F446943

General Info

Members Datasets Scaffolds Average Seq Length
452 219 451 101

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10600550|Ga0075365_106005501
Length 102
Sequence MKAVWNGIVIADAPKEDLIYIEQNWYFPPESVKKEFLRKSPTPYTCPWKGMCQYFDVGQDQGEKWSKDNAWSYPEPKPSAIDIVKKDFSNYIAFWRDVEVSE

Samples

Sample ID Description Type Environment
1 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300009987 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_213 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
134 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
139 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
140 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
146 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
147 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
148 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
151 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
152 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
153 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
154 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
155 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
158 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
159 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
160 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
163 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
174 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
179 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
180 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
181 3300049773 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_B_4_control Metagenome Rhizosphere
182 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
183 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
192 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
193 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
194 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
195 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
196 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
197 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
198 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
199 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
200 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
201 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
202 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
203 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
204 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
205 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
206 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
207 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
208 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
209 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
210 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
211 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
212 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
213 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
214 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
215 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
216 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
217 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
218 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
219 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.44
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.89
Nodule 0
Rhizoplane 3.32
Rhizosphere 69.25
Stem 0
Stem Tuber 0
Unclassified 3.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1015516 3300001915 Bacteria 1257
2 JGI24740J21852_10007732 3300001979 Bacteria 4345
3 JGI24740J21852_10029080 3300001979 Bacteria 1819
4 JGI24740J21852_10075510 3300001979 Unclassified 893
5 JGI24739J22299_10056926 3300001989 Unclassified 1245
6 JGI24737J22298_10000002 3300001990 Bacteria 76949
7 JGI24737J22298_10001293 3300001990 Bacteria 8867
8 JGI24743J22301_10005338 3300001991 Bacteria 2140
9 JGI24735J21928_10000042 3300002067 Bacteria 58971
10 JGI24735J21928_10000921 3300002067 Bacteria 10515
11 JGI24738J21930_10000621 3300002075 Bacteria 10196
12 rootH1_10150186 3300003316 Bacteria 1100
13 rootH2_10000244 3300003320 Bacteria 697651
14 rootH2_10070509 3300003320 Bacteria 4372
15 rootL2_10120990 3300003322 Bacteria 12741
16 rootL2_10311552 3300003322 Bacteria 1252
17 rootH1_10199138 3300003323 Unclassified 1709
18 rootH1_10346889 3300003323 Bacteria 2425
19 Ga0065714_10051138 3300005288 Bacteria 562
20 Ga0070658_10000024 3300005327 Bacteria 175873
21 Ga0070658_10000036 3300005327 Bacteria 143743
22 Ga0070658_10000064 3300005327 Bacteria 106537
23 Ga0070658_10000358 3300005327 Bacteria 39704
24 Ga0070658_10001718 3300005327 Bacteria 18491
25 Ga0070658_10154787 3300005327 Bacteria 1921
26 Ga0070676_10025926 3300005328 Bacteria 3317
27 Ga0070683_100000130 3300005329 Bacteria 48482
28 Ga0070683_100000630 3300005329 Bacteria 25350
29 Ga0070683_100004271 3300005329 Bacteria 11729
30 Ga0070683_100589730 3300005329 Bacteria 1063
31 Ga0070683_100944768 3300005329 Bacteria 827
32 Ga0070670_102039884 3300005331 Unclassified 528
33 Ga0068869_100198383 3300005334 Bacteria 1581
34 Ga0070666_10058154 3300005335 Unclassified 2614
35 Ga0070666_10182509 3300005335 Unclassified 1472
36 Ga0070682_100001438 3300005337 Bacteria 13384
37 Ga0070682_100493882 3300005337 Bacteria 947
38 Ga0070682_100539386 3300005337 Unclassified 911
39 Ga0070660_100000047 3300005339 Bacteria 69868
40 Ga0070660_100030055 3300005339 Bacteria 4074
41 Ga0070660_100107063 3300005339 Bacteria 2221
42 Ga0070660_100401574 3300005339 Unclassified 1133
43 Ga0070689_101065294 3300005340 Bacteria 721
44 Ga0070689_101657412 3300005340 Unclassified 581
45 Ga0070661_100019067 3300005344 Unclassified 4884
46 Ga0070661_100387831 3300005344 Unclassified 1102
47 Ga0070668_100290902 3300005347 Bacteria 1367
48 Ga0070671_100000001 3300005355 Bacteria 1228151
49 Ga0070671_100028476 3300005355 Bacteria 4600
50 Ga0070674_100093439 3300005356 Unclassified 2176
51 Ga0070674_100094241 3300005356 Bacteria 2168
52 Ga0070673_100000281 3300005364 Bacteria 26376
53 Ga0070659_100005130 3300005366 Bacteria 9394
54 Ga0070659_100081590 3300005366 Bacteria 2583
55 Ga0070659_100094402 3300005366 Unclassified 2402
56 Ga0070659_100260306 3300005366 Bacteria 1439
57 Ga0070659_101166373 3300005366 Unclassified 680
58 Ga0070667_100001577 3300005367 Bacteria 20416
59 Ga0070667_102269091 3300005367 Unclassified 511
60 Ga0070710_10730544 3300005437 Bacteria 701
61 Ga0070663_100081405 3300005455 Bacteria 2380
62 Ga0070663_100142634 3300005455 Bacteria 1830
63 Ga0070663_101605712 3300005455 Unclassified 580
64 Ga0070678_100007428 3300005456 Bacteria 6501
65 Ga0070678_100013372 3300005456 Bacteria 5143
66 Ga0070662_100005247 3300005457 Bacteria 8267
67 Ga0070662_100940743 3300005457 Unclassified 738
68 Ga0070681_10288498 3300005458 Bacteria 1551
69 Ga0068867_100001921 3300005459 Bacteria 14469
70 Ga0070685_10001280 3300005466 Bacteria 13289
71 Ga0070685_10003495 3300005466 Bacteria 7997
72 Ga0070679_100107940 3300005530 Bacteria 2769
73 Ga0070679_100175195 3300005530 Bacteria 2117
74 Ga0070679_100750535 3300005530 Unclassified 919
75 Ga0070679_101000256 3300005530 Unclassified 780
76 Ga0070679_101534758 3300005530 Unclassified 613
77 Ga0070684_100000268 3300005535 Bacteria 36020
78 Ga0070684_100002696 3300005535 Bacteria 13117
79 Ga0070684_100021351 3300005535 Bacteria 5386
80 Ga0070684_100880456 3300005535 Unclassified 839
81 Ga0068853_100382316 3300005539 Bacteria 1315
82 Ga0070672_100179057 3300005543 Bacteria 1766
83 Ga0070665_100103831 3300005548 Bacteria 2845
84 Ga0070665_100157951 3300005548 Bacteria 2269
85 Ga0068855_100000003 3300005563 Bacteria 589862
86 Ga0068855_100023799 3300005563 Bacteria 7337
87 Ga0068855_100115892 3300005563 Unclassified 3071
88 Ga0068855_100783488 3300005563 Bacteria 1014
89 Ga0068855_101015773 3300005563 Unclassified 871
90 Ga0070664_100000123 3300005564 Bacteria 51444
91 Ga0070664_100229077 3300005564 Bacteria 1665
92 Ga0068857_100010383 3300005577 Bacteria 8091
93 Ga0068857_100194440 3300005577 Bacteria 1848
94 Ga0068856_100001042 3300005614 Bacteria 29439
95 Ga0068856_100001649 3300005614 Bacteria 23391
96 Ga0068856_100736031 3300005614 Unclassified 1006
97 Ga0068852_100026607 3300005616 Bacteria 4705
98 Ga0068859_101104360 3300005617 Bacteria 872
99 Ga0068863_100025044 3300005841 Bacteria 5690
100 Ga0068858_100025953 3300005842 Bacteria 5449
101 Ga0068860_100411886 3300005843 Bacteria 1339
102 Ga0081455_10504650 3300005937 Unclassified 811
103 Ga0075365_10007333 3300006038 Bacteria 6166
104 Ga0075365_10028291 3300006038 Bacteria 3574
105 Ga0075365_10041265 3300006038 Bacteria 3014
106 Ga0075365_10392422 3300006038 Unclassified 979
107 Ga0075365_10600550 3300006038 Unclassified 778
108 Ga0075363_100000019 3300006048 Bacteria 34359
109 Ga0075363_100049288 3300006048 Bacteria 2242
110 Ga0075363_101003606 3300006048 Bacteria 514
111 Ga0075364_10001004 3300006051 Viruses 14949
112 Ga0075364_10012949 3300006051 Bacteria 5119
113 Ga0075364_10033410 3300006051 Bacteria 3313
114 Ga0075364_10112213 3300006051 Bacteria 1820
115 Ga0075362_10001555 3300006177 Bacteria 7410
116 Ga0075367_10000530 3300006178 Bacteria 14413
117 Ga0075367_10002952 3300006178 Bacteria 7945
118 Ga0075367_10010684 3300006178 Bacteria 4833
119 Ga0075369_10000012 3300006186 Bacteria 74833
120 Ga0075369_10010438 3300006186 Bacteria 3632
121 Ga0075369_10064793 3300006186 Bacteria 1601
122 Ga0075366_10000001 3300006195 Bacteria 569172
123 Ga0075366_10000761 3300006195 Bacteria 15303
124 Ga0075366_10001138 3300006195 Bacteria 13138
125 Ga0075366_10058739 3300006195 Bacteria 2285
126 Ga0075366_10144429 3300006195 Unclassified 1439
127 Ga0075366_10184608 3300006195 Unclassified 1267
128 Ga0097621_100000002 3300006237 Bacteria 172240
129 Ga0097621_100356038 3300006237 Unclassified 1303
130 Ga0075370_10000669 3300006353 Bacteria 13369
131 Ga0075370_10001409 3300006353 Bacteria 10390
132 Ga0075370_10014176 3300006353 Unclassified 4247
133 Ga0075370_10099713 3300006353 Unclassified 1680
134 Ga0068871_100000425 3300006358 Bacteria 29068
135 Ga0068871_100132515 3300006358 Bacteria 2114
136 Ga0068871_100318756 3300006358 Bacteria 1368
137 Ga0068865_100002991 3300006881 Bacteria 10088
138 Ga0097620_101104274 3300006931 Bacteria 872
139 Ga0105250_10236119 3300009092 Bacteria 778
140 Ga0105240_10000003 3300009093 Bacteria 1183681
141 Ga0105240_10000118 3300009093 Bacteria 163934
142 Ga0105240_10014069 3300009093 Bacteria 10941
143 Ga0105240_10409288 3300009093 Bacteria 1526
144 Ga0105240_11166690 3300009093 Bacteria 817
145 Ga0111539_10061512 3300009094 Unclassified 4448
146 Ga0105245_10000002 3300009098 Bacteria 634374
147 Ga0105245_10000093 3300009098 Bacteria 86866
148 Ga0105245_10001246 3300009098 Bacteria 22974
149 Ga0105245_10104152 3300009098 Bacteria 2630
150 Ga0105245_10396341 3300009098 Unclassified 1378
151 Ga0105243_10000001 3300009148 Bacteria 1156578
152 Ga0105243_10003826 3300009148 Bacteria 12040
153 Ga0105243_12283942 3300009148 Unclassified 578
154 Ga0105241_10000007 3300009174 Bacteria 343524
155 Ga0105241_10003617 3300009174 Bacteria 11488
156 Ga0105241_10006098 3300009174 Bacteria 8885
157 Ga0105241_10028502 3300009174 Bacteria 4162
158 Ga0105241_10954096 3300009174 Bacteria 800
159 Ga0105242_10000002 3300009176 Bacteria 262559
160 Ga0105242_10002304 3300009176 Bacteria 15058
161 Ga0105248_11474791 3300009177 Bacteria 770
162 Ga0105237_10082847 3300009545 Unclassified 3199
163 Ga0105237_10151889 3300009545 Bacteria 2312
164 Ga0105237_10370243 3300009545 Bacteria 1438
165 Ga0105237_10890624 3300009545 Unclassified 897
166 Ga0105238_10234588 3300009551 Bacteria 1812
167 Ga0105238_10758997 3300009551 Unclassified 984
168 Ga0105238_10905273 3300009551 Unclassified 901
169 Ga0105238_11038143 3300009551 Bacteria 841
170 Ga0105249_10000950 3300009553 Bacteria 25626
171 Ga0105249_10221107 3300009553 Bacteria 1863
172 Ga0105249_10777323 3300009553 Bacteria 1021
173 Ga0105249_10859798 3300009553 Bacteria 973
174 Ga0105249_11188471 3300009553 Bacteria 834
175 Ga0105249_11778504 3300009553 Bacteria 689
176 Ga0105030_100222 3300009987 Bacteria 4909
177 Ga0105239_10009404 3300010375 Bacteria 11022
178 Ga0105239_10024960 3300010375 Bacteria 6585
179 Ga0105239_11469571 3300010375 Unclassified 787
180 Ga0105246_10000681 3300011119 Bacteria 19073
181 Ga0157313_1021655 3300012503 Unclassified 661
182 Ga0157373_10000096 3300013100 Bacteria 72510
183 Ga0157373_10067052 3300013100 Unclassified 2538
184 Ga0157373_10546378 3300013100 Unclassified 840
185 Ga0157373_10686613 3300013100 Unclassified 749
186 Ga0157373_11021037 3300013100 Unclassified 618
187 Ga0157371_10002104 3300013102 Bacteria 19431
188 Ga0157371_10125898 3300013102 Bacteria 1822
189 Ga0157371_10367761 3300013102 Bacteria 1049
190 Ga0157370_10049328 3300013104 Bacteria 4029
191 Ga0157369_10000029 3300013105 Bacteria 206955
192 Ga0157369_10000104 3300013105 Bacteria 118133
193 Ga0157369_10109370 3300013105 Bacteria 2939
194 Ga0157369_12040753 3300013105 Bacteria 582
195 Ga0157374_10000018 3300013296 Bacteria 286683
196 Ga0157374_10000225 3300013296 Bacteria 52365
197 Ga0157374_10000509 3300013296 Bacteria 35015
198 Ga0157374_10277303 3300013296 Bacteria 1655
199 Ga0157374_10298358 3300013296 Bacteria 1594
200 Ga0157374_10534411 3300013296 Bacteria 1179
201 Ga0157378_10007914 3300013297 Bacteria 9273
202 Ga0157378_10436086 3300013297 Unclassified 1297
203 Ga0157372_13219081 3300013307 Unclassified 521
204 Ga0157375_10422544 3300013308 Bacteria 1499
205 Ga0163163_10026154 3300014325 Bacteria 5574
206 Ga0163163_10163141 3300014325 Bacteria 2274
207 Ga0157377_10006655 3300014745 Bacteria 5525
208 Ga0157377_10455560 3300014745 Unclassified 884
209 Ga0157379_10463621 3300014968 Unclassified 1171
210 Ga0157379_12215249 3300014968 Bacteria 546
211 Ga0157376_10000007 3300014969 Bacteria 368004
212 Ga0157376_11394009 3300014969 Unclassified 732
213 Ga0197907_10746141 3300020069 Bacteria 599
214 Ga0154015_1351290 3300020610 Bacteria 779
215 Ga0207688_10607323 3300025901 Unclassified 689
216 Ga0207680_10084491 3300025903 Bacteria 2003
217 Ga0207680_10196562 3300025903 Unclassified 1372
218 Ga0207647_10012220 3300025904 Bacteria 5985
219 Ga0207647_10052021 3300025904 Bacteria 2529
220 Ga0207647_10318198 3300025904 Unclassified 884
221 Ga0207645_10126072 3300025907 Bacteria 1664
222 Ga0207705_10000001 3300025909 Bacteria 2061880
223 Ga0207705_10000011 3300025909 Bacteria 517768
224 Ga0207705_10000047 3300025909 Bacteria 175887
225 Ga0207705_10000104 3300025909 Bacteria 96668
226 Ga0207705_10000136 3300025909 Bacteria 79294
227 Ga0207705_10003197 3300025909 Bacteria 12475
228 Ga0207705_10033403 3300025909 Bacteria 3675
229 Ga0207705_10145861 3300025909 Bacteria 1771
230 Ga0207654_10000002 3300025911 Bacteria 1460142
231 Ga0207654_10001716 3300025911 Bacteria 11416
232 Ga0207707_10031690 3300025912 Bacteria 4627
233 Ga0207707_11169274 3300025912 Bacteria 624
234 Ga0207695_10000005 3300025913 Bacteria 1196715
235 Ga0207695_10000675 3300025913 Bacteria 67072
236 Ga0207695_10033883 3300025913 Bacteria 5560
237 Ga0207671_10084304 3300025914 Bacteria 2387
238 Ga0207671_10941497 3300025914 Unclassified 682
239 Ga0207657_10000883 3300025919 Bacteria 31684
240 Ga0207657_10010727 3300025919 Bacteria 9123
241 Ga0207657_10099514 3300025919 Bacteria 2415
242 Ga0207657_10151820 3300025919 Bacteria 1886
243 Ga0207649_10021978 3300025920 Bacteria 3682
244 Ga0207649_10819650 3300025920 Unclassified 727
245 Ga0207652_10224400 3300025921 Bacteria 1693
246 Ga0207652_10346494 3300025921 Bacteria 1341
247 Ga0207652_11288012 3300025921 Unclassified 633
248 Ga0207652_11360776 3300025921 Unclassified 613
249 Ga0207694_10040504 3300025924 Bacteria 3587
250 Ga0207694_10637470 3300025924 Unclassified 897
251 Ga0207694_11083558 3300025924 Bacteria 678
252 Ga0207650_10633195 3300025925 Bacteria 901
253 Ga0207687_10000001 3300025927 Bacteria 1130810
254 Ga0207687_10000008 3300025927 Bacteria 497738
255 Ga0207687_10000127 3300025927 Bacteria 51055
256 Ga0207687_10002066 3300025927 Bacteria 13750
257 Ga0207687_10051088 3300025927 Bacteria 2880
258 Ga0207687_10562729 3300025927 Unclassified 957
259 Ga0207644_10000001 3300025931 Bacteria 1243214
260 Ga0207690_10011190 3300025932 Bacteria 5357
261 Ga0207690_10084187 3300025932 Bacteria 2229
262 Ga0207690_10260762 3300025932 Bacteria 1343
263 Ga0207690_10261910 3300025932 Unclassified 1340
264 Ga0207706_10000073 3300025933 Bacteria 103803
265 Ga0207706_10792790 3300025933 Unclassified 805
266 Ga0207686_10000001 3300025934 Bacteria 1169580
267 Ga0207686_10003972 3300025934 Bacteria 7940
268 Ga0207709_10000002 3300025935 Bacteria 1171536
269 Ga0207709_10007890 3300025935 Bacteria 5899
270 Ga0207709_10610940 3300025935 Unclassified 864
271 Ga0207669_10045089 3300025937 Bacteria 2596
272 Ga0207669_10108992 3300025937 Bacteria 1850
273 Ga0207704_10006808 3300025938 Bacteria 5354
274 Ga0207691_10913799 3300025940 Bacteria 734
275 Ga0207689_10216630 3300025942 Bacteria 1582
276 Ga0207661_10000118 3300025944 Bacteria 50730
277 Ga0207661_10000715 3300025944 Bacteria 21548
278 Ga0207661_10002428 3300025944 Bacteria 12834
279 Ga0207679_10000124 3300025945 Bacteria 63038
280 Ga0207679_10465815 3300025945 Bacteria 1123
281 Ga0207667_10000008 3300025949 Bacteria 625138
282 Ga0207667_10039223 3300025949 Bacteria 5050
283 Ga0207667_10372734 3300025949 Unclassified 1455
284 Ga0207667_10453230 3300025949 Unclassified 1303
285 Ga0207667_11464125 3300025949 Bacteria 655
286 Ga0207651_10000182 3300025960 Bacteria 27344
287 Ga0207712_10000664 3300025961 Bacteria 26702
288 Ga0207712_10711351 3300025961 Bacteria 877
289 Ga0207712_10901169 3300025961 Unclassified 781
290 Ga0207712_10950424 3300025961 Archaea 761
291 Ga0207640_10225388 3300025981 Bacteria 1438
292 Ga0207658_10005578 3300025986 Bacteria 8610
293 Ga0207703_10019970 3300026035 Bacteria 5236
294 Ga0207678_10037434 3300026067 Bacteria 4219
295 Ga0207678_10167379 3300026067 Bacteria 1877
296 Ga0207702_10000622 3300026078 Bacteria 39021
297 Ga0207702_10003296 3300026078 Bacteria 14883
298 Ga0207702_10241175 3300026078 Unclassified 1694
299 Ga0207641_10018237 3300026088 Bacteria 5753
300 Ga0207648_10011674 3300026089 Bacteria 8267
301 Ga0207674_10039537 3300026116 Bacteria 4889
302 Ga0207674_11177044 3300026116 Unclassified 736
303 Ga0207683_10015550 3300026121 Bacteria 6480
304 Ga0207683_10019942 3300026121 Bacteria 5728
305 Ga0207698_10015936 3300026142 Bacteria 5053
306 Ga0209998_10006792 3300027717 Unclassified 2373
307 Ga0209813_10000002 3300027866 Bacteria 215993
308 Ga0209974_10100740 3300027876 Bacteria 1009
309 Ga0207428_10089215 3300027907 Unclassified 2396
310 Ga0268266_10006586 3300028379 Bacteria 10608
311 Ga0268266_10181766 3300028379 Bacteria 1915
312 Ga0268264_10340783 3300028381 Bacteria 1424
313 Ga0265337_1043355 3300028556 Bacteria 1286
314 Ga0265319_1127044 3300028563 Bacteria 793
315 Ga0265334_10000028 3300028573 Bacteria 115200
316 Ga0265334_10009331 3300028573 Bacteria 4151
317 Ga0265338_10000323 3300028800 Bacteria 87009
318 Ga0265338_10000412 3300028800 Bacteria 76488
319 Ga0265338_10013408 3300028800 Bacteria 9259
320 Ga0265338_10169880 3300028800 Bacteria 1674
321 Ga0265340_10000065 3300031247 Bacteria 49264
322 Ga0265327_10002867 3300031251 Bacteria 17361
323 Ga0265327_10030184 3300031251 Unclassified 3069
324 Ga0307516_10090958 3300031730 Bacteria 2880
325 Ga0373959_0000406 3300034820 Bacteria 8360
326 Ga0373952_0126756 3300035092 Bacteria 697
327 Ga0395900_0010665 3300037418 Bacteria 9397
328 Ga0395900_0025872 3300037418 Bacteria 6008
329 Ga0395900_1141773 3300037418 Unclassified 696
330 Ga0395898_0031124 3300037466 Bacteria 5336
331 Ga0395898_0662887 3300037466 Bacteria 986
332 Ga0395901_0057396 3300038443 Bacteria 4049
333 Ga0395901_0982106 3300038443 Bacteria 821
334 Ga0451789_0323029 3300041443 Bacteria 985
335 Ga0451791_0801622 3300041451 Bacteria 1017
336 Ga0451793_1269411 3300041452 Bacteria 646
337 Ga0451793_1546724 3300041452 Bacteria 667
338 Ga0451793_1566048 3300041452 Bacteria 1040
339 Ga0451795_0191986 3300041456 Bacteria 879
340 Ga0451802_0033264 3300041460 Bacteria 663
341 Ga0451802_0812737 3300041460 Bacteria 1770
342 Ga0451806_851107 3300041462 Bacteria 550
343 Ga0451807_1780302 3300041486 Bacteria 941
344 Ga0451833_1416120 3300041491 Unclassified 1244
345 Ga0451839_0246786 3300041496 Bacteria 709
346 Ga0451839_0382291 3300041496 Bacteria 875
347 Ga0451841_0749446 3300041498 Bacteria 939
348 Ga0451845_0362547 3300041501 Unclassified 682
349 Ga0451853_3639293 3300041512 Unclassified 1824
350 Ga0439463_028621 3300042016 Unclassified 1404
351 Ga0439464_0000023 3300042439 Bacteria 20242
352 Ga0495629_0237441 3300046459 Unclassified 1255
353 Ga0495622_0000051 3300046557 Bacteria 105674
354 Ga0495588_0000173 3300046674 Bacteria 81355
355 Ga0495588_0507315 3300046674 Bacteria 632
356 Ga0495649_0000069 3300046694 Bacteria 90066
357 Ga0495600_0023406 3300046809 Bacteria 3974
358 Ga0496104_0799066 3300048907 Bacteria 850
359 Ga0496104_1029170 3300048907 Bacteria 727
360 Ga0496108_0954479 3300048911 Bacteria 734
361 Ga0496109_0126027 3300048912 Bacteria 2388
362 Ga0496112_0020062 3300048915 Bacteria 6328
363 Ga0496117_0000178 3300048920 Bacteria 131062
364 Ga0496118_0105685 3300048921 Bacteria 1886
365 Ga0501032_0654400 3300049569 Bacteria 667
366 Ga0501033_0551476 3300049570 Bacteria 794
367 Ga0501037_0119878 3300049573 Bacteria 1892
368 Ga0501072_0781411 3300049588 Bacteria 748
369 Ga0501080_0533687 3300049742 Bacteria 1046
370 Ga0501083_1002300 3300049744 Unclassified 543
371 Ga0501276_000571 3300049773 Bacteria 2301
372 nmdc:mga03683_242_c1 3300050489 Bacteria 17040
373 nmdc:mga03683_431672_c1 3300050489 Unclassified 632
374 nmdc:mga03n38_31367_c1 3300050490 Bacteria 2242
375 nmdc:mga03n38_33_c1 3300050490 Bacteria 30986
376 nmdc:mga00v17_234288_c1 3300050491 Bacteria 1190
377 nmdc:mga00v17_348_c1 3300050491 Bacteria 26056
378 nmdc:mga00v17_37955_c1 3300050491 Bacteria 2878
379 nmdc:mga00v17_816_c1 3300050491 Bacteria 16942
380 nmdc:mga0yw44_17669_c1 3300050492 Bacteria 3887
381 nmdc:mga0yw44_321085_c1 3300050492 Bacteria 1040
382 nmdc:mga0yw44_43389_c1 3300050492 Bacteria 2685
383 nmdc:mga0k408_1035_c1 3300050493 Bacteria 15259
384 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
385 nmdc:mga0k408_53877_c1 3300050493 Unclassified 2331
386 nmdc:mga0k408_8313_c1 3300050493 Bacteria 2303
387 nmdc:mga0k408_92316_c2 3300050493 Unclassified 1287
388 nmdc:mga06z11_10_c1 3300050494 Bacteria 105982
389 nmdc:mga06z11_19880_c1 3300050494 Bacteria 3096
390 nmdc:mga04h51_159856_c1 3300050495 Bacteria 866
391 nmdc:mga04h51_240657_c1 3300050495 Unclassified 722
392 nmdc:mga04h51_2_c1 3300050495 Bacteria 215993
393 nmdc:mga07m45_299340_c2 3300050496 Unclassified 619
394 nmdc:mga07m45_5638_c3 3300050496 Unclassified 4493
395 nmdc:mga07m45_657531_c1 3300050496 Unclassified 604
396 nmdc:mga08y16_52219_c1 3300050511 Unclassified 4277
397 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
398 nmdc:mga0sz30_44361_c1 3300050516 Unclassified 1873
399 nmdc:mga0sz30_4_c1 3300050516 Bacteria 84956
400 Ga0500610_0000002 3300053079 Bacteria 166752
401 Ga0500610_0040889 3300053079 Unclassified 2397
402 Ga0500643_000010 3300053087 Bacteria 408084
403 Ga0500643_000011 3300053087 Bacteria 385630
404 Ga0500643_000251 3300053087 Bacteria 49425
405 Ga0500643_057077 3300053087 Bacteria 1102
406 Ga0500644_0000198 3300053088 Bacteria 36907
407 Ga0500644_0000912 3300053088 Bacteria 9414
408 Ga0500644_0001342 3300053088 Bacteria 6599
409 Ga0500644_0083425 3300053088 Bacteria 1180
410 Ga0500646_0000048 3300053090 Bacteria 33067
411 Ga0500583_0000057 3300053092 Bacteria 71874
412 Ga0500583_0019312 3300053092 Bacteria 2792
413 Ga0500583_0161749 3300053092 Unclassified 1115
414 Ga0500583_0223144 3300053092 Bacteria 934
415 Ga0500651_0000051 3300053093 Bacteria 76584
416 Ga0500651_0001287 3300053093 Bacteria 12507
417 Ga0500566_0000001 3300053094 Bacteria 1101031
418 Ga0500650_0000003 3300053098 Bacteria 164144
419 Ga0500555_000001 3300053103 Bacteria 1353713
420 Ga0500555_000002 3300053103 Bacteria 1314346
421 Ga0500555_022544 3300053103 Bacteria 1809
422 Ga0500556_0000196 3300053104 Bacteria 49648
423 Ga0500562_000002 3300053108 Bacteria 977234
424 Ga0500562_006272 3300053108 Bacteria 2999
425 Ga0500562_047200 3300053108 Unclassified 1149
426 Ga0500562_088352 3300053108 Bacteria 841
427 Ga0500593_000001 3300053117 Bacteria 784404
428 Ga0500594_0000001 3300053118 Bacteria 1178472
429 Ga0500594_0000145 3300053118 Bacteria 19337
430 Ga0500614_000001 3300053123 Bacteria 1274484
431 Ga0500614_000766 3300053123 Bacteria 8140
432 Ga0500614_001485 3300053123 Bacteria 5591
433 Ga0500628_000009 3300053129 Bacteria 122386
434 Ga0500628_092470 3300053129 Bacteria 790
435 Ga0500642_0028246 3300053130 Unclassified 2311
436 Ga0500652_000049 3300053131 Bacteria 55921
437 Ga0500655_004786 3300053133 Bacteria 2436
438 Ga0500568_0028275 3300053139 Bacteria 2338
439 Ga0500573_0023781 3300053140 Bacteria 3519
440 Ga0500577_0000116 3300053142 Bacteria 19551
441 Ga0500577_0157453 3300053142 Bacteria 966
442 Ga0500579_000782 3300053143 Bacteria 18254
443 Ga0500589_000002 3300053147 Bacteria 245055
444 Ga0500604_0012014 3300053151 Bacteria 2334
445 Ga0500604_0090225 3300053151 Unclassified 1000
446 Ga0500604_0265987 3300053151 Unclassified 594
447 Ga0500633_0006053 3300053160 Bacteria 2935
448 Ga0500649_000002 3300053722 Bacteria 145889
449 Ga0500611_000214 3300053727 Bacteria 6990
450 Ga0500611_008725 3300053727 Bacteria 1579
451 Ga0501082_1330244 3300060353 Bacteria 628

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2939657138 2939659495 96
2 3300001915 JGI24741J21665_1015516 JGI24741J21665_10155162 100
3 3300001979 JGI24740J21852_10007732 JGI24740J21852_100077322 100
4 3300001979 JGI24740J21852_10029080 JGI24740J21852_100290803 100
5 3300001979 JGI24740J21852_10075510 JGI24740J21852_100755102 100
6 3300001989 JGI24739J22299_10056926 JGI24739J22299_100569262 100
7 3300001990 JGI24737J22298_10000002 JGI24737J22298_1000000263 100
8 3300001990 JGI24737J22298_10001293 JGI24737J22298_100012939 100
9 3300001991 JGI24743J22301_10005338 JGI24743J22301_100053382 100
10 3300002067 JGI24735J21928_10000042 JGI24735J21928_1000004240 100
11 3300002067 JGI24735J21928_10000921 JGI24735J21928_100009219 100
12 3300002075 JGI24738J21930_10000621 JGI24738J21930_1000062110 100
13 3300003316 rootH1_10150186 rootH1_101501862 100
14 3300003320 rootH2_10000244 rootH2_1000024447 100
15 3300003320 rootH2_10070509 rootH2_100705094 100
16 3300003322 rootL2_10120990 rootL2_101209908 100
17 3300003322 rootL2_10311552 rootL2_103115523 100
18 3300003323 rootH1_10199138 rootH1_101991383 100
19 3300003323 rootH1_10346889 rootH1_103468893 100
20 3300005288 Ga0065714_10051138 Ga0065714_100511381 100
21 3300005327 Ga0070658_10000024 Ga0070658_10000024195 100
22 3300005327 Ga0070658_10000036 Ga0070658_1000003656 100
23 3300005327 Ga0070658_10000064 Ga0070658_1000006496 100
24 3300005327 Ga0070658_10000358 Ga0070658_1000035833 100
25 3300005327 Ga0070658_10001718 Ga0070658_1000171818 100
26 3300005327 Ga0070658_10154787 Ga0070658_101547873 100
27 3300005328 Ga0070676_10025926 Ga0070676_100259265 100
28 3300005329 Ga0070683_100000130 Ga0070683_10000013010 100
29 3300005329 Ga0070683_100000630 Ga0070683_10000063020 100
30 3300005329 Ga0070683_100004271 Ga0070683_10000427114 100
31 3300005329 Ga0070683_100589730 Ga0070683_1005897302 100
32 3300005329 Ga0070683_100944768 Ga0070683_1009447682 100
33 3300005331 Ga0070670_102039884 Ga0070670_1020398842 100
34 3300005334 Ga0068869_100198383 Ga0068869_1001983833 100
35 3300005335 Ga0070666_10058154 Ga0070666_100581543 100
36 3300005335 Ga0070666_10182509 Ga0070666_101825091 100
37 3300005337 Ga0070682_100001438 Ga0070682_1000014381 100
38 3300005337 Ga0070682_100493882 Ga0070682_1004938821 100
39 3300005337 Ga0070682_100539386 Ga0070682_1005393861 100
40 3300005339 Ga0070660_100000047 Ga0070660_10000004730 100
41 3300005339 Ga0070660_100030055 Ga0070660_1000300552 100
42 3300005339 Ga0070660_100107063 Ga0070660_1001070634 100
43 3300005339 Ga0070660_100401574 Ga0070660_1004015742 100
44 3300005340 Ga0070689_101065294 Ga0070689_1010652942 100
45 3300005340 Ga0070689_101657412 Ga0070689_1016574121 100
46 3300005344 Ga0070661_100019067 Ga0070661_1000190674 100
47 3300005344 Ga0070661_100387831 Ga0070661_1003878312 100
48 3300005347 Ga0070668_100290902 Ga0070668_1002909021 100
49 3300005355 Ga0070671_100000001 Ga0070671_10000000174 100
50 3300005355 Ga0070671_100028476 Ga0070671_1000284762 100
51 3300005356 Ga0070674_100093439 Ga0070674_1000934394 100
52 3300005356 Ga0070674_100094241 Ga0070674_1000942413 100
53 3300005364 Ga0070673_100000281 Ga0070673_10000028124 100
54 3300005366 Ga0070659_100005130 Ga0070659_1000051307 100
55 3300005366 Ga0070659_100081590 Ga0070659_1000815903 100
56 3300005366 Ga0070659_100094402 Ga0070659_1000944024 100
57 3300005366 Ga0070659_100260306 Ga0070659_1002603063 100
58 3300005366 Ga0070659_101166373 Ga0070659_1011663732 100
59 3300005367 Ga0070667_100001577 Ga0070667_10000157713 100
60 3300005367 Ga0070667_102269091 Ga0070667_1022690911 100
61 3300005437 Ga0070710_10730544 Ga0070710_107305442 100
62 3300005455 Ga0070663_100081405 Ga0070663_1000814052 100
63 3300005455 Ga0070663_100142634 Ga0070663_1001426342 100
64 3300005455 Ga0070663_101605712 Ga0070663_1016057122 100
65 3300005456 Ga0070678_100007428 Ga0070678_1000074285 100
66 3300005456 Ga0070678_100013372 Ga0070678_1000133724 100
67 3300005457 Ga0070662_100005247 Ga0070662_10000524710 100
68 3300005457 Ga0070662_100940743 Ga0070662_1009407432 100
69 3300005458 Ga0070681_10288498 Ga0070681_102884982 100
70 3300005459 Ga0068867_100001921 Ga0068867_1000019216 100
71 3300005466 Ga0070685_10001280 Ga0070685_100012806 100
72 3300005466 Ga0070685_10003495 Ga0070685_100034954 100
73 3300005530 Ga0070679_100107940 Ga0070679_1001079403 100
74 3300005530 Ga0070679_100175195 Ga0070679_1001751953 100
75 3300005530 Ga0070679_100750535 Ga0070679_1007505352 100
76 3300005530 Ga0070679_101000256 Ga0070679_1010002562 100
77 3300005530 Ga0070679_101534758 Ga0070679_1015347582 100
78 3300005535 Ga0070684_100000268 Ga0070684_10000026827 100
79 3300005535 Ga0070684_100002696 Ga0070684_10000269614 100
80 3300005535 Ga0070684_100021351 Ga0070684_1000213512 100
81 3300005535 Ga0070684_100880456 Ga0070684_1008804561 100
82 3300005539 Ga0068853_100382316 Ga0068853_1003823162 100
83 3300005543 Ga0070672_100179057 Ga0070672_1001790572 100
84 3300005548 Ga0070665_100103831 Ga0070665_1001038314 100
85 3300005548 Ga0070665_100157951 Ga0070665_1001579513 100
86 3300005563 Ga0068855_100000003 Ga0068855_100000003610 100
87 3300005563 Ga0068855_100023799 Ga0068855_1000237994 100
88 3300005563 Ga0068855_100115892 Ga0068855_1001158925 100
89 3300005563 Ga0068855_100783488 Ga0068855_1007834882 100
90 3300005563 Ga0068855_101015773 Ga0068855_1010157732 100
91 3300005564 Ga0070664_100000123 Ga0070664_10000012337 100
92 3300005564 Ga0070664_100229077 Ga0070664_1002290772 100
93 3300005577 Ga0068857_100010383 Ga0068857_1000103839 100
94 3300005577 Ga0068857_100194440 Ga0068857_1001944402 100
95 3300005614 Ga0068856_100001042 Ga0068856_10000104216 100
96 3300005614 Ga0068856_100001649 Ga0068856_10000164920 100
97 3300005614 Ga0068856_100736031 Ga0068856_1007360312 100
98 3300005616 Ga0068852_100026607 Ga0068852_1000266075 100
99 3300005617 Ga0068859_101104360 Ga0068859_1011043602 100
100 3300005841 Ga0068863_100025044 Ga0068863_1000250444 100
101 3300005842 Ga0068858_100025953 Ga0068858_1000259534 100
102 3300005843 Ga0068860_100411886 Ga0068860_1004118862 100
103 3300005937 Ga0081455_10504650 Ga0081455_105046502 100
104 3300006038 Ga0075365_10007333 Ga0075365_100073332 100
105 3300006038 Ga0075365_10028291 Ga0075365_100282914 100
106 3300006038 Ga0075365_10041265 Ga0075365_100412655 100
107 3300006038 Ga0075365_10392422 Ga0075365_103924222 100
108 3300006038 Ga0075365_10600550 Ga0075365_106005501 100
109 3300006048 Ga0075363_100000019 Ga0075363_10000001910 100
110 3300006048 Ga0075363_100049288 Ga0075363_1000492883 100
111 3300006048 Ga0075363_101003606 Ga0075363_1010036061 100
112 3300006051 Ga0075364_10001004 Ga0075364_100010049 100
113 3300006051 Ga0075364_10012949 Ga0075364_100129492 100
114 3300006051 Ga0075364_10033410 Ga0075364_100334103 100
115 3300006051 Ga0075364_10112213 Ga0075364_101122132 100
116 3300006177 Ga0075362_10001555 Ga0075362_100015557 100
117 3300006178 Ga0075367_10000530 Ga0075367_1000053015 100
118 3300006178 Ga0075367_10002952 Ga0075367_1000295210 100
119 3300006178 Ga0075367_10010684 Ga0075367_100106841 100
120 3300006186 Ga0075369_10000012 Ga0075369_1000001219 100
121 3300006186 Ga0075369_10010438 Ga0075369_100104381 100
122 3300006186 Ga0075369_10064793 Ga0075369_100647932 100
123 3300006195 Ga0075366_10000001 Ga0075366_1000000149 100
124 3300006195 Ga0075366_10000761 Ga0075366_100007614 100
125 3300006195 Ga0075366_10001138 Ga0075366_100011386 100
126 3300006195 Ga0075366_10058739 Ga0075366_100587394 100
127 3300006195 Ga0075366_10144429 Ga0075366_101444292 100
128 3300006195 Ga0075366_10184608 Ga0075366_101846083 100
129 3300006237 Ga0097621_100000002 Ga0097621_100000002179 100
130 3300006237 Ga0097621_100356038 Ga0097621_1003560382 100
131 3300006353 Ga0075370_10000669 Ga0075370_1000066910 100
132 3300006353 Ga0075370_10001409 Ga0075370_100014098 100
133 3300006353 Ga0075370_10014176 Ga0075370_100141761 100
134 3300006353 Ga0075370_10099713 Ga0075370_100997132 100
135 3300006358 Ga0068871_100000425 Ga0068871_10000042521 100
136 3300006358 Ga0068871_100132515 Ga0068871_1001325152 100
137 3300006358 Ga0068871_100318756 Ga0068871_1003187561 100
138 3300006881 Ga0068865_100002991 Ga0068865_1000029917 100
139 3300006931 Ga0097620_101104274 Ga0097620_1011042742 100
140 3300009092 Ga0105250_10236119 Ga0105250_102361192 100
141 3300009093 Ga0105240_10000003 Ga0105240_100000031230 100
142 3300009093 Ga0105240_10000118 Ga0105240_1000011868 100
143 3300009093 Ga0105240_10014069 Ga0105240_100140697 100
144 3300009093 Ga0105240_10409288 Ga0105240_104092883 100
145 3300009093 Ga0105240_11166690 Ga0105240_111666901 100
146 3300009094 Ga0111539_10061512 Ga0111539_100615124 100
147 3300009098 Ga0105245_10000002 Ga0105245_10000002623 100
148 3300009098 Ga0105245_10000093 Ga0105245_1000009343 100
149 3300009098 Ga0105245_10001246 Ga0105245_1000124614 100
150 3300009098 Ga0105245_10104152 Ga0105245_101041523 100
151 3300009098 Ga0105245_10396341 Ga0105245_103963412 100
152 3300009148 Ga0105243_10000001 Ga0105243_1000000149 100
153 3300009148 Ga0105243_10003826 Ga0105243_100038267 100
154 3300009148 Ga0105243_12283942 Ga0105243_122839422 100
155 3300009174 Ga0105241_10000007 Ga0105241_1000000757 100
156 3300009174 Ga0105241_10003617 Ga0105241_100036173 100
157 3300009174 Ga0105241_10006098 Ga0105241_100060989 100
158 3300009174 Ga0105241_10028502 Ga0105241_100285023 100
159 3300009174 Ga0105241_10954096 Ga0105241_109540962 100
160 3300009176 Ga0105242_10000002 Ga0105242_10000002233 100
161 3300009176 Ga0105242_10002304 Ga0105242_1000230416 100
162 3300009177 Ga0105248_11474791 Ga0105248_114747912 100
163 3300009545 Ga0105237_10082847 Ga0105237_100828476 100
164 3300009545 Ga0105237_10151889 Ga0105237_101518893 100
165 3300009545 Ga0105237_10370243 Ga0105237_103702432 100
166 3300009545 Ga0105237_10890624 Ga0105237_108906242 100
167 3300009551 Ga0105238_10234588 Ga0105238_102345883 100
168 3300009551 Ga0105238_10758997 Ga0105238_107589972 100
169 3300009551 Ga0105238_10905273 Ga0105238_109052732 100
170 3300009551 Ga0105238_11038143 Ga0105238_110381432 100
171 3300009553 Ga0105249_10000950 Ga0105249_1000095021 100
172 3300009553 Ga0105249_10221107 Ga0105249_102211072 100
173 3300009553 Ga0105249_10777323 Ga0105249_107773232 100
174 3300009553 Ga0105249_10859798 Ga0105249_108597982 100
175 3300009553 Ga0105249_11188471 Ga0105249_111884712 100
176 3300009553 Ga0105249_11778504 Ga0105249_117785042 100
177 3300009987 Ga0105030_100222 Ga0105030_1002222 100
178 3300010375 Ga0105239_10009404 Ga0105239_100094046 100
179 3300010375 Ga0105239_10024960 Ga0105239_100249605 100
180 3300010375 Ga0105239_11469571 Ga0105239_114695711 100
181 3300011119 Ga0105246_10000681 Ga0105246_1000068116 100
182 3300012503 Ga0157313_1021655 Ga0157313_10216552 100
183 3300013100 Ga0157373_10000096 Ga0157373_1000009614 100
184 3300013100 Ga0157373_10067052 Ga0157373_100670522 100
185 3300013100 Ga0157373_10546378 Ga0157373_105463781 100
186 3300013100 Ga0157373_10686613 Ga0157373_106866131 100
187 3300013100 Ga0157373_11021037 Ga0157373_110210371 100
188 3300013102 Ga0157371_10002104 Ga0157371_100021043 100
189 3300013102 Ga0157371_10125898 Ga0157371_101258982 100
190 3300013102 Ga0157371_10367761 Ga0157371_103677612 100
191 3300013104 Ga0157370_10049328 Ga0157370_100493284 100
192 3300013105 Ga0157369_10000029 Ga0157369_1000002986 100
193 3300013105 Ga0157369_10000104 Ga0157369_1000010433 100
194 3300013105 Ga0157369_10109370 Ga0157369_101093703 100
195 3300013105 Ga0157369_12040753 Ga0157369_120407531 100
196 3300013296 Ga0157374_10000018 Ga0157374_1000001844 100
197 3300013296 Ga0157374_10000225 Ga0157374_1000022546 100
198 3300013296 Ga0157374_10000509 Ga0157374_1000050919 100
199 3300013296 Ga0157374_10277303 Ga0157374_102773032 100
200 3300013296 Ga0157374_10298358 Ga0157374_102983583 100
201 3300013296 Ga0157374_10534411 Ga0157374_105344112 100
202 3300013297 Ga0157378_10007914 Ga0157378_100079149 100
203 3300013297 Ga0157378_10436086 Ga0157378_104360863 100
204 3300013307 Ga0157372_13219081 Ga0157372_132190812 100
205 3300013308 Ga0157375_10422544 Ga0157375_104225442 100
206 3300014325 Ga0163163_10026154 Ga0163163_100261548 100
207 3300014325 Ga0163163_10163141 Ga0163163_101631412 100
208 3300014745 Ga0157377_10006655 Ga0157377_100066552 100
209 3300014745 Ga0157377_10455560 Ga0157377_104555601 100
210 3300014968 Ga0157379_10463621 Ga0157379_104636212 100
211 3300014968 Ga0157379_12215249 Ga0157379_122152491 100
212 3300014969 Ga0157376_10000007 Ga0157376_1000000765 100
213 3300014969 Ga0157376_11394009 Ga0157376_113940092 100
214 3300020069 Ga0197907_10746141 Ga0197907_107461412 100
215 3300020610 Ga0154015_1351290 Ga0154015_13512902 100
216 3300025901 Ga0207688_10607323 Ga0207688_106073232 100
217 3300025903 Ga0207680_10084491 Ga0207680_100844912 100
218 3300025903 Ga0207680_10196562 Ga0207680_101965622 100
219 3300025904 Ga0207647_10012220 Ga0207647_100122205 100
220 3300025904 Ga0207647_10052021 Ga0207647_100520213 100
221 3300025904 Ga0207647_10318198 Ga0207647_103181982 100
222 3300025907 Ga0207645_10126072 Ga0207645_101260723 100
223 3300025909 Ga0207705_10000001 Ga0207705_10000001739 100
224 3300025909 Ga0207705_10000011 Ga0207705_10000011541 100
225 3300025909 Ga0207705_10000047 Ga0207705_1000004710 100
226 3300025909 Ga0207705_10000104 Ga0207705_1000010421 100
227 3300025909 Ga0207705_10000136 Ga0207705_1000013646 100
228 3300025909 Ga0207705_10003197 Ga0207705_1000319715 100
229 3300025909 Ga0207705_10033403 Ga0207705_100334033 100
230 3300025909 Ga0207705_10145861 Ga0207705_101458612 100
231 3300025911 Ga0207654_10000002 Ga0207654_100000021489 100
232 3300025911 Ga0207654_10001716 Ga0207654_1000171613 100
233 3300025912 Ga0207707_10031690 Ga0207707_100316906 100
234 3300025912 Ga0207707_11169274 Ga0207707_111692742 100
235 3300025913 Ga0207695_10000005 Ga0207695_100000051241 100
236 3300025913 Ga0207695_10000675 Ga0207695_1000067557 100
237 3300025913 Ga0207695_10033883 Ga0207695_100338832 100
238 3300025914 Ga0207671_10084304 Ga0207671_100843043 100
239 3300025914 Ga0207671_10941497 Ga0207671_109414971 100
240 3300025919 Ga0207657_10000883 Ga0207657_1000088319 100
241 3300025919 Ga0207657_10010727 Ga0207657_100107279 100
242 3300025919 Ga0207657_10099514 Ga0207657_100995142 100
243 3300025919 Ga0207657_10151820 Ga0207657_101518202 100
244 3300025920 Ga0207649_10021978 Ga0207649_100219782 100
245 3300025920 Ga0207649_10819650 Ga0207649_108196502 100
246 3300025921 Ga0207652_10224400 Ga0207652_102244002 100
247 3300025921 Ga0207652_10346494 Ga0207652_103464943 100
248 3300025921 Ga0207652_11288012 Ga0207652_112880122 100
249 3300025921 Ga0207652_11360776 Ga0207652_113607762 100
250 3300025924 Ga0207694_10040504 Ga0207694_100405046 100
251 3300025924 Ga0207694_10637470 Ga0207694_106374701 100
252 3300025924 Ga0207694_11083558 Ga0207694_110835582 100
253 3300025925 Ga0207650_10633195 Ga0207650_106331951 100
254 3300025927 Ga0207687_10000001 Ga0207687_10000001588 100
255 3300025927 Ga0207687_10000008 Ga0207687_10000008478 100
256 3300025927 Ga0207687_10000127 Ga0207687_1000012743 100
257 3300025927 Ga0207687_10002066 Ga0207687_1000206614 100
258 3300025927 Ga0207687_10051088 Ga0207687_100510882 100
259 3300025927 Ga0207687_10562729 Ga0207687_105627292 100
260 3300025931 Ga0207644_10000001 Ga0207644_1000000110 100
261 3300025932 Ga0207690_10011190 Ga0207690_100111906 100
262 3300025932 Ga0207690_10084187 Ga0207690_100841873 100
263 3300025932 Ga0207690_10260762 Ga0207690_102607623 100
264 3300025932 Ga0207690_10261910 Ga0207690_102619102 100
265 3300025933 Ga0207706_10000073 Ga0207706_10000073124 100
266 3300025933 Ga0207706_10792790 Ga0207706_107927902 100
267 3300025934 Ga0207686_10000001 Ga0207686_100000011095 100
268 3300025934 Ga0207686_10003972 Ga0207686_100039729 100
269 3300025935 Ga0207709_10000002 Ga0207709_100000021212 100
270 3300025935 Ga0207709_10007890 Ga0207709_100078904 100
271 3300025935 Ga0207709_10610940 Ga0207709_106109402 100
272 3300025937 Ga0207669_10045089 Ga0207669_100450893 100
273 3300025937 Ga0207669_10108992 Ga0207669_101089923 100
274 3300025938 Ga0207704_10006808 Ga0207704_100068087 100
275 3300025940 Ga0207691_10913799 Ga0207691_109137992 100
276 3300025942 Ga0207689_10216630 Ga0207689_102166303 100
277 3300025944 Ga0207661_10000118 Ga0207661_1000011848 100
278 3300025944 Ga0207661_10000715 Ga0207661_1000071512 100
279 3300025944 Ga0207661_10002428 Ga0207661_100024282 100
280 3300025945 Ga0207679_10000124 Ga0207679_1000012426 100
281 3300025945 Ga0207679_10465815 Ga0207679_104658152 100
282 3300025949 Ga0207667_10000008 Ga0207667_10000008600 100
283 3300025949 Ga0207667_10039223 Ga0207667_100392234 100
284 3300025949 Ga0207667_10372734 Ga0207667_103727341 100
285 3300025949 Ga0207667_10453230 Ga0207667_104532302 100
286 3300025949 Ga0207667_11464125 Ga0207667_114641252 100
287 3300025960 Ga0207651_10000182 Ga0207651_1000018224 100
288 3300025961 Ga0207712_10000664 Ga0207712_1000066417 100
289 3300025961 Ga0207712_10711351 Ga0207712_107113512 100
290 3300025961 Ga0207712_10901169 Ga0207712_109011692 100
291 3300025961 Ga0207712_10950424 Ga0207712_109504241 100
292 3300025981 Ga0207640_10225388 Ga0207640_102253882 100
293 3300025986 Ga0207658_10005578 Ga0207658_100055784 100
294 3300026035 Ga0207703_10019970 Ga0207703_100199705 100
295 3300026067 Ga0207678_10037434 Ga0207678_100374344 100
296 3300026067 Ga0207678_10167379 Ga0207678_101673793 100
297 3300026078 Ga0207702_10000622 Ga0207702_1000062228 100
298 3300026078 Ga0207702_10003296 Ga0207702_1000329611 100
299 3300026078 Ga0207702_10241175 Ga0207702_102411753 100
300 3300026088 Ga0207641_10018237 Ga0207641_100182376 100
301 3300026089 Ga0207648_10011674 Ga0207648_100116745 100
302 3300026116 Ga0207674_10039537 Ga0207674_100395374 100
303 3300026116 Ga0207674_11177044 Ga0207674_111770441 100
304 3300026121 Ga0207683_10015550 Ga0207683_100155506 100
305 3300026121 Ga0207683_10019942 Ga0207683_100199426 100
306 3300026142 Ga0207698_10015936 Ga0207698_100159362 100
307 3300027717 Ga0209998_10006792 Ga0209998_100067922 100
308 3300027866 Ga0209813_10000002 Ga0209813_10000002130 100
309 3300027876 Ga0209974_10100740 Ga0209974_101007402 100
310 3300027907 Ga0207428_10089215 Ga0207428_100892153 100
311 3300028379 Ga0268266_10006586 Ga0268266_100065867 100
312 3300028379 Ga0268266_10181766 Ga0268266_101817664 100
313 3300028381 Ga0268264_10340783 Ga0268264_103407833 100
314 3300028556 Ga0265337_1043355 Ga0265337_10433552 100
315 3300028563 Ga0265319_1127044 Ga0265319_11270442 100
316 3300028573 Ga0265334_10000028 Ga0265334_100000288 100
317 3300028573 Ga0265334_10009331 Ga0265334_100093314 100
318 3300028800 Ga0265338_10000323 Ga0265338_1000032331 100
319 3300028800 Ga0265338_10000412 Ga0265338_1000041239 100
320 3300028800 Ga0265338_10013408 Ga0265338_1001340810 100
321 3300028800 Ga0265338_10169880 Ga0265338_101698802 100
322 3300031247 Ga0265340_10000065 Ga0265340_1000006532 100
323 3300031251 Ga0265327_10002867 Ga0265327_100028679 100
324 3300031251 Ga0265327_10030184 Ga0265327_100301845 100
325 3300031730 Ga0307516_10090958 Ga0307516_100909582 100
326 3300034820 Ga0373959_0000406 Ga0373959_0000406_1278_1580 100
327 3300035092 Ga0373952_0126756 Ga0373952_0126756_25_378 100
328 3300037418 Ga0395900_0010665 Ga0395900_0010665_1811_2113 100
329 3300037418 Ga0395900_0025872 Ga0395900_0025872_1914_2216 100
330 3300037418 Ga0395900_1141773 Ga0395900_1141773_97_438 100
331 3300037466 Ga0395898_0031124 Ga0395898_0031124_2424_2726 100
332 3300037466 Ga0395898_0662887 Ga0395898_0662887_316_618 100
333 3300038443 Ga0395901_0057396 Ga0395901_0057396_2217_2522 100
334 3300038443 Ga0395901_0982106 Ga0395901_0982106_416_718 100
335 3300041443 Ga0451789_0323029 Ga0451789_0323029_448_750 100
336 3300041451 Ga0451791_0801622 Ga0451791_0801622_238_540 100
337 3300041452 Ga0451793_1269411 Ga0451793_1269411_46_348 100
338 3300041452 Ga0451793_1546724 Ga0451793_1546724_236_538 100
339 3300041452 Ga0451793_1566048 Ga0451793_1566048_150_452 100
340 3300041456 Ga0451795_0191986 Ga0451795_0191986_482_784 100
341 3300041460 Ga0451802_0033264 Ga0451802_0033264_218_523 100
342 3300041460 Ga0451802_0812737 Ga0451802_0812737_436_738 100
343 3300041462 Ga0451806_851107 Ga0451806_851107_16_318 100
344 3300041486 Ga0451807_1780302 Ga0451807_1780302_512_814 100
345 3300041491 Ga0451833_1416120 Ga0451833_1416120_488_790 100
346 3300041496 Ga0451839_0246786 Ga0451839_0246786_89_448 100
347 3300041496 Ga0451839_0382291 Ga0451839_0382291_398_700 100
348 3300041498 Ga0451841_0749446 Ga0451841_0749446_322_624 100
349 3300041501 Ga0451845_0362547 Ga0451845_0362547_91_393 100
350 3300041512 Ga0451853_3639293 Ga0451853_3639293_490_792 100
351 3300042016 Ga0439463_028621 Ga0439463_028621_675_977 100
352 3300042439 Ga0439464_0000023 Ga0439464_0000023_15029_15331 100
353 3300046459 Ga0495629_0237441 Ga0495629_0237441_191_496 100
354 3300046557 Ga0495622_0000051 Ga0495622_0000051_75170_75475 100
355 3300046674 Ga0495588_0000173 Ga0495588_0000173_56410_56715 100
356 3300046674 Ga0495588_0507315 Ga0495588_0507315_306_608 100
357 3300046694 Ga0495649_0000069 Ga0495649_0000069_14717_15019 100
358 3300046809 Ga0495600_0023406 Ga0495600_0023406_3640_3945 100
359 3300048907 Ga0496104_0799066 Ga0496104_0799066_346_648 100
360 3300048907 Ga0496104_1029170 Ga0496104_1029170_198_500 100
361 3300048911 Ga0496108_0954479 Ga0496108_0954479_184_486 100
362 3300048912 Ga0496109_0126027 Ga0496109_0126027_1754_2056 100
363 3300048915 Ga0496112_0020062 Ga0496112_0020062_2710_3012 100
364 3300048920 Ga0496117_0000178 Ga0496117_0000178_3781_4083 100
365 3300048921 Ga0496118_0105685 Ga0496118_0105685_968_1270 100
366 3300049569 Ga0501032_0654400 Ga0501032_0654400_295_597 100
367 3300049570 Ga0501033_0551476 Ga0501033_0551476_474_776 100
368 3300049573 Ga0501037_0119878 Ga0501037_0119878_316_618 100
369 3300049588 Ga0501072_0781411 Ga0501072_0781411_183_485 100
370 3300049742 Ga0501080_0533687 Ga0501080_0533687_302_604 100
371 3300049744 Ga0501083_1002300 Ga0501083_1002300_150_452 100
372 3300049773 Ga0501276_000571 Ga0501276_000571_1874_2176 100
373 3300050489 nmdc:mga03683_242_c1 nmdc:mga03683_242_c1_5049_5354 100
374 3300050489 nmdc:mga03683_431672_c1 nmdc:mga03683_431672_c1_11_316 100
375 3300050490 nmdc:mga03n38_31367_c1 nmdc:mga03n38_31367_c1_1418_1720 100
376 3300050490 nmdc:mga03n38_33_c1 nmdc:mga03n38_33_c1_8541_8894 100
377 3300050491 nmdc:mga00v17_234288_c1 nmdc:mga00v17_234288_c1_795_1097 100
378 3300050491 nmdc:mga00v17_348_c1 nmdc:mga00v17_348_c1_22544_22846 100
379 3300050491 nmdc:mga00v17_37955_c1 nmdc:mga00v17_37955_c1_2090_2392 100
380 3300050491 nmdc:mga00v17_816_c1 nmdc:mga00v17_816_c1_9851_10153 100
381 3300050492 nmdc:mga0yw44_17669_c1 nmdc:mga0yw44_17669_c1_1464_1766 100
382 3300050492 nmdc:mga0yw44_321085_c1 nmdc:mga0yw44_321085_c1_167_469 100
383 3300050492 nmdc:mga0yw44_43389_c1 nmdc:mga0yw44_43389_c1_932_1234 100
384 3300050493 nmdc:mga0k408_1035_c1 nmdc:mga0k408_1035_c1_12714_13016 100
385 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_1030528_1030830 100
386 3300050493 nmdc:mga0k408_53877_c1 nmdc:mga0k408_53877_c1_1207_1509 100
387 3300050493 nmdc:mga0k408_8313_c1 nmdc:mga0k408_8313_c1_214_516 100
388 3300050493 nmdc:mga0k408_92316_c2 nmdc:mga0k408_92316_c2_840_1142 100
389 3300050494 nmdc:mga06z11_10_c1 nmdc:mga06z11_10_c1_95669_96022 100
390 3300050494 nmdc:mga06z11_19880_c1 nmdc:mga06z11_19880_c1_857_1162 100
391 3300050495 nmdc:mga04h51_159856_c1 nmdc:mga04h51_159856_c1_551_856 100
392 3300050495 nmdc:mga04h51_240657_c1 nmdc:mga04h51_240657_c1_215_517 100
393 3300050495 nmdc:mga04h51_2_c1 nmdc:mga04h51_2_c1_95666_96019 100
394 3300050496 nmdc:mga07m45_299340_c2 nmdc:mga07m45_299340_c2_275_577 100
395 3300050496 nmdc:mga07m45_5638_c3 nmdc:mga07m45_5638_c3_102_404 100
396 3300050496 nmdc:mga07m45_657531_c1 nmdc:mga07m45_657531_c1_103_405 100
397 3300050511 nmdc:mga08y16_52219_c1 nmdc:mga08y16_52219_c1_963_1268 100
398 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_764024_764329 100
399 3300050516 nmdc:mga0sz30_44361_c1 nmdc:mga0sz30_44361_c1_868_1170 100
400 3300050516 nmdc:mga0sz30_4_c1 nmdc:mga0sz30_4_c1_56503_56805 100
401 3300053079 Ga0500610_0000002 Ga0500610_0000002_45503_45805 100
402 3300053079 Ga0500610_0040889 Ga0500610_0040889_1599_1904 100
403 3300053087 Ga0500643_000010 Ga0500643_000010_36410_36712 100
404 3300053087 Ga0500643_000011 Ga0500643_000011_300749_301051 100
405 3300053087 Ga0500643_000251 Ga0500643_000251_31550_31852 100
406 3300053087 Ga0500643_057077 Ga0500643_057077_758_1060 100
407 3300053088 Ga0500644_0000198 Ga0500644_0000198_4586_4888 100
408 3300053088 Ga0500644_0000912 Ga0500644_0000912_5583_5885 100
409 3300053088 Ga0500644_0001342 Ga0500644_0001342_3589_3891 100
410 3300053088 Ga0500644_0083425 Ga0500644_0083425_417_719 100
411 3300053090 Ga0500646_0000048 Ga0500646_0000048_11071_11373 100
412 3300053092 Ga0500583_0000057 Ga0500583_0000057_29569_29874 100
413 3300053092 Ga0500583_0019312 Ga0500583_0019312_2418_2720 100
414 3300053092 Ga0500583_0161749 Ga0500583_0161749_33_335 100
415 3300053092 Ga0500583_0223144 Ga0500583_0223144_616_918 100
416 3300053093 Ga0500651_0000051 Ga0500651_0000051_22812_23114 100
417 3300053093 Ga0500651_0001287 Ga0500651_0001287_2500_2802 100
418 3300053094 Ga0500566_0000001 Ga0500566_0000001_1007192_1007497 100
419 3300053098 Ga0500650_0000003 Ga0500650_0000003_18326_18628 100
420 3300053103 Ga0500555_000001 Ga0500555_000001_1250170_1250472 100
421 3300053103 Ga0500555_000002 Ga0500555_000002_83902_84204 100
422 3300053103 Ga0500555_022544 Ga0500555_022544_137_439 100
423 3300053104 Ga0500556_0000196 Ga0500556_0000196_29215_29517 100
424 3300053108 Ga0500562_000002 Ga0500562_000002_155536_155838 100
425 3300053108 Ga0500562_006272 Ga0500562_006272_2588_2890 100
426 3300053108 Ga0500562_047200 Ga0500562_047200_476_778 100
427 3300053108 Ga0500562_088352 Ga0500562_088352_324_626 100
428 3300053117 Ga0500593_000001 Ga0500593_000001_342990_343292 100
429 3300053118 Ga0500594_0000001 Ga0500594_0000001_320341_320643 100
430 3300053118 Ga0500594_0000145 Ga0500594_0000145_11680_11982 100
431 3300053123 Ga0500614_000001 Ga0500614_000001_1131891_1132196 100
432 3300053123 Ga0500614_000766 Ga0500614_000766_4251_4553 100
433 3300053123 Ga0500614_001485 Ga0500614_001485_615_920 100
434 3300053129 Ga0500628_000009 Ga0500628_000009_41391_41693 100
435 3300053129 Ga0500628_092470 Ga0500628_092470_265_567 100
436 3300053130 Ga0500642_0028246 Ga0500642_0028246_396_701 100
437 3300053131 Ga0500652_000049 Ga0500652_000049_49892_50194 100
438 3300053133 Ga0500655_004786 Ga0500655_004786_1895_2197 100
439 3300053139 Ga0500568_0028275 Ga0500568_0028275_484_786 100
440 3300053140 Ga0500573_0023781 Ga0500573_0023781_2265_2567 100
441 3300053142 Ga0500577_0000116 Ga0500577_0000116_14743_15045 100
442 3300053142 Ga0500577_0157453 Ga0500577_0157453_154_456 100
443 3300053143 Ga0500579_000782 Ga0500579_000782_7405_7707 100
444 3300053147 Ga0500589_000002 Ga0500589_000002_143120_143425 100
445 3300053151 Ga0500604_0012014 Ga0500604_0012014_1482_1784 100
446 3300053151 Ga0500604_0090225 Ga0500604_0090225_444_746 100
447 3300053151 Ga0500604_0265987 Ga0500604_0265987_33_338 100
448 3300053160 Ga0500633_0006053 Ga0500633_0006053_1118_1420 100
449 3300053722 Ga0500649_000002 Ga0500649_000002_14587_14892 100
450 3300053727 Ga0500611_000214 Ga0500611_000214_4667_4969 100
451 3300053727 Ga0500611_008725 Ga0500611_008725_411_713 100
452 3300060353 Ga0501082_1330244 Ga0501082_1330244_175_480 100

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04248

NTP_transf_9

Domain of unknown function (DUF427)

1

97

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3djm-assembly5.cif.gz_E crystal structure of a protein of unknown function from duf427 family (rsph17029_0682) from rhodobacter sphaeroides 2.4.1 at 2.51 a resolution 0.8215 2 95
3djm-assembly5.cif.gz_E crystal structure of a protein of unknown function from duf427 family (rsph17029_0682) from rhodobacter sphaeroides 2.4.1 at 2.51 a resolution 0.7553 2 95
2lex-assembly1.cif.gz_A complex of the c-terminal wrky domain of atwrky4 and a w-box dna 0.5787 37 100
4i0s-assembly1.cif.gz_A crystal structure of spleen tyrosine kinase complexed with 2-(6-chloro-1-methyl-1h-indazol-3-yl)-5h-pyrrolo[2,3-b]pyrazine-7-carboxylic acid isopropylamide 0.5506 34 69
5tr6-assembly1.cif.gz_A discovery of tak-659, an orally available investigational inhibitor of spleen tyrosine kinase (syk) 0.5423 34 69
ID Description Score Start End Superfamily
af_O53917_1_97_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.9154 2 100 2.170.150.40
af_O53917_1_97_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.8883 2 100 2.170.150.40
3djmD00 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.8498 2 95 2.170.150.40
af_O53404_8_113_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.7901 1 95 2.170.150.40
af_P96817_9_123_2.170.150.40 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Domain of unknown function (DUF427) 0.7882 2 98 2.170.150.40
ID Description Score Start End GO Terms
AF-A0A7T9QG99-F1-model_v4 deleted 1.002 1 100
AF-A0A7W3PJZ6-F1-model_v4 Uncharacterized protein (DUF427 family) 0.9794 2 100
AF-A0A1B9NCR8-F1-model_v4 Uncharacterized protein 0.9776 1 99
AF-A0A2M8KZ34-F1-model_v4 DUF427 domain-containing protein 0.9763 1 100
AF-A0A0C2JDW5-F1-model_v4 DUF427 domain-containing protein 0.9734 1 100

Feature Viewer

pLDDT pTM Quality
97.86 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map