
107 Ga0157378_10040220 3300013297 Bacteria 4146
108 Ga0157378_10087410 3300013297 Bacteria 2828
109 Ga0163162_10145459 3300013306 Bacteria 2486
110 Ga0157375_10000723 3300013308 Bacteria 29095
111 Ga0157375_10006804 3300013308 Bacteria 9953
112 Ga0157375_10008069 3300013308 Bacteria 9210
113 Ga0157375_10070732 3300013308 Bacteria 3500
114 Ga0157375_11516413 3300013308 Bacteria 791
115 Ga0163163_10045441 3300014325 Bacteria 4310
116 Ga0163163_10196423 3300014325 Bacteria 2065
117 Ga0163163_10542592 3300014325 Bacteria 1225
118 Ga0163163_10743312 3300014325 Bacteria 1044
119 Ga0157380_10000024 3300014326 Bacteria 110947
120 Ga0157380_10000202 3300014326 Bacteria 35113
121 Ga0157377_10840365 3300014745 Bacteria 681
122 Ga0157379_10014627 3300014968 Bacteria 6881
123 Ga0157379_10080096 3300014968 Bacteria 2926
124 Ga0157379_10098744 3300014968 Bacteria 2621
125 Ga0157376_10031598 3300014969 Bacteria 4243
126 Ga0163161_10000058 3300017792 Bacteria 114035
127 Ga0163161_10008224 3300017792 Bacteria 7219
128 Ga0163161_10603072 3300017792 Bacteria 905
129 Ga0207682_10000168 3300025893 Bacteria 30073
130 Ga0207642_10000001 3300025899 Bacteria 714030
131 Ga0207642_10000003 3300025899 Bacteria 650651
132 Ga0207710_10000103 3300025900 Bacteria 109033
133 Ga0207710_10122026 3300025900 Bacteria 1245
134 Ga0207680_10009661 3300025903 Bacteria 4795
135 Ga0207685_10000001 3300025905 Bacteria 604473
136 Ga0207645_10239622 3300025907 Bacteria 1198
137 Ga0207705_10019780 3300025909 Bacteria 4815
138 Ga0207707_10005314 3300025912 Bacteria 11251
139 Ga0207695_10059182 3300025913 Bacteria 3974
140 Ga0207693_10004681 3300025915 Bacteria 11526
141 Ga0207660_10069705 3300025917 Bacteria 2554
142 Ga0207657_10931802 3300025919 Bacteria 668
143 Ga0207649_10001043 3300025920 Bacteria 17022
144 Ga0207649_10595316 3300025920 Bacteria 850
145 Ga0207652_10001431 3300025921 Bacteria 21145
146 Ga0207681_10360888 3300025923 Bacteria 1165
147 Ga0207694_10000067 3300025924 Bacteria 128108
148 Ga0207659_10000620 3300025926 Bacteria 21118
149 Ga0207687_10000021 3300025927 Bacteria 226396
150 Ga0207687_10000023 3300025927 Bacteria 217098
151 Ga0207687_10000099 3300025927 Bacteria 63345
152 Ga0207687_10011461 3300025927 Bacteria 5794
153 Ga0207700_10000009 3300025928 Bacteria 314953
154 Ga0207700_10285879 3300025928 Bacteria 1420
155 Ga0207690_10004598 3300025932 Bacteria 8159
156 Ga0207690_10067260 3300025932 Bacteria 2457
157 Ga0207706_10000016 3300025933 Bacteria 170697
158 Ga0207686_10000544 3300025934 Bacteria 24398
159 Ga0207686_10142616 3300025934 Bacteria 1658
160 Ga0207709_10005335 3300025935 Bacteria 7311
161 Ga0207670_10373969 3300025936 Bacteria 1133
162 Ga0207669_10000137 3300025937 Bacteria 35016
163 Ga0207704_10000004 3300025938 Bacteria 239295
164 Ga0207704_10451620 3300025938 Bacteria 1026
165 Ga0207691_10000199 3300025940 Bacteria 57652
166 Ga0207711_10000019 3300025941 Bacteria 412779
167 Ga0207661_10000339 3300025944 Bacteria 29875
168 Ga0207661_10004401 3300025944 Bacteria 9879
169 Ga0207661_10017970 3300025944 Bacteria 5247
170 Ga0207661_10042628 3300025944 Bacteria 3578
171 Ga0207679_10052022 3300025945 Bacteria 3002
172 Ga0207651_10040926 3300025960 Bacteria 3071
173 Ga0207712_10000003 3300025961 Bacteria 615314
174 Ga0207712_10041844 3300025961 Bacteria 3151
175 Ga0207668_10101874 3300025972 Bacteria 2135
176 Ga0207640_10000122 3300025981 Bacteria 59302
177 Ga0207658_10081011 3300025986 Bacteria 2488
178 Ga0207677_10000376 3300026023 Bacteria 30827
179 Ga0207677_10001003 3300026023 Bacteria 15596
180 Ga0207703_10000060 3300026035 Bacteria 134334
181 Ga0207703_10083415 3300026035 Bacteria 2670
182 Ga0207639_10001333 3300026041 Bacteria 16674
183 Ga0207678_10185408 3300026067 Bacteria 1777
184 Ga0207708_10397768 3300026075 Bacteria 1139
185 Ga0207702_10000027 3300026078 Bacteria 183792
186 Ga0207702_10002040 3300026078 Bacteria 19552
187 Ga0207702_10135809 3300026078 Bacteria 2219
188 Ga0207641_10017737 3300026088 Bacteria 5831
189 Ga0207641_10043456 3300026088 Bacteria 3774
190 Ga0207648_10000228 3300026089 Bacteria 60032
191 Ga0207676_10000043 3300026095 Bacteria 161948
192 Ga0207675_100223504 3300026118 Bacteria 1815
193 Ga0207683_10055449 3300026121 Bacteria 3475
194 Ga0207698_10000002 3300026142 Bacteria 404991
195 Ga0207698_10118350 3300026142 Bacteria 2237
196 Ga0207698_10235825 3300026142 Bacteria 1664
197 Ga0268266_10007963 3300028379 Bacteria 9475
198 Ga0268266_10694875 3300028379 Bacteria 980
199 Ga0268266_10817211 3300028379 Bacteria 900
200 Ga0268264_10005149 3300028381 Bacteria 11080
201 Ga0268264_10075637 3300028381 Bacteria 2863
202 Ga0265337_1000013 3300028556 Bacteria 82926
203 Ga0265326_10000012 3300028558 Bacteria 175352
204 Ga0265319_1000421 3300028563 Bacteria 30464
205 Ga0265322_10000003 3300028654 Bacteria 468671
206 Ga0265336_10008458 3300028666 Bacteria 3609
207 Ga0265338_10002111 3300028800 Bacteria 30659
208 Ga0265338_10145700 3300028800 Bacteria 1848
209 Ga0265324_10000555 3300029957 Bacteria 25595
210 Ga0307511_10111674 3300030521 Bacteria 1736
211 Ga0265332_10020728 3300031238 Bacteria 2904
212 Ga0265328_10000700 3300031239 Bacteria 15518
213 Ga0265320_10000001 3300031240 Bacteria 847191
214 Ga0265325_10002586 3300031241 Bacteria 12140
215 Ga0265329_10011862 3300031242 Bacteria 3156
216 Ga0265339_10047749 3300031249 Bacteria 2350
217 Ga0265331_10001257 3300031250 Bacteria 19008
218 Ga0265331_10009894 3300031250 Bacteria 5312
219 Ga0265327_10000003 3300031251 Bacteria 852750
220 Ga0316579_10289415 3300031691 Bacteria 792
221 Ga0265314_10000044 3300031711 Bacteria 207337
222 Ga0316576_10139582 3300031727 Bacteria 1824
223 Ga0373955_0192447 3300035172 Bacteria 1213
224 Ga0373933_0392673 3300035724 Bacteria 904
225 Ga0373937_0010103 3300036401 Bacteria 8231
226 Ga0451789_1213367 3300041443 Bacteria 1070
227 Ga0451853_2334234 3300041512 Bacteria 1653
228 Ga0451853_2953792 3300041512 Bacteria 1123
229 Ga0466963_0000710 3300044694 Bacteria 16256
230 Ga0466963_0056231 3300044694 Bacteria 2618
231 Ga0466957_0001272 3300044842 Bacteria 13140
232 Ga0466957_0969190 3300044842 Bacteria 610
233 Ga0466967_0000004 3300045976 Bacteria 155664
234 Ga0466967_0048500 3300045976 Bacteria 3709
235 Ga0466967_0252799 3300045976 Bacteria 1684
236 Ga0495592_0001063 3300046454 Bacteria 19010
237 Ga0495592_0297356 3300046454 Bacteria 1050
238 Ga0495603_0000095 3300046455 Bacteria 40632
239 Ga0495603_0001218 3300046455 Bacteria 15011
240 Ga0495629_0000682 3300046459 Bacteria 27492
241 Ga0495629_0001002 3300046459 Bacteria 22663
242 Ga0495641_0000187 3300046461 Bacteria 47961
243 Ga0495641_0046714 3300046461 Bacteria 1990
244 Ga0495641_0061422 3300046461 Bacteria 1696
245 Ga0495641_0306126 3300046461 Bacteria 716
246 Ga0495651_0296487 3300046462 Bacteria 1086
247 Ga0495653_0106718 3300046463 Bacteria 2019
248 Ga0495582_0000005 3300046473 Bacteria 156170
249 Ga0495662_0006018 3300046476 Bacteria 6062
250 Ga0495594_0000004 3300046499 Bacteria 195881
251 Ga0495596_0080831 3300046500 Bacteria 1262
252 Ga0495606_0000045 3300046507 Bacteria 212105
253 Ga0495608_0000001 3300046511 Bacteria 411278
254 Ga0495608_0000702 3300046511 Bacteria 23274
255 Ga0495608_0126404 3300046511 Bacteria 1637
256 Ga0495618_0000068 3300046514 Bacteria 74614
257 Ga0495620_0005333 3300046515 Bacteria 7193
258 Ga0495628_0000070 3300046516 Bacteria 80592
259 Ga0495628_0002703 3300046516 Bacteria 15872
260 Ga0495628_0021689 3300046516 Bacteria 5280
261 Ga0495628_0152990 3300046516 Bacteria 1756
262 Ga0495630_0000037 3300046517 Bacteria 114404
263 Ga0495630_0001004 3300046517 Bacteria 19578
264 Ga0495630_0007991 3300046517 Bacteria 7596
265 Ga0495630_0140632 3300046517 Bacteria 1835
266 Ga0495630_0228201 3300046517 Bacteria 1422
267 Ga0495644_0000600 3300046523 Bacteria 15119
268 Ga0495652_0000066 3300046529 Bacteria 109895
269 Ga0495652_0006039 3300046529 Bacteria 11327
270 Ga0495640_0012284 3300046533 Bacteria 6550
271 Ga0495640_0098876 3300046533 Bacteria 1917
272 Ga0495586_0001124 3300046535 Bacteria 15053
273 Ga0495586_0372968 3300046535 Bacteria 820
274 Ga0495587_0008303 3300046536 Bacteria 6686
275 Ga0495587_0225826 3300046536 Bacteria 1056
276 Ga0495587_0309140 3300046536 Bacteria 883
277 Ga0495598_0039236 3300046537 Bacteria 1376
278 Ga0495645_0006912 3300046543 Bacteria 7883
279 Ga0495645_0013323 3300046543 Bacteria 5811
280 Ga0495622_0000016 3300046557 Bacteria 177089
281 Ga0495633_0014022 3300046558 Bacteria 4202
282 Ga0495667_0000015 3300046559 Bacteria 200377
283 Ga0495667_0412468 3300046559 Bacteria 850
284 Ga0495634_0000592 3300046642 Bacteria 35197
285 Ga0495634_0000910 3300046642 Bacteria 28215
286 Ga0495634_0059188 3300046642 Bacteria 2552
287 Ga0495625_0000020 3300046660 Bacteria 290440
288 Ga0495635_0010981 3300046663 Bacteria 6346
289 Ga0495635_0074594 3300046663 Bacteria 2324
290 Ga0495588_0000735 3300046674 Bacteria 14992
291 Ga0495657_0000002 3300046675 Bacteria 411958
292 Ga0495657_0009242 3300046675 Bacteria 7480
293 Ga0495623_0119238 3300046679 Bacteria 1590
294 Ga0495623_0409505 3300046679 Bacteria 728
295 Ga0495646_0378151 3300046680 Bacteria 739
296 Ga0495647_0000037 3300046681 Bacteria 42482
297 Ga0495647_0001793 3300046681 Bacteria 6637
298 Ga0495647_0005678 3300046681 Bacteria 4099
299 Ga0495658_0000019 3300046683 Bacteria 91606
300 Ga0495658_0001723 3300046683 Bacteria 11336
301 Ga0495658_0901239 3300046683 Bacteria 565
302 Ga0495669_0000163 3300046684 Bacteria 42549
303 Ga0495669_0011032 3300046684 Bacteria 3827
304 Ga0495613_0000257 3300046689 Bacteria 50000
305 Ga0495613_0119703 3300046689 Bacteria 1891
306 Ga0495613_0342610 3300046689 Bacteria 1028
307 Ga0495624_0000013 3300046690 Bacteria 115278
308 Ga0495624_0007342 3300046690 Bacteria 7738
309 Ga0495624_0081573 3300046690 Bacteria 2003
310 Ga0495670_0039887 3300046691 Bacteria 2342
311 Ga0495649_0011451 3300046694 Bacteria 5200
312 Ga0495600_0001883 3300046809 Bacteria 11775
313 Ga0495600_0014761 3300046809 Bacteria 4926
314 Ga0495581_0723748 3300047315 Bacteria 573
315 Ga0495604_0000033 3300047317 Bacteria 134810
316 Ga0495604_0005980 3300047317 Bacteria 9659
317 Ga0495604_0034727 3300047317 Bacteria 3989
318 Ga0495674_0000007 3300047319 Bacteria 336257
319 Ga0495672_0158553 3300047320 Bacteria 1166
320 Ga0495676_0000091 3300047321 Bacteria 66575
321 Ga0495676_0000400 3300047321 Bacteria 35076
322 Ga0495676_0234414 3300047321 Bacteria 1259
323 Ga0495680_0000023 3300047322 Bacteria 116444
324 Ga0495680_0001062 3300047322 Bacteria 30410
325 Ga0495680_0002013 3300047322 Bacteria 21325
326 Ga0495680_0062008 3300047322 Bacteria 2875
327 Ga0495680_0174873 3300047322 Bacteria 1553
328 Ga0495675_0007835 3300047444 Bacteria 6597
329 Ga0495679_010053 3300047446 Bacteria 3744
330 Ga0495685_032903 3300047447 Bacteria 1782
331 Ga0495593_0060095 3300047673 Bacteria 1990
332 Ga0495602_0000010 3300048088 Bacteria 212121
333 Ga0495602_0001999 3300048088 Bacteria 20491
334 Ga0495602_0052115 3300048088 Bacteria 3638
335 Ga0495614_0020870 3300048089 Bacteria 2831
336 Ga0496100_0000003 3300048903 Bacteria 360802
337 Ga0496100_0000008 3300048903 Bacteria 231974
338 Ga0496100_0761050 3300048903 Unclassified 758
339 Ga0496101_0000003 3300048904 Bacteria 406565
340 Ga0496101_0000016 3300048904 Bacteria 240753
341 Ga0496102_0000054 3300048905 Bacteria 175565
342 Ga0496102_0008829 3300048905 Bacteria 8645
343 Ga0496102_0258139 3300048905 Bacteria 1643
344 Ga0496103_0000079 3300048906 Bacteria 110624
345 Ga0496103_0012116 3300048906 Bacteria 5122
346 Ga0496103_0097534 3300048906 Bacteria 1858
347 Ga0496103_0103162 3300048906 Bacteria 1806
348 Ga0496103_0173817 3300048906 Bacteria 1384
349 Ga0496104_0000003 3300048907 Bacteria 669219
350 Ga0496104_0000063 3300048907 Bacteria 116618
351 Ga0496104_0001015 3300048907 Bacteria 24067
352 Ga0496104_0034860 3300048907 Bacteria 4695
353 Ga0496104_0211538 3300048907 Bacteria 1851
354 Ga0496105_0000031 3300048908 Bacteria 137220
355 Ga0496105_0000041 3300048908 Bacteria 116618
356 Ga0496105_0000138 3300048908 Bacteria 48896
357 Ga0496105_0100300 3300048908 Bacteria 2391
358 Ga0496106_0000013 3300048909 Bacteria 202263
359 Ga0496106_0000048 3300048909 Bacteria 98233
360 Ga0496106_0000085 3300048909 Bacteria 74004
361 Ga0496106_1071770 3300048909 Bacteria 632
362 Ga0496107_0000008 3300048910 Bacteria 251874
363 Ga0496107_0000009 3300048910 Bacteria 231682
364 Ga0496107_0018066 3300048910 Bacteria 4961
365 Ga0496108_0000002 3300048911 Bacteria 700890
366 Ga0496108_0000024 3300048911 Bacteria 183389
367 Ga0496108_0013847 3300048911 Bacteria 6578
368 Ga0496109_0000001 3300048912 Bacteria 700852
369 Ga0496109_0000033 3300048912 Bacteria 160496
370 Ga0496109_0000237 3300048912 Bacteria 53743
371 Ga0496109_0000299 3300048912 Bacteria 46702
372 Ga0496109_0531341 3300048912 Bacteria 1110
373 Ga0496110_0000623 3300048913 Bacteria 24276
374 Ga0496110_0019624 3300048913 Bacteria 5693
375 Ga0496110_0030719 3300048913 Bacteria 4632
376 Ga0496111_0000004 3300048914 Bacteria 116115
377 Ga0496112_0000002 3300048915 Bacteria 782039
378 Ga0496112_1411081 3300048915 Bacteria 611
379 Ga0496113_0000030 3300048916 Bacteria 60123
380 Ga0496113_0064317 3300048916 Bacteria 2773
381 Ga0496113_0133870 3300048916 Bacteria 1947
382 Ga0496113_0150353 3300048916 Bacteria 1836
383 Ga0496113_0249356 3300048916 Bacteria 1417
384 Ga0496113_0277797 3300048916 Bacteria 1339
385 Ga0496113_1088056 3300048916 Bacteria 627
386 Ga0496114_0000010 3300048917 Bacteria 363396
387 Ga0496114_0039212 3300048917 Bacteria 3919
388 Ga0496114_0147901 3300048917 Bacteria 2037
389 Ga0496115_0000074 3300048918 Bacteria 90267
390 Ga0496115_0000426 3300048918 Bacteria 34356
391 Ga0496115_0130329 3300048918 Bacteria 2073
392 Ga0496117_0002396 3300048920 Bacteria 23836
393 Ga0496118_0001663 3300048921 Bacteria 32640
394 Ga0496119_0007318 3300048922 Bacteria 9988
395 Ga0496120_0012622 3300048923 Bacteria 5735
396 Ga0496120_0033829 3300048923 Bacteria 3068
397 Ga0496121_0015158 3300048924 Bacteria 8106
398 Ga0496121_0198005 3300048924 Bacteria 1434
399 Ga0496125_0347429 3300048928 Bacteria 887
400 Ga0501039_0207430 3300049575 Bacteria 1541
401 Ga0501039_0460958 3300049575 Bacteria 998
402 Ga0501042_0075210 3300049578 Bacteria 2417
403 Ga0501042_0079923 3300049578 Bacteria 2343
404 Ga0501042_0179089 3300049578 Bacteria 1529
405 Ga0501042_0480266 3300049578 Unclassified 902
406 Ga0501047_0144827 3300049581 Bacteria 2253
407 Ga0501047_0615014 3300049581 Bacteria 907
408 Ga0501070_0007649 3300049586 Bacteria 9174
409 Ga0501070_0151797 3300049586 Bacteria 1911
410 Ga0501070_0652302 3300049586 Bacteria 835
411 Ga0501071_0093518 3300049587 Bacteria 2211
412 Ga0501073_0194545 3300049589 Bacteria 1403
413 Ga0501075_0000855 3300049591 Bacteria 19203
414 Ga0501076_0440749 3300049592 Bacteria 1072
415 Ga0501079_0350391 3300049741 Bacteria 1157
416 Ga0501079_0566907 3300049741 Bacteria 893
417 Ga0501080_0312015 3300049742 Bacteria 1425
418 Ga0501080_0430295 3300049742 Bacteria 1185
419 Ga0501080_0504476 3300049742 Bacteria 1081
420 Ga0501083_0006940 3300049744 Bacteria 8036
421 Ga0501083_0061361 3300049744 Bacteria 2509
422 Ga0501083_0422554 3300049744 Bacteria 867
423 Ga0501044_0231612 3300049823 Bacteria 1794
424 nmdc:mga00v17_263865_c1 3300050491 Bacteria 1117
425 nmdc:mga06r32_144117_c1 3300050510 Bacteria 2359
426 nmdc:mga0a205_758_c1 3300050515 Bacteria 26047
427 nmdc:mga0a205_9_c1 3300050515 Bacteria 55726
428 Ga0495601_0006058 3300053077 Bacteria 7056
429 Ga0495601_0035298 3300053077 Bacteria 3120
430 Ga0495612_0005051 3300053078 Bacteria 5464
431 Ga0495612_0015869 3300053078 Bacteria 3019
432 Ga0495612_0017162 3300053078 Bacteria 2899
433 Ga0495612_0056035 3300053078 Bacteria 1626
434 Ga0495655_0000003 3300053083 Bacteria 303053
435 Ga0495655_0000494 3300053083 Bacteria 6565
436 Ga0495595_0000001 3300053084 Bacteria 495226
437 Ga0495595_0000109 3300053084 Bacteria 37617
438 Ga0495595_0007478 3300053084 Bacteria 4474
439 Ga0495595_0128331 3300053084 Bacteria 1238
440 Ga0495619_0000020 3300053085 Bacteria 201556
441 Ga0495619_0000024 3300053085 Bacteria 180821
442 Ga0495619_0000192 3300053085 Bacteria 45153
443 Ga0495619_0000909 3300053085 Bacteria 19385
444 Ga0495619_0003820 3300053085 Bacteria 9695
445 Ga0495619_0008262 3300053085 Bacteria 6585
446 Ga0495619_0033526 3300053085 Bacteria 3335
447 Ga0495619_0248662 3300053085 Bacteria 1232
448 Ga0500566_0113051 3300053094 Bacteria 1474
449 Ga0500641_0008785 3300053096 Bacteria 3616
450 Ga0500628_000002 3300053129 Bacteria 357687
451 Ga0500658_0089441 3300053134 Bacteria 1329
452 Ga0501082_0252153 3300060353 Bacteria 1536
453 Ga0070693_100000793
454 JGI24740J21852_10015307
455 JGI24748J21848_1000153
456 JGI24034J26672_10000074
457 JGI25406J46586_10105820
458 JGI25404J52841_10001611
459 Ga0070676_10250304
460 Ga0070683_100000190
461 Ga0070683_100006423
462 Ga0070683_100026488
463 Ga0070666_10099750
464 Ga0070680_100086792
465 Ga0070682_100000016
466 Ga0070682_100000029
467 Ga0070682_100546446
468 Ga0068868_100000451
469 Ga0070691_10000006
470 Ga0070661_100000217
471 Ga0070661_100756556
472 Ga0070668_100004533
473 Ga0070668_100125493
474 Ga0070668_100175933
475 Ga0070675_100000429
476 Ga0070674_100000033
477 Ga0070673_100061197
478 Ga0070688_100000225
479 Ga0070688_100000468
480 Ga0070659_100005667
481 Ga0070659_100104945
482 Ga0070667_100036060
483 Ga0070667_100213761
484 Ga0070713_100000091
485 Ga0070713_100229527
486 Ga0070700_100074195
487 Ga0070663_100160536
488 Ga0070678_100035596
489 Ga0070662_100000008
490 Ga0070681_10003882
491 Ga0068867_100000179
492 Ga0070685_10000028
493 Ga0070685_10000124
494 Ga0070685_10054812
495 Ga0070685_10235147
496 Ga0070679_100000823
497 Ga0070684_100038395
498 Ga0070684_100120662
499 Ga0070684_100147585
500 Ga0070684_100583644
501 Ga0068853_100001640
502 Ga0070665_100000725
503 Ga0070665_100940886
504 Ga0070665_101127227
505 Ga0070664_100068607
506 Ga0068854_100001877
507 Ga0068856_100000403
508 Ga0068856_100012776
509 Ga0068856_100175097
510 Ga0068859_101033536
511 Ga0068864_100000044
512 Ga0068866_10000002
513 Ga0068861_100174200
514 Ga0068851_10001306
515 Ga0068863_100000080
516 Ga0068863_100348404
517 Ga0068858_100000042
518 Ga0068858_100191811
519 Ga0068862_100003975
520 Ga0081455_10002828
521 Ga0081540_1000115
522 Ga0081540_1110476
523 Ga0081539_10014578
524 Ga0081539_10015825
525 Ga0075363_100069026
526 Ga0075364_10139681
527 Ga0070715_10000015
528 Ga0070712_100001773
529 Ga0068871_100373681
530 Ga0075431_100167373
531 Ga0075433_10000031
532 Ga0075433_10014844
533 Ga0068865_100000020
534 Ga0068865_100447576
535 Ga0097620_101033527
536 Ga0105240_10114751
537 Ga0105245_10000045
538 Ga0105245_10000150
539 Ga0105245_10000327
540 Ga0105247_10000712
541 Ga0105247_10110317
542 Ga0105243_10003341
543 Ga0105241_10185238
544 Ga0105242_10002594
545 Ga0105242_10199509
546 Ga0105248_10000803
547 Ga0105238_10000240
548 Ga0105249_10000095
549 Ga0105249_10003887
550 Ga0105249_10363249
551 Ga0105239_10084325
552 Ga0105239_10388796
553 Ga0157371_10001294
554 Ga0157370_10014499
555 Ga0157370_10810460
556 Ga0157369_10000037
557 Ga0157374_10000668
558 Ga0157374_10048215
559 Ga0157378_10040220
560 Ga0157378_10087410
561 Ga0163162_10145459
562 Ga0157375_10000723
563 Ga0157375_10006804
564 Ga0157375_10008069
565 Ga0157375_10070732
566 Ga0157375_11516413
567 Ga0163163_10045441
568 Ga0163163_10196423
569 Ga0163163_10542592
570 Ga0163163_10743312
571 Ga0157380_10000024
572 Ga0157380_10000202
573 Ga0157377_10840365
574 Ga0157379_10014627
575 Ga0157379_10080096
576 Ga0157379_10098744
577 Ga0157376_10031598
578 Ga0163161_10000058
579 Ga0163161_10008224
580 Ga0163161_10603072
581 Ga0207682_10000168
582 Ga0207642_10000001
583 Ga0207642_10000003
584 Ga0207710_10000103
585 Ga0207710_10122026
586 Ga0207680_10009661
587 Ga0207685_10000001
588 Ga0207645_10239622
589 Ga0207705_10019780
590 Ga0207707_10005314
591 Ga0207695_10059182
592 Ga0207693_10004681
593 Ga0207660_10069705
594 Ga0207657_10931802
595 Ga0207649_10001043
596 Ga0207649_10595316
597 Ga0207652_10001431
598 Ga0207681_10360888
599 Ga0207694_10000067
600 Ga0207659_10000620
601 Ga0207687_10000021
602 Ga0207687_10000023
603 Ga0207687_10000099
604 Ga0207687_10011461
605 Ga0207700_10000009
606 Ga0207700_10285879
607 Ga0207690_10004598
608 Ga0207690_10067260
609 Ga0207706_10000016
610 Ga0207686_10000544
611 Ga0207686_10142616
612 Ga0207709_10005335
613 Ga0207670_10373969
614 Ga0207669_10000137
615 Ga0207704_10000004
616 Ga0207704_10451620
617 Ga0207691_10000199
618 Ga0207711_10000019
619 Ga0207661_10000339
620 Ga0207661_10004401
621 Ga0207661_10017970
622 Ga0207661_10042628
623 Ga0207679_10052022
624 Ga0207651_10040926
625 Ga0207712_10000003
626 Ga0207712_10041844
627 Ga0207668_10101874
628 Ga0207640_10000122
629 Ga0207658_10081011
630 Ga0207677_10000376
631 Ga0207677_10001003
632 Ga0207703_10000060
633 Ga0207703_10083415
634 Ga0207639_10001333
635 Ga0207678_10185408
636 Ga0207708_10397768
637 Ga0207702_10000027
638 Ga0207702_10002040
639 Ga0207702_10135809
640 Ga0207641_10017737
641 Ga0207641_10043456
642 Ga0207648_10000228
643 Ga0207676_10000043
644 Ga0207675_100223504
645 Ga0207683_10055449
646 Ga0207698_10000002
647 Ga0207698_10118350
648 Ga0207698_10235825
649 Ga0268266_10007963
650 Ga0268266_10694875
651 Ga0268266_10817211
652 Ga0268264_10005149
653 Ga0268264_10075637
654 Ga0265337_1000013
655 Ga0265326_10000012
656 Ga0265319_1000421
657 Ga0265322_10000003
658 Ga0265336_10008458
659 Ga0265338_10002111
660 Ga0265338_10145700
661 Ga0265324_10000555
662 Ga0307511_10111674
663 Ga0265332_10020728
664 Ga0265328_10000700
665 Ga0265320_10000001
666 Ga0265325_10002586
667 Ga0265329_10011862
668 Ga0265339_10047749
669 Ga0265331_10001257
670 Ga0265331_10009894
671 Ga0265327_10000003
672 Ga0316579_10289415
673 Ga0265314_10000044
674 Ga0316576_10139582
675 Ga0373955_0192447
676 Ga0373933_0392673
677 Ga0373937_0010103
678 Ga0451789_1213367
679 Ga0451853_2334234
680 Ga0451853_2953792
681 Ga0466963_0000710
682 Ga0466963_0056231
683 Ga0466957_0001272
684 Ga0466957_0969190
685 Ga0466967_0000004
686 Ga0466967_0048500
687 Ga0466967_0252799
688 Ga0495592_0001063
689 Ga0495592_0297356
690 Ga0495603_0000095
691 Ga0495603_0001218
692 Ga0495629_0000682
693 Ga0495629_0001002
694 Ga0495641_0000187
695 Ga0495641_0046714
696 Ga0495641_0061422
697 Ga0495641_0306126
698 Ga0495651_0296487
699 Ga0495653_0106718
700 Ga0495582_0000005
701 Ga0495662_0006018
702 Ga0495594_0000004
703 Ga0495596_0080831
704 Ga0495606_0000045
705 Ga0495608_0000001
706 Ga0495608_0000702
707 Ga0495608_0126404
708 Ga0495618_0000068
709 Ga0495620_0005333
710 Ga0495628_0000070
711 Ga0495628_0002703
712 Ga0495628_0021689
713 Ga0495628_0152990
714 Ga0495630_0000037
715 Ga0495630_0001004
716 Ga0495630_0007991
717 Ga0495630_0140632
718 Ga0495630_0228201
719 Ga0495644_0000600
720 Ga0495652_0000066
721 Ga0495652_0006039
722 Ga0495640_0012284
723 Ga0495640_0098876
724 Ga0495586_0001124
725 Ga0495586_0372968
726 Ga0495587_0008303
727 Ga0495587_0225826
728 Ga0495587_0309140
729 Ga0495598_0039236
730 Ga0495645_0006912
731 Ga0495645_0013323
732 Ga0495622_0000016
733 Ga0495633_0014022
734 Ga0495667_0000015
735 Ga0495667_0412468
736 Ga0495634_0000592
737 Ga0495634_0000910
738 Ga0495634_0059188
739 Ga0495625_0000020
740 Ga0495635_0010981
741 Ga0495635_0074594
742 Ga0495588_0000735
743 Ga0495657_0000002
744 Ga0495657_0009242
745 Ga0495623_0119238
746 Ga0495623_0409505
747 Ga0495646_0378151
748 Ga0495647_0000037
749 Ga0495647_0001793
750 Ga0495647_0005678
751 Ga0495658_0000019
752 Ga0495658_0001723
753 Ga0495658_0901239
754 Ga0495669_0000163
755 Ga0495669_0011032
756 Ga0495613_0000257
757 Ga0495613_0119703
758 Ga0495613_0342610
759 Ga0495624_0000013
760 Ga0495624_0007342
761 Ga0495624_0081573
762 Ga0495670_0039887
763 Ga0495649_0011451
764 Ga0495600_0001883
765 Ga0495600_0014761
766 Ga0495581_0723748
767 Ga0495604_0000033
768 Ga0495604_0005980
769 Ga0495604_0034727
770 Ga0495674_0000007
771 Ga0495672_0158553
772 Ga0495676_0000091
773 Ga0495676_0000400
774 Ga0495676_0234414
775 Ga0495680_0000023
776 Ga0495680_0001062
777 Ga0495680_0002013
778 Ga0495680_0062008
779 Ga0495680_0174873
780 Ga0495675_0007835
781 Ga0495679_010053
782 Ga0495685_032903
783 Ga0495593_0060095
784 Ga0495602_0000010
785 Ga0495602_0001999
786 Ga0495602_0052115
787 Ga0495614_0020870
788 Ga0496100_0000003
789 Ga0496100_0000008
790 Ga0496100_0761050
791 Ga0496101_0000003
792 Ga0496101_0000016
793 Ga0496102_0000054
794 Ga0496102_0008829
795 Ga0496102_0258139
796 Ga0496103_0000079
797 Ga0496103_0012116
798 Ga0496103_0097534
799 Ga0496103_0103162
800 Ga0496103_0173817
801 Ga0496104_0000003
802 Ga0496104_0000063
803 Ga0496104_0001015
804 Ga0496104_0034860
805 Ga0496104_0211538
806 Ga0496105_0000031
807 Ga0496105_0000041
808 Ga0496105_0000138
809 Ga0496105_0100300
810 Ga0496106_0000013
811 Ga0496106_0000048
812 Ga0496106_0000085
813 Ga0496106_1071770
814 Ga0496107_0000008
815 Ga0496107_0000009
816 Ga0496107_0018066
817 Ga0496108_0000002
818 Ga0496108_0000024
819 Ga0496108_0013847
820 Ga0496109_0000001
821 Ga0496109_0000033
822 Ga0496109_0000237
823 Ga0496109_0000299
824 Ga0496109_0531341
825 Ga0496110_0000623
826 Ga0496110_0019624
827 Ga0496110_0030719
828 Ga0496111_0000004
829 Ga0496112_0000002
830 Ga0496112_1411081
831 Ga0496113_0000030
832 Ga0496113_0064317
833 Ga0496113_0133870
834 Ga0496113_0150353
835 Ga0496113_0249356
836 Ga0496113_0277797
837 Ga0496113_1088056
838 Ga0496114_0000010
839 Ga0496114_0039212
840 Ga0496114_0147901
841 Ga0496115_0000074
842 Ga0496115_0000426
843 Ga0496115_0130329
844 Ga0496117_0002396
845 Ga0496118_0001663
846 Ga0496119_0007318
847 Ga0496120_0012622
848 Ga0496120_0033829
849 Ga0496121_0015158
850 Ga0496121_0198005
851 Ga0496125_0347429
852 Ga0501039_0207430
853 Ga0501039_0460958
854 Ga0501042_0075210
855 Ga0501042_0079923
856 Ga0501042_0179089
857 Ga0501042_0480266
858 Ga0501047_0144827
859 Ga0501047_0615014
860 Ga0501070_0007649
861 Ga0501070_0151797
862 Ga0501070_0652302
863 Ga0501071_0093518
864 Ga0501073_0194545
865 Ga0501075_0000855
866 Ga0501076_0440749
867 Ga0501079_0350391
868 Ga0501079_0566907
869 Ga0501080_0312015
870 Ga0501080_0430295
871 Ga0501080_0504476
872 Ga0501083_0006940
873 Ga0501083_0061361
874 Ga0501083_0422554
875 Ga0501044_0231612
876 nmdc:mga00v17_263865_c1
877 nmdc:mga06r32_144117_c1
878 nmdc:mga0a205_758_c1
879 nmdc:mga0a205_9_c1
880 Ga0495601_0006058
881 Ga0495601_0035298
882 Ga0495612_0005051
883 Ga0495612_0015869
884 Ga0495612_0017162
885 Ga0495612_0056035
886 Ga0495655_0000003
887 Ga0495655_0000494
888 Ga0495595_0000001
889 Ga0495595_0000109
890 Ga0495595_0007478
891 Ga0495595_0128331
892 Ga0495619_0000020
893 Ga0495619_0000024
894 Ga0495619_0000192
895 Ga0495619_0000909
896 Ga0495619_0003820
897 Ga0495619_0008262
898 Ga0495619_0033526
899 Ga0495619_0248662
900 Ga0500566_0113051
901 Ga0500641_0008785
902 Ga0500628_000002
903 Ga0500658_0089441
904 Ga0501082_0252153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02397

Bac_transf

Bacterial sugar transferase

12

190

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8g1n-assembly2.cif.gz_B structure of campylobacter concisus pglc i57m/q175m variant with modeled c-terminus 0.828 3 183
8e37-assembly4.cif.gz_D structure of campylobacter concisus wild-type semet pglc 0.8251 3 179
8g1n-assembly1.cif.gz_A structure of campylobacter concisus pglc i57m/q175m variant with modeled c-terminus 0.8105 3 183
8g1n-assembly2.cif.gz_B structure of campylobacter concisus pglc i57m/q175m variant with modeled c-terminus 0.7833 3 183
8g1n-assembly1.cif.gz_A structure of campylobacter concisus pglc i57m/q175m variant with modeled c-terminus 0.7824 3 183
ID Description Score Start End Superfamily
af_O06389_10_125_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.6601 34 58 2.30.110.10
2i6sA03 Mainly Beta;Beta Barrel;Thrombin, subunit H;Trypsin-like serine proteases 0.5677 34 56 2.40.10.10
af_C6TE45_50_189_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.5135 24 60 2.30.110.10
af_Q0J6W9_62_206_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.4992 21 59 2.30.110.10
1nqyA00 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.4934 37 55 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A524JGT0-F1-model_v4 Sugar transferase 0.9784 1 187 GO:0016020
GO:0016780
AF-A0A537YT64-F1-model_v4 Sugar transferase 0.9776 1 187 GO:0016780
AF-A0A537ZWT0-F1-model_v4 Sugar transferase 0.9772 1 136 GO:0016020
GO:0016780
AF-A0A640YB93-F1-model_v4 Sugar transferase 0.9766 33 186 GO:0016780
AF-A0A524JGT0-F1-model_v4 Sugar transferase 0.9733 1 187 GO:0016020
GO:0016780

Map