F447006

General Info

Members Datasets Scaffolds Average Seq Length
452 244 452 130

Family's Representative Sequence

Representative Sequence 3300025940|Ga0207691_10337063|Ga0207691_103370632
Length 149
Sequence VAGDAGGYTAQYVTHVTAEGRRRISSGGPWEATASYSRAIVVGDTCWVAGTTDAGPDGSARNPDNVAAQAGAVFDIIESALVQAGFTFADIVRIRMFITDMSRAGELMAVQAERFRNIRPAATLVEVSALIDPSLLVEIEVDAHRAPKD

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
143 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
144 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
145 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
146 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
149 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
150 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
151 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
152 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
153 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
154 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
158 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
171 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
172 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
173 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
176 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
177 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
178 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
179 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
182 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
191 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
223 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
224 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
225 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
231 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
239 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
240 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 9.07
Rhizosphere 90.49
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10872075 3300005327 Bacteria 782
2 Ga0070676_10091284 3300005328 Bacteria 1866
3 Ga0070683_100196291 3300005329 Bacteria 1916
4 Ga0070670_100037836 3300005331 Bacteria 4150
5 Ga0070670_100409855 3300005331 Bacteria 1197
6 Ga0068869_100108377 3300005334 Unclassified 2110
7 Ga0068869_100747233 3300005334 Bacteria 837
8 Ga0070680_100353724 3300005336 Bacteria 1249
9 Ga0070682_100036972 3300005337 Bacteria 2987
10 Ga0068868_100665689 3300005338 Unclassified 928
11 Ga0068868_100740830 3300005338 Unclassified 882
12 Ga0070660_100855515 3300005339 Bacteria 766
13 Ga0070689_100078025 3300005340 Unclassified 2596
14 Ga0070691_10053577 3300005341 Unclassified 1930
15 Ga0070687_100002534 3300005343 Bacteria 6882
16 Ga0070661_100840773 3300005344 Bacteria 755
17 Ga0070692_10007998 3300005345 Bacteria 4691
18 Ga0070692_10454836 3300005345 Bacteria 820
19 Ga0070668_100470104 3300005347 Unclassified 1084
20 Ga0070669_100082810 3300005353 Bacteria 2392
21 Ga0070675_100010076 3300005354 Bacteria 7368
22 Ga0070675_100292492 3300005354 Bacteria 1434
23 Ga0070675_100696594 3300005354 Unclassified 925
24 Ga0070671_100453209 3300005355 Bacteria 1101
25 Ga0070671_101090272 3300005355 Bacteria 701
26 Ga0070674_100004038 3300005356 Bacteria 8325
27 Ga0070674_100964391 3300005356 Bacteria 746
28 Ga0070673_100026338 3300005364 Bacteria 4294
29 Ga0070688_100130969 3300005365 Bacteria 1692
30 Ga0070659_100023913 3300005366 Bacteria 4680
31 Ga0070703_10046161 3300005406 Unclassified 1376
32 Ga0070709_10657120 3300005434 Unclassified 812
33 Ga0070710_11013945 3300005437 Bacteria 605
34 Ga0070705_100017537 3300005440 Bacteria 3739
35 Ga0070705_100855934 3300005440 Unclassified 728
36 Ga0070700_100316997 3300005441 Bacteria 1144
37 Ga0070694_100058793 3300005444 Bacteria 2616
38 Ga0070694_100087302 3300005444 Bacteria 2181
39 Ga0070694_100094293 3300005444 Bacteria 2105
40 Ga0070694_100198498 3300005444 Bacteria 1494
41 Ga0070694_100250680 3300005444 Bacteria 1339
42 Ga0070708_100025853 3300005445 Bacteria 5020
43 Ga0070708_100041068 3300005445 Bacteria 4055
44 Ga0070708_100368434 3300005445 Bacteria 1354
45 Ga0070708_101062995 3300005445 Unclassified 758
46 Ga0070663_100577744 3300005455 Unclassified 942
47 Ga0070678_100308183 3300005456 Bacteria 1348
48 Ga0070678_100781700 3300005456 Bacteria 866
49 Ga0070681_10698482 3300005458 Bacteria 930
50 Ga0068867_100088840 3300005459 Bacteria 2343
51 Ga0068867_101176645 3300005459 Bacteria 703
52 Ga0070685_10012464 3300005466 Bacteria 4467
53 Ga0070706_100002673 3300005467 Bacteria 17856
54 Ga0070706_100648630 3300005467 Bacteria 980
55 Ga0070706_101698739 3300005467 Bacteria 575
56 Ga0070707_100001009 3300005468 Bacteria 27892
57 Ga0070707_100026690 3300005468 Bacteria 5486
58 Ga0070707_100141785 3300005468 Bacteria 2339
59 Ga0070698_100106085 3300005471 Bacteria 2779
60 Ga0070698_100159323 3300005471 Bacteria 2202
61 Ga0070698_101704302 3300005471 Unclassified 583
62 Ga0070699_100028561 3300005518 Archaea 4810
63 Ga0070699_100063885 3300005518 Bacteria 3192
64 Ga0070699_100136914 3300005518 Bacteria 2160
65 Ga0070699_100412442 3300005518 Bacteria 1222
66 Ga0070679_100092898 3300005530 Bacteria 3004
67 Ga0070684_100035666 3300005535 Bacteria 4258
68 Ga0070684_100140625 3300005535 Bacteria 2183
69 Ga0070684_102121083 3300005535 Unclassified 530
70 Ga0070697_100190394 3300005536 Bacteria 1741
71 Ga0068853_100126674 3300005539 Bacteria 2282
72 Ga0068853_100186114 3300005539 Bacteria 1885
73 Ga0070672_100262008 3300005543 Bacteria 1458
74 Ga0070672_100987300 3300005543 Unclassified 746
75 Ga0070686_100007488 3300005544 Bacteria 6092
76 Ga0070686_100035501 3300005544 Bacteria 3080
77 Ga0070695_100021965 3300005545 Bacteria 3910
78 Ga0070695_100154507 3300005545 Bacteria 1604
79 Ga0070696_100006207 3300005546 Bacteria 7994
80 Ga0070696_100029599 3300005546 Bacteria 3744
81 Ga0070696_100063003 3300005546 Bacteria 2597
82 Ga0070696_100077334 3300005546 Bacteria 2351
83 Ga0070693_100660575 3300005547 Bacteria 761
84 Ga0070704_100052164 3300005549 Bacteria 2884
85 Ga0070704_100056808 3300005549 Bacteria 2780
86 Ga0070704_100066291 3300005549 Bacteria 2603
87 Ga0068855_102100662 3300005563 Bacteria 569
88 Ga0070664_100457574 3300005564 Bacteria 1172
89 Ga0070664_100755327 3300005564 Bacteria 908
90 Ga0070664_100787004 3300005564 Unclassified 889
91 Ga0070664_100900429 3300005564 Bacteria 829
92 Ga0068854_100007542 3300005578 Bacteria 6952
93 Ga0068854_101009342 3300005578 Bacteria 737
94 Ga0068854_102138854 3300005578 Bacteria 517
95 Ga0068856_100179368 3300005614 Bacteria 2131
96 Ga0068856_100353011 3300005614 Bacteria 1489
97 Ga0068856_101135854 3300005614 Bacteria 798
98 Ga0070702_100002645 3300005615 Bacteria 7810
99 Ga0070702_100294330 3300005615 Unclassified 1120
100 Ga0068852_100805573 3300005616 Bacteria 953
101 Ga0068859_100555107 3300005617 Bacteria 1243
102 Ga0068864_100014152 3300005618 Bacteria 6621
103 Ga0068864_100246142 3300005618 Bacteria 1658
104 Ga0068866_10011362 3300005718 Bacteria 3850
105 Ga0068870_10004223 3300005840 Bacteria 6174
106 Ga0068863_100444540 3300005841 Bacteria 1272
107 Ga0068863_100697641 3300005841 Bacteria 1009
108 Ga0068858_100098470 3300005842 Bacteria 2726
109 Ga0068860_100073876 3300005843 Bacteria 3241
110 Ga0068860_100453073 3300005843 Bacteria 1276
111 Ga0068860_101233698 3300005843 Bacteria 768
112 Ga0068862_100454982 3300005844 Bacteria 1207
113 Ga0068862_102169997 3300005844 Bacteria 567
114 Ga0070715_10304177 3300006163 Bacteria 854
115 Ga0070716_101655814 3300006173 Bacteria 527
116 Ga0070712_100383008 3300006175 Bacteria 1158
117 Ga0068871_100501575 3300006358 Bacteria 1094
118 Ga0068871_100911848 3300006358 Bacteria 815
119 Ga0075433_10008221 3300006852 Bacteria 8313
120 Ga0075434_100071953 3300006871 Bacteria 3450
121 Ga0075434_100157502 3300006871 Bacteria 2290
122 Ga0075434_100419843 3300006871 Bacteria 1359
123 Ga0075434_100559002 3300006871 Unclassified 1164
124 Ga0075434_100942119 3300006871 Archaea 878
125 Ga0068865_100003323 3300006881 Bacteria 9635
126 Ga0068865_101009386 3300006881 Unclassified 729
127 Ga0097620_100555068 3300006931 Bacteria 1243
128 Ga0075435_100107558 3300007076 Bacteria 2316
129 Ga0075435_100885795 3300007076 Bacteria 778
130 Ga0105244_10565172 3300009036 Unclassified 523
131 Ga0111539_10012521 3300009094 Bacteria 10630
132 Ga0111539_10020328 3300009094 Bacteria 8178
133 Ga0111539_10216601 3300009094 Bacteria 2230
134 Ga0105245_10026836 3300009098 Bacteria 5071
135 Ga0105245_10429196 3300009098 Unclassified 1326
136 Ga0105245_10896296 3300009098 Bacteria 928
137 Ga0105245_11915732 3300009098 Bacteria 646
138 Ga0105245_12107303 3300009098 Bacteria 618
139 Ga0105247_11237105 3300009101 Bacteria 596
140 Ga0114129_10126437 3300009147 Bacteria 3514
141 Ga0114129_10150742 3300009147 Bacteria 3182
142 Ga0105243_10007751 3300009148 Bacteria 8257
143 Ga0105243_10097864 3300009148 Bacteria 2429
144 Ga0105241_10296960 3300009174 Bacteria 1385
145 Ga0105238_10263013 3300009551 Unclassified 1705
146 Ga0105249_10032318 3300009553 Bacteria 4733
147 Ga0105249_10034978 3300009553 Bacteria 4554
148 Ga0105249_10078626 3300009553 Bacteria 3061
149 Ga0105249_10259890 3300009553 Bacteria 1725
150 Ga0105249_10800487 3300009553 Bacteria 1006
151 Ga0105239_10075368 3300010375 Bacteria 3709
152 Ga0105239_10340800 3300010375 Bacteria 1692
153 Ga0105246_10048048 3300011119 Bacteria 2917
154 Ga0105246_10534961 3300011119 Bacteria 1001
155 Ga0105246_11450727 3300011119 Bacteria 642
156 Ga0157374_10664867 3300013296 Bacteria 1054
157 Ga0157374_12588052 3300013296 Bacteria 535
158 Ga0157378_10835031 3300013297 Bacteria 949
159 Ga0157378_11457951 3300013297 Bacteria 728
160 Ga0157378_11460335 3300013297 Bacteria 728
161 Ga0163162_10104729 3300013306 Bacteria 2924
162 Ga0163162_10822450 3300013306 Bacteria 1045
163 Ga0157375_10008137 3300013308 Bacteria 9175
164 Ga0157375_10653209 3300013308 Bacteria 1208
165 Ga0163163_10011466 3300014325 Bacteria 8042
166 Ga0163163_10018899 3300014325 Bacteria 6465
167 Ga0163163_10019379 3300014325 Bacteria 6389
168 Ga0163163_10123728 3300014325 Bacteria 2622
169 Ga0163163_10214718 3300014325 Bacteria 1973
170 Ga0163163_10332728 3300014325 Bacteria 1573
171 Ga0163163_10748778 3300014325 Bacteria 1040
172 Ga0163163_12832997 3300014325 Unclassified 541
173 Ga0157380_10010124 3300014326 Bacteria 6775
174 Ga0157377_10001871 3300014745 Bacteria 9216
175 Ga0157377_10531142 3300014745 Bacteria 828
176 Ga0157379_10506389 3300014968 Bacteria 1119
177 Ga0207653_10001624 3300025885 Bacteria 7233
178 Ga0207653_10037680 3300025885 Bacteria 1577
179 Ga0207688_10110921 3300025901 Unclassified 1592
180 Ga0207680_10175268 3300025903 Bacteria 1447
181 Ga0207685_10064306 3300025905 Bacteria 1464
182 Ga0207699_10607671 3300025906 Unclassified 796
183 Ga0207645_10173769 3300025907 Unclassified 1412
184 Ga0207643_10004561 3300025908 Bacteria 7443
185 Ga0207684_10022072 3300025910 Bacteria 5436
186 Ga0207684_10092878 3300025910 Bacteria 2572
187 Ga0207684_10518112 3300025910 Bacteria 1021
188 Ga0207654_10219216 3300025911 Unclassified 1261
189 Ga0207654_11048484 3300025911 Bacteria 593
190 Ga0207693_10325470 3300025915 Bacteria 1203
191 Ga0207693_10628442 3300025915 Bacteria 835
192 Ga0207660_11340212 3300025917 Unclassified 581
193 Ga0207662_10012310 3300025918 Bacteria 4761
194 Ga0207657_10023977 3300025919 Bacteria 5665
195 Ga0207649_10202609 3300025920 Bacteria 1403
196 Ga0207652_10031337 3300025921 Bacteria 4465
197 Ga0207646_10002036 3300025922 Bacteria 24288
198 Ga0207646_10012048 3300025922 Bacteria 8327
199 Ga0207646_10016705 3300025922 Bacteria 6884
200 Ga0207646_11084625 3300025922 Bacteria 705
201 Ga0207646_11219060 3300025922 Unclassified 659
202 Ga0207681_10082770 3300025923 Bacteria 2270
203 Ga0207694_10077664 3300025924 Bacteria 2602
204 Ga0207650_10809526 3300025925 Bacteria 794
205 Ga0207659_10041810 3300025926 Bacteria 3211
206 Ga0207659_10055167 3300025926 Bacteria 2841
207 Ga0207659_10613740 3300025926 Bacteria 928
208 Ga0207687_10047418 3300025927 Bacteria 2979
209 Ga0207687_10149911 3300025927 Unclassified 1778
210 Ga0207644_10740352 3300025931 Bacteria 821
211 Ga0207690_10197829 3300025932 Bacteria 1524
212 Ga0207690_11135965 3300025932 Bacteria 651
213 Ga0207690_11698489 3300025932 Bacteria 527
214 Ga0207706_10035925 3300025933 Bacteria 4403
215 Ga0207706_10387783 3300025933 Bacteria 1212
216 Ga0207670_10282459 3300025936 Unclassified 1294
217 Ga0207669_10033555 3300025937 Unclassified 2898
218 Ga0207691_10081321 3300025940 Bacteria 2912
219 Ga0207691_10337063 3300025940 Unclassified 1291
220 Ga0207691_11490178 3300025940 Unclassified 553
221 Ga0207689_10520485 3300025942 Bacteria 997
222 Ga0207689_10856377 3300025942 Bacteria 767
223 Ga0207679_10023805 3300025945 Bacteria 4192
224 Ga0207679_10455943 3300025945 Bacteria 1135
225 Ga0207679_10641731 3300025945 Unclassified 960
226 Ga0207679_10849531 3300025945 Bacteria 834
227 Ga0207667_10302366 3300025949 Bacteria 1635
228 Ga0207651_10008152 3300025960 Bacteria 5638
229 Ga0207651_10150918 3300025960 Unclassified 1809
230 Ga0207712_10172472 3300025961 Bacteria 1692
231 Ga0207712_10276117 3300025961 Bacteria 1369
232 Ga0207712_10439771 3300025961 Unclassified 1104
233 Ga0207668_10524959 3300025972 Unclassified 1022
234 Ga0207640_10018979 3300025981 Bacteria 4052
235 Ga0207640_11324080 3300025981 Unclassified 643
236 Ga0207640_11463792 3300025981 Bacteria 613
237 Ga0207677_10270933 3300026023 Bacteria 1389
238 Ga0207677_10555374 3300026023 Bacteria 1001
239 Ga0207703_10267723 3300026035 Bacteria 1547
240 Ga0207639_10109528 3300026041 Bacteria 2247
241 Ga0207639_10284568 3300026041 Bacteria 1455
242 Ga0207708_10003005 3300026075 Bacteria 12424
243 Ga0207708_10058992 3300026075 Bacteria 2928
244 Ga0207708_10086086 3300026075 Bacteria 2418
245 Ga0207708_10243056 3300026075 Bacteria 1448
246 Ga0207702_10388959 3300026078 Unclassified 1343
247 Ga0207702_10584055 3300026078 Bacteria 1095
248 Ga0207641_10144092 3300026088 Bacteria 2153
249 Ga0207641_10210506 3300026088 Bacteria 1798
250 Ga0207648_10003422 3300026089 Bacteria 16653
251 Ga0207648_10363634 3300026089 Bacteria 1306
252 Ga0207676_10209329 3300026095 Bacteria 1729
253 Ga0207676_10434201 3300026095 Bacteria 1235
254 Ga0207676_10956297 3300026095 Unclassified 842
255 Ga0207674_10009525 3300026116 Bacteria 11085
256 Ga0207674_10835968 3300026116 Bacteria 888
257 Ga0207674_11921419 3300026116 Unclassified 558
258 Ga0207675_100038773 3300026118 Bacteria 4446
259 Ga0207675_100616928 3300026118 Bacteria 1089
260 Ga0207683_10558059 3300026121 Bacteria 1059
261 Ga0207683_11266150 3300026121 Bacteria 683
262 Ga0207698_10143968 3300026142 Bacteria 2058
263 Ga0209998_10006798 3300027717 Bacteria 2372
264 Ga0209974_10027959 3300027876 Bacteria 1867
265 Ga0207428_10071940 3300027907 Bacteria 2715
266 Ga0207428_10399545 3300027907 Unclassified 1006
267 Ga0268265_10425613 3300028380 Bacteria 1234
268 Ga0268264_10092179 3300028381 Unclassified 2615
269 Ga0268264_10237733 3300028381 Bacteria 1686
270 Ga0268264_10416719 3300028381 Bacteria 1294
271 Ga0268264_11459108 3300028381 Unclassified 695
272 Ga0268264_12472608 3300028381 Unclassified 525
273 Ga0265319_1005937 3300028563 Bacteria 5741
274 Ga0265319_1135930 3300028563 Unclassified 764
275 Ga0265334_10005772 3300028573 Bacteria 5391
276 Ga0265334_10080533 3300028573 Bacteria 1200
277 Ga0265334_10092217 3300028573 Bacteria 1104
278 Ga0265318_10030480 3300028577 Bacteria 2099
279 Ga0265318_10074564 3300028577 Bacteria 1256
280 Ga0265322_10020345 3300028654 Bacteria 1903
281 Ga0265336_10013442 3300028666 Bacteria 2729
282 Ga0265338_10084162 3300028800 Bacteria 2656
283 Ga0265338_10125280 3300028800 Bacteria 2039
284 Ga0265338_10728779 3300028800 Unclassified 683
285 Ga0265324_10070083 3300029957 Bacteria 1194
286 Ga0265332_10026698 3300031238 Bacteria 2532
287 Ga0265328_10029778 3300031239 Bacteria 2036
288 Ga0265320_10013134 3300031240 Bacteria 4776
289 Ga0265320_10071470 3300031240 Bacteria 1635
290 Ga0265325_10029772 3300031241 Bacteria 2932
291 Ga0265325_10192244 3300031241 Unclassified 945
292 Ga0265339_10099881 3300031249 Bacteria 1512
293 Ga0265339_10373598 3300031249 Unclassified 669
294 Ga0265316_10025703 3300031344 Bacteria 4910
295 Ga0265314_10097591 3300031711 Bacteria 1897
296 Ga0265342_10203096 3300031712 Unclassified 1076
297 Ga0307413_10216759 3300031824 Bacteria 1395
298 Ga0307413_10408653 3300031824 Bacteria 1066
299 Ga0307410_10164675 3300031852 Unclassified 1665
300 Ga0307406_10576078 3300031901 Bacteria 925
301 Ga0307409_100164920 3300031995 Bacteria 1943
302 Ga0307416_101593807 3300032002 Unclassified 758
303 Ga0307415_100662680 3300032126 Bacteria 937
304 Ga0373948_0218743 3300034817 Bacteria 503
305 Ga0373960_0269100 3300035121 Bacteria 625
306 Ga0373935_0219578 3300035692 Bacteria 1320
307 Ga0373935_1095657 3300035692 Unclassified 593
308 Ga0373937_1097883 3300036401 Bacteria 744
309 Ga0373925_0475909 3300037068 Unclassified 1024
310 Ga0395900_1752466 3300037418 Bacteria 532
311 Ga0395901_0719528 3300038443 Bacteria 994
312 Ga0395901_1189272 3300038443 Bacteria 729
313 Ga0439466_0068092 3300041411 Bacteria 1138
314 Ga0439465_0168179 3300041413 Bacteria 789
315 Ga0451807_2536942 3300041486 Bacteria 726
316 Ga0451847_0543366 3300041503 Bacteria 510
317 Ga0451853_2225043 3300041512 Bacteria 899
318 Ga0450920_023077 3300042122 Bacteria 1206
319 Ga0439446_0061056 3300042156 Bacteria 1140
320 Ga0466960_0256606 3300044901 Bacteria 973
321 Ga0451576_0198280 3300045051 Bacteria 2097
322 Ga0466967_2163336 3300045976 Bacteria 552
323 Ga0495603_0222832 3300046455 Bacteria 1088
324 Ga0495664_0091482 3300046477 Bacteria 1829
325 Ga0495618_0087371 3300046514 Bacteria 1994
326 Ga0495640_0027776 3300046533 Bacteria 4078
327 Ga0495587_0252858 3300046536 Bacteria 991
328 Ga0495634_0718157 3300046642 Bacteria 574
329 Ga0495635_0801815 3300046663 Unclassified 607
330 Ga0495581_0637628 3300047315 Unclassified 616
331 Ga0495604_0658146 3300047317 Bacteria 668
332 Ga0495676_0407785 3300047321 Unclassified 901
333 Ga0495680_0102568 3300047322 Bacteria 2130
334 Ga0495675_0198631 3300047444 Unclassified 1222
335 Ga0496101_0068185 3300048904 Unclassified 2600
336 Ga0496101_0097199 3300048904 Bacteria 2199
337 Ga0496102_0116152 3300048905 Bacteria 2497
338 Ga0496102_0516418 3300048905 Bacteria 1117
339 Ga0496102_0685097 3300048905 Bacteria 948
340 Ga0496102_1526319 3300048905 Unclassified 587
341 Ga0496103_0046140 3300048906 Bacteria 2689
342 Ga0496103_0578308 3300048906 Bacteria 716
343 Ga0496104_0029071 3300048907 Bacteria 5125
344 Ga0496104_0282371 3300048907 Bacteria 1573
345 Ga0496105_0118316 3300048908 Bacteria 2185
346 Ga0496106_0193371 3300048909 Bacteria 1618
347 Ga0496106_0829294 3300048909 Bacteria 733
348 Ga0496107_0152703 3300048910 Bacteria 1709
349 Ga0496107_0718957 3300048910 Bacteria 734
350 Ga0496108_0176116 3300048911 Bacteria 1851
351 Ga0496108_0227340 3300048911 Unclassified 1622
352 Ga0496108_0912038 3300048911 Bacteria 754
353 Ga0496109_0011504 3300048912 Bacteria 7611
354 Ga0496109_0055610 3300048912 Bacteria 3610
355 Ga0496109_0094210 3300048912 Bacteria 2772
356 Ga0496109_0149637 3300048912 Bacteria 2185
357 Ga0496109_0576384 3300048912 Bacteria 1061
358 Ga0496109_1154400 3300048912 Bacteria 711
359 Ga0496110_0015619 3300048913 Bacteria 6324
360 Ga0496110_0147006 3300048913 Bacteria 2132
361 Ga0496111_0021281 3300048914 Bacteria 4526
362 Ga0496112_0029189 3300048915 Bacteria 5332
363 Ga0496112_0043996 3300048915 Bacteria 4373
364 Ga0496112_0051453 3300048915 Bacteria 4041
365 Ga0496112_0403993 3300048915 Bacteria 1306
366 Ga0496112_1569850 3300048915 Bacteria 572
367 Ga0496113_0003112 3300048916 Bacteria 9865
368 Ga0496113_0201890 3300048916 Bacteria 1580
369 Ga0496113_0444909 3300048916 Bacteria 1041
370 Ga0496113_0491309 3300048916 Bacteria 986
371 Ga0496114_0159393 3300048917 Bacteria 1961
372 Ga0496114_0403836 3300048917 Bacteria 1210
373 Ga0496114_0459845 3300048917 Bacteria 1127
374 Ga0496114_0720743 3300048917 Bacteria 874
375 Ga0501031_0010196 3300049568 Bacteria 6120
376 Ga0501031_0103581 3300049568 Bacteria 1857
377 Ga0501031_0331720 3300049568 Unclassified 985
378 Ga0501032_0063911 3300049569 Bacteria 2464
379 Ga0501033_0214896 3300049570 Bacteria 1370
380 Ga0501033_0748003 3300049570 Bacteria 663
381 Ga0501034_1105167 3300049571 Bacteria 674
382 Ga0501036_0038266 3300049572 Bacteria 4059
383 Ga0501036_0487710 3300049572 Unclassified 1026
384 Ga0501037_0032173 3300049573 Bacteria 3872
385 Ga0501038_0012056 3300049574 Bacteria 7893
386 Ga0501039_0127183 3300049575 Bacteria 1999
387 Ga0501039_0216599 3300049575 Bacteria 1505
388 Ga0501040_0008217 3300049576 Bacteria 6785
389 Ga0501040_0162546 3300049576 Bacteria 1579
390 Ga0501041_0058366 3300049577 Bacteria 2360
391 Ga0501041_0267592 3300049577 Bacteria 1075
392 Ga0501041_0457282 3300049577 Bacteria 811
393 Ga0501042_0026519 3300049578 Bacteria 4072
394 Ga0501042_0247361 3300049578 Bacteria 1287
395 Ga0501042_0588861 3300049578 Bacteria 809
396 Ga0501043_0282948 3300049579 Bacteria 1271
397 Ga0501046_0241040 3300049580 Bacteria 1333
398 Ga0501046_0254718 3300049580 Bacteria 1291
399 Ga0501048_0052962 3300049582 Bacteria 2887
400 Ga0501048_0450146 3300049582 Bacteria 922
401 Ga0501067_0025323 3300049583 Bacteria 3289
402 Ga0501067_0222704 3300049583 Bacteria 1051
403 Ga0501068_0011095 3300049584 Bacteria 5073
404 Ga0501068_0412426 3300049584 Bacteria 872
405 Ga0501069_0018812 3300049585 Bacteria 3730
406 Ga0501070_0084649 3300049586 Bacteria 2625
407 Ga0501071_0016243 3300049587 Bacteria 5117
408 Ga0501071_0536327 3300049587 Bacteria 898
409 Ga0501072_0034251 3300049588 Bacteria 3979
410 Ga0501072_0311450 3300049588 Unclassified 1251
411 Ga0501074_0282530 3300049590 Bacteria 1180
412 Ga0501074_0437615 3300049590 Bacteria 927
413 Ga0501075_0065612 3300049591 Bacteria 2739
414 Ga0501075_0325976 3300049591 Bacteria 1170
415 Ga0501075_0480452 3300049591 Bacteria 948
416 Ga0501076_0196312 3300049592 Bacteria 1647
417 Ga0501077_0023816 3300049593 Bacteria 3882
418 Ga0501077_0315788 3300049593 Bacteria 996
419 Ga0501077_0443038 3300049593 Bacteria 832
420 Ga0501080_0037262 3300049742 Bacteria 4540
421 Ga0501080_0337156 3300049742 Unclassified 1363
422 Ga0501080_0542775 3300049742 Bacteria 1036
423 Ga0501081_0179158 3300049743 Bacteria 1532
424 Ga0501083_0012761 3300049744 Bacteria 5876
425 Ga0501083_0435841 3300049744 Bacteria 853
426 Ga0501035_0038044 3300049822 Bacteria 4356
427 Ga0501044_0806630 3300049823 Bacteria 818
428 Ga0501045_0020791 3300049824 Bacteria 4690
429 Ga0501045_0056931 3300049824 Bacteria 2860
430 Ga0501045_0937589 3300049824 Bacteria 636
431 Ga0501045_0956966 3300049824 Bacteria 628
432 nmdc:mga08y16_14990_c1 3300050511 Bacteria 8153
433 nmdc:mga08y16_368082_c1 3300050511 Bacteria 1475
434 nmdc:mga08y16_583657_c1 3300050511 Unclassified 1128
435 nmdc:mga0rr50_116696_c1 3300050513 Unclassified 2119
436 nmdc:mga0rr50_255535_c1 3300050513 Bacteria 1456
437 nmdc:mga0a205_79891_c1 3300050515 Bacteria 3161
438 Ga0495601_0017799 3300053077 Bacteria 4317
439 Ga0495612_0370171 3300053078 Bacteria 648
440 Ga0495619_0081236 3300053085 Bacteria 2182
441 Ga0495619_0177738 3300053085 Bacteria 1472
442 Ga0495619_0494076 3300053085 Unclassified 842
443 Ga0501084_0240734 3300054114 Unclassified 1527
444 Ga0501084_0255081 3300054114 Bacteria 1480
445 Ga0501082_0035529 3300060353 Bacteria 4295
446 Ga0501082_0309619 3300060353 Bacteria 1375
447 Ga0501082_0649202 3300060353 Unclassified 923
448 Ga0530510_0015123 3300061734 Bacteria 5450
449 Ga0530510_0024636 3300061734 Bacteria 4296
450 Ga0530510_0195687 3300061734 Bacteria 1501
451 Ga0530510_0634072 3300061734 Bacteria 813
452 Ga0530510_0897477 3300061734 Bacteria 677

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005549 Ga0070704_100066291 Ga0070704_1000662915 119
2 3300026041 Ga0207639_10284568 Ga0207639_102845682 119
3 3300048909 Ga0496106_0193371 Ga0496106_0193371_1078_1470 119
4 3300005345 Ga0070692_10007998 Ga0070692_100079984 120
5 3300005444 Ga0070694_100087302 Ga0070694_1000873022 120
6 3300005539 Ga0068853_100126674 Ga0068853_1001266743 120
7 3300005843 Ga0068860_100453073 Ga0068860_1004530732 120
8 3300009553 Ga0105249_10078626 Ga0105249_100786262 120
9 3300010375 Ga0105239_10340800 Ga0105239_103408003 120
10 3300025911 Ga0207654_11048484 Ga0207654_110484842 120
11 3300025932 Ga0207690_11135965 Ga0207690_111359652 120
12 3300025949 Ga0207667_10302366 Ga0207667_103023662 120
13 3300025961 Ga0207712_10276117 Ga0207712_102761173 120
14 3300026118 Ga0207675_100616928 Ga0207675_1006169282 120
15 3300028381 Ga0268264_10416719 Ga0268264_104167192 120
16 3300045051 Ga0451576_0198280 Ga0451576_0198280_1409_1801 120
17 3300047315 Ga0495581_0637628 Ga0495581_0637628_119_508 122
18 3300047321 Ga0495676_0407785 Ga0495676_0407785_225_614 122
19 3300053085 Ga0495619_0494076 Ga0495619_0494076_113_502 122
20 3300005331 Ga0070670_100409855 Ga0070670_1004098553 124
21 3300014325 Ga0163163_10011466 Ga0163163_100114664 124
22 3300005468 Ga0070707_100141785 Ga0070707_1001417852 126
23 3300025922 Ga0207646_11084625 Ga0207646_110846252 126
24 3300005337 Ga0070682_100036972 Ga0070682_1000369722 127
25 3300005354 Ga0070675_100696594 Ga0070675_1006965942 127
26 3300005434 Ga0070709_10657120 Ga0070709_106571202 127
27 3300005440 Ga0070705_100017537 Ga0070705_1000175372 127
28 3300005444 Ga0070694_100198498 Ga0070694_1001984983 127
29 3300005467 Ga0070706_100648630 Ga0070706_1006486302 127
30 3300005468 Ga0070707_100001009 Ga0070707_1000010098 127
31 3300005471 Ga0070698_100159323 Ga0070698_1001593232 127
32 3300005518 Ga0070699_100028561 Ga0070699_1000285616 127
33 3300005543 Ga0070672_100987300 Ga0070672_1009873001 127
34 3300005549 Ga0070704_100052164 Ga0070704_1000521645 127
35 3300005614 Ga0068856_101135854 Ga0068856_1011358542 127
36 3300005615 Ga0070702_100294330 Ga0070702_1002943303 127
37 3300006163 Ga0070715_10304177 Ga0070715_103041771 127
38 3300006175 Ga0070712_100383008 Ga0070712_1003830081 127
39 3300009094 Ga0111539_10216601 Ga0111539_102166012 127
40 3300009098 Ga0105245_11915732 Ga0105245_119157322 127
41 3300009553 Ga0105249_10800487 Ga0105249_108004871 127
42 3300013297 Ga0157378_11460335 Ga0157378_114603352 127
43 3300014325 Ga0163163_10748778 Ga0163163_107487782 127
44 3300025885 Ga0207653_10037680 Ga0207653_100376803 127
45 3300025905 Ga0207685_10064306 Ga0207685_100643063 127
46 3300025906 Ga0207699_10607671 Ga0207699_106076712 127
47 3300025910 Ga0207684_10022072 Ga0207684_100220722 127
48 3300025910 Ga0207684_10518112 Ga0207684_105181123 127
49 3300025915 Ga0207693_10325470 Ga0207693_103254703 127
50 3300025922 Ga0207646_10002036 Ga0207646_100020365 127
51 3300025922 Ga0207646_10012048 Ga0207646_100120488 127
52 3300026075 Ga0207708_10243056 Ga0207708_102430562 127
53 3300026078 Ga0207702_10584055 Ga0207702_105840551 127
54 3300026116 Ga0207674_11921419 Ga0207674_119214192 127
55 3300026121 Ga0207683_11266150 Ga0207683_112661502 127
56 3300027717 Ga0209998_10006798 Ga0209998_100067983 127
57 3300027876 Ga0209974_10027959 Ga0209974_100279592 127
58 3300048912 Ga0496109_1154400 Ga0496109_1154400_58_444 127
59 3300050511 nmdc:mga08y16_583657_c1 nmdc:mga08y16_583657_c1_648_1040 127
60 3300005334 Ga0068869_100747233 Ga0068869_1007472332 128
61 3300005336 Ga0070680_100353724 Ga0070680_1003537241 128
62 3300005338 Ga0068868_100740830 Ga0068868_1007408302 128
63 3300005345 Ga0070692_10454836 Ga0070692_104548362 128
64 3300005354 Ga0070675_100292492 Ga0070675_1002924922 128
65 3300005355 Ga0070671_101090272 Ga0070671_1010902722 128
66 3300005406 Ga0070703_10046161 Ga0070703_100461612 128
67 3300005441 Ga0070700_100316997 Ga0070700_1003169972 128
68 3300005444 Ga0070694_100094293 Ga0070694_1000942932 128
69 3300005445 Ga0070708_100025853 Ga0070708_1000258536 128
70 3300005445 Ga0070708_100368434 Ga0070708_1003684343 128
71 3300005456 Ga0070678_100308183 Ga0070678_1003081832 128
72 3300005456 Ga0070678_100781700 Ga0070678_1007817002 128
73 3300005459 Ga0068867_101176645 Ga0068867_1011766452 128
74 3300005467 Ga0070706_101698739 Ga0070706_1016987391 128
75 3300005468 Ga0070707_100026690 Ga0070707_1000266902 128
76 3300005471 Ga0070698_101704302 Ga0070698_1017043021 128
77 3300005518 Ga0070699_100136914 Ga0070699_1001369143 128
78 3300005535 Ga0070684_100140625 Ga0070684_1001406253 128
79 3300005536 Ga0070697_100190394 Ga0070697_1001903942 128
80 3300005544 Ga0070686_100035501 Ga0070686_1000355011 128
81 3300005545 Ga0070695_100154507 Ga0070695_1001545072 128
82 3300005546 Ga0070696_100029599 Ga0070696_1000295992 128
83 3300005546 Ga0070696_100063003 Ga0070696_1000630032 128
84 3300005546 Ga0070696_100077334 Ga0070696_1000773343 128
85 3300005547 Ga0070693_100660575 Ga0070693_1006605752 128
86 3300005549 Ga0070704_100056808 Ga0070704_1000568084 128
87 3300005564 Ga0070664_100755327 Ga0070664_1007553272 128
88 3300005564 Ga0070664_100787004 Ga0070664_1007870042 128
89 3300005614 Ga0068856_100179368 Ga0068856_1001793682 128
90 3300005614 Ga0068856_100353011 Ga0068856_1003530112 128
91 3300005618 Ga0068864_100246142 Ga0068864_1002461422 128
92 3300005841 Ga0068863_100444540 Ga0068863_1004445402 128
93 3300005841 Ga0068863_100697641 Ga0068863_1006976412 128
94 3300005843 Ga0068860_101233698 Ga0068860_1012336982 128
95 3300005844 Ga0068862_100454982 Ga0068862_1004549822 128
96 3300005844 Ga0068862_102169997 Ga0068862_1021699972 128
97 3300006173 Ga0070716_101655814 Ga0070716_1016558142 128
98 3300006358 Ga0068871_100911848 Ga0068871_1009118482 128
99 3300006871 Ga0075434_100071953 Ga0075434_1000719533 128
100 3300006871 Ga0075434_100157502 Ga0075434_1001575022 128
101 3300006871 Ga0075434_100942119 Ga0075434_1009421192 128
102 3300006881 Ga0068865_101009386 Ga0068865_1010093862 128
103 3300007076 Ga0075435_100107558 Ga0075435_1001075582 128
104 3300007076 Ga0075435_100885795 Ga0075435_1008857952 128
105 3300009094 Ga0111539_10012521 Ga0111539_100125213 128
106 3300009098 Ga0105245_10896296 Ga0105245_108962962 128
107 3300009098 Ga0105245_12107303 Ga0105245_121073032 128
108 3300009147 Ga0114129_10126437 Ga0114129_101264373 128
109 3300009147 Ga0114129_10150742 Ga0114129_101507422 128
110 3300009553 Ga0105249_10259890 Ga0105249_102598903 128
111 3300011119 Ga0105246_11450727 Ga0105246_114507272 128
112 3300013296 Ga0157374_12588052 Ga0157374_125880521 128
113 3300013308 Ga0157375_10653209 Ga0157375_106532091 128
114 3300014325 Ga0163163_10019379 Ga0163163_100193795 128
115 3300014325 Ga0163163_10123728 Ga0163163_101237282 128
116 3300014325 Ga0163163_10332728 Ga0163163_103327282 128
117 3300014968 Ga0157379_10506389 Ga0157379_105063891 128
118 3300025885 Ga0207653_10001624 Ga0207653_100016246 128
119 3300025915 Ga0207693_10628442 Ga0207693_106284421 128
120 3300025922 Ga0207646_10016705 Ga0207646_100167057 128
121 3300025926 Ga0207659_10055167 Ga0207659_100551676 128
122 3300025931 Ga0207644_10740352 Ga0207644_107403522 128
123 3300025932 Ga0207690_11698489 Ga0207690_116984891 128
124 3300025940 Ga0207691_11490178 Ga0207691_114901782 128
125 3300025942 Ga0207689_10856377 Ga0207689_108563772 128
126 3300025945 Ga0207679_10455943 Ga0207679_104559432 128
127 3300025945 Ga0207679_10641731 Ga0207679_106417311 128
128 3300025945 Ga0207679_10849531 Ga0207679_108495312 128
129 3300025960 Ga0207651_10150918 Ga0207651_101509182 128
130 3300026023 Ga0207677_10555374 Ga0207677_105553742 128
131 3300026075 Ga0207708_10058992 Ga0207708_100589922 128
132 3300026075 Ga0207708_10086086 Ga0207708_100860861 128
133 3300026078 Ga0207702_10388959 Ga0207702_103889591 128
134 3300026088 Ga0207641_10144092 Ga0207641_101440923 128
135 3300026089 Ga0207648_10363634 Ga0207648_103636342 128
136 3300026095 Ga0207676_10209329 Ga0207676_102093292 128
137 3300026095 Ga0207676_10434201 Ga0207676_104342012 128
138 3300026116 Ga0207674_10835968 Ga0207674_108359682 128
139 3300026121 Ga0207683_10558059 Ga0207683_105580592 128
140 3300027907 Ga0207428_10071940 Ga0207428_100719403 128
141 3300028380 Ga0268265_10425613 Ga0268265_104256132 128
142 3300028381 Ga0268264_12472608 Ga0268264_124726081 128
143 3300031824 Ga0307413_10216759 Ga0307413_102167593 128
144 3300031824 Ga0307413_10408653 Ga0307413_104086532 128
145 3300031852 Ga0307410_10164675 Ga0307410_101646752 128
146 3300031901 Ga0307406_10576078 Ga0307406_105760782 128
147 3300031995 Ga0307409_100164920 Ga0307409_1001649203 128
148 3300032002 Ga0307416_101593807 Ga0307416_1015938072 128
149 3300032126 Ga0307415_100662680 Ga0307415_1006626802 128
150 3300034817 Ga0373948_0218743 Ga0373948_0218743_12_401 128
151 3300035121 Ga0373960_0269100 Ga0373960_0269100_14_418 128
152 3300037418 Ga0395900_1752466 Ga0395900_1752466_127_522 128
153 3300038443 Ga0395901_0719528 Ga0395901_0719528_346_738 128
154 3300038443 Ga0395901_1189272 Ga0395901_1189272_206_601 128
155 3300041411 Ga0439466_0068092 Ga0439466_0068092_588_980 128
156 3300041413 Ga0439465_0168179 Ga0439465_0168179_380_772 128
157 3300041486 Ga0451807_2536942 Ga0451807_2536942_12_425 128
158 3300041503 Ga0451847_0543366 Ga0451847_0543366_60_449 128
159 3300041512 Ga0451853_2225043 Ga0451853_2225043_442_831 128
160 3300042122 Ga0450920_023077 Ga0450920_023077_305_694 128
161 3300042156 Ga0439446_0061056 Ga0439446_0061056_226_618 128
162 3300044901 Ga0466960_0256606 Ga0466960_0256606_53_439 128
163 3300045976 Ga0466967_2163336 Ga0466967_2163336_148_534 128
164 3300046455 Ga0495603_0222832 Ga0495603_0222832_499_888 128
165 3300046477 Ga0495664_0091482 Ga0495664_0091482_993_1382 128
166 3300046514 Ga0495618_0087371 Ga0495618_0087371_696_1085 128
167 3300046533 Ga0495640_0027776 Ga0495640_0027776_2380_2769 128
168 3300046536 Ga0495587_0252858 Ga0495587_0252858_293_682 128
169 3300046642 Ga0495634_0718157 Ga0495634_0718157_120_509 128
170 3300047317 Ga0495604_0658146 Ga0495604_0658146_73_462 128
171 3300047322 Ga0495680_0102568 Ga0495680_0102568_186_575 128
172 3300047444 Ga0495675_0198631 Ga0495675_0198631_582_971 128
173 3300048904 Ga0496101_0097199 Ga0496101_0097199_427_819 128
174 3300048905 Ga0496102_0116152 Ga0496102_0116152_1493_1882 128
175 3300048905 Ga0496102_0516418 Ga0496102_0516418_107_529 128
176 3300048905 Ga0496102_1526319 Ga0496102_1526319_17_406 128
177 3300048906 Ga0496103_0046140 Ga0496103_0046140_842_1231 128
178 3300048907 Ga0496104_0282371 Ga0496104_0282371_82_474 128
179 3300048908 Ga0496105_0118316 Ga0496105_0118316_846_1238 128
180 3300048909 Ga0496106_0829294 Ga0496106_0829294_212_604 128
181 3300048910 Ga0496107_0152703 Ga0496107_0152703_103_492 128
182 3300048910 Ga0496107_0718957 Ga0496107_0718957_92_481 128
183 3300048911 Ga0496108_0176116 Ga0496108_0176116_348_740 128
184 3300048911 Ga0496108_0912038 Ga0496108_0912038_209_598 128
185 3300048912 Ga0496109_0011504 Ga0496109_0011504_3483_3875 128
186 3300048912 Ga0496109_0094210 Ga0496109_0094210_68_457 128
187 3300048912 Ga0496109_0149637 Ga0496109_0149637_154_543 128
188 3300048912 Ga0496109_0576384 Ga0496109_0576384_241_630 128
189 3300048913 Ga0496110_0147006 Ga0496110_0147006_1695_2084 128
190 3300048914 Ga0496111_0021281 Ga0496111_0021281_2383_2772 128
191 3300048915 Ga0496112_0029189 Ga0496112_0029189_4867_5256 128
192 3300048915 Ga0496112_0051453 Ga0496112_0051453_1205_1594 128
193 3300048915 Ga0496112_1569850 Ga0496112_1569850_141_530 128
194 3300048916 Ga0496113_0003112 Ga0496113_0003112_416_805 128
195 3300048916 Ga0496113_0444909 Ga0496113_0444909_215_604 128
196 3300048917 Ga0496114_0403836 Ga0496114_0403836_613_1005 128
197 3300048917 Ga0496114_0459845 Ga0496114_0459845_681_1073 128
198 3300048917 Ga0496114_0720743 Ga0496114_0720743_182_571 128
199 3300049568 Ga0501031_0010196 Ga0501031_0010196_272_661 128
200 3300049569 Ga0501032_0063911 Ga0501032_0063911_42_431 128
201 3300049570 Ga0501033_0214896 Ga0501033_0214896_83_472 128
202 3300049571 Ga0501034_1105167 Ga0501034_1105167_82_471 128
203 3300049572 Ga0501036_0038266 Ga0501036_0038266_1563_1952 128
204 3300049573 Ga0501037_0032173 Ga0501037_0032173_3031_3420 128
205 3300049574 Ga0501038_0012056 Ga0501038_0012056_7216_7605 128
206 3300049575 Ga0501039_0216599 Ga0501039_0216599_870_1259 128
207 3300049576 Ga0501040_0008217 Ga0501040_0008217_551_940 128
208 3300049577 Ga0501041_0058366 Ga0501041_0058366_1732_2121 128
209 3300049578 Ga0501042_0026519 Ga0501042_0026519_144_533 128
210 3300049579 Ga0501043_0282948 Ga0501043_0282948_173_562 128
211 3300049580 Ga0501046_0241040 Ga0501046_0241040_741_1130 128
212 3300049582 Ga0501048_0052962 Ga0501048_0052962_2340_2729 128
213 3300049583 Ga0501067_0025323 Ga0501067_0025323_2830_3222 128
214 3300049583 Ga0501067_0222704 Ga0501067_0222704_394_798 128
215 3300049584 Ga0501068_0011095 Ga0501068_0011095_4053_4442 128
216 3300049585 Ga0501069_0018812 Ga0501069_0018812_2340_2729 128
217 3300049586 Ga0501070_0084649 Ga0501070_0084649_1519_1908 128
218 3300049587 Ga0501071_0016243 Ga0501071_0016243_4447_4836 128
219 3300049587 Ga0501071_0536327 Ga0501071_0536327_18_410 128
220 3300049588 Ga0501072_0034251 Ga0501072_0034251_294_683 128
221 3300049592 Ga0501076_0196312 Ga0501076_0196312_207_596 128
222 3300049593 Ga0501077_0023816 Ga0501077_0023816_3357_3746 128
223 3300049742 Ga0501080_0037262 Ga0501080_0037262_240_629 128
224 3300049744 Ga0501083_0012761 Ga0501083_0012761_5101_5490 128
225 3300049822 Ga0501035_0038044 Ga0501035_0038044_594_983 128
226 3300049824 Ga0501045_0956966 Ga0501045_0956966_92_484 128
227 3300050511 nmdc:mga08y16_14990_c1 nmdc:mga08y16_14990_c1_1212_1634 128
228 3300050513 nmdc:mga0rr50_116696_c1 nmdc:mga0rr50_116696_c1_89_481 128
229 3300050513 nmdc:mga0rr50_255535_c1 nmdc:mga0rr50_255535_c1_690_1094 128
230 3300053077 Ga0495601_0017799 Ga0495601_0017799_2512_2901 128
231 3300053078 Ga0495612_0370171 Ga0495612_0370171_244_633 128
232 3300053085 Ga0495619_0081236 Ga0495619_0081236_317_706 128
233 3300054114 Ga0501084_0255081 Ga0501084_0255081_375_764 128
234 3300060353 Ga0501082_0035529 Ga0501082_0035529_76_465 128
235 3300061734 Ga0530510_0024636 Ga0530510_0024636_301_690 128
236 3300061734 Ga0530510_0195687 Ga0530510_0195687_108_512 128
237 3300061734 Ga0530510_0897477 Ga0530510_0897477_41_466 128
238 3300005338 Ga0068868_100665689 Ga0068868_1006656892 129
239 3300005356 Ga0070674_100964391 Ga0070674_1009643912 129
240 3300005444 Ga0070694_100058793 Ga0070694_1000587932 129
241 3300005445 Ga0070708_101062995 Ga0070708_1010629951 129
242 3300005458 Ga0070681_10698482 Ga0070681_106984821 129
243 3300005518 Ga0070699_100063885 Ga0070699_1000638855 129
244 3300005530 Ga0070679_100092898 Ga0070679_1000928982 129
245 3300005545 Ga0070695_100021965 Ga0070695_1000219652 129
246 3300005546 Ga0070696_100006207 Ga0070696_1000062075 129
247 3300005563 Ga0068855_102100662 Ga0068855_1021006621 129
248 3300005578 Ga0068854_101009342 Ga0068854_1010093422 129
249 3300005578 Ga0068854_102138854 Ga0068854_1021388541 129
250 3300006852 Ga0075433_10008221 Ga0075433_100082213 129
251 3300006871 Ga0075434_100559002 Ga0075434_1005590022 129
252 3300013297 Ga0157378_10835031 Ga0157378_108350311 129
253 3300013297 Ga0157378_11457951 Ga0157378_114579512 129
254 3300025921 Ga0207652_10031337 Ga0207652_100313376 129
255 3300025927 Ga0207687_10149911 Ga0207687_101499114 129
256 3300025981 Ga0207640_11324080 Ga0207640_113240801 129
257 3300025981 Ga0207640_11463792 Ga0207640_114637922 129
258 3300028381 Ga0268264_10237733 Ga0268264_102377332 129
259 3300028563 Ga0265319_1005937 Ga0265319_10059374 129
260 3300028563 Ga0265319_1135930 Ga0265319_11359302 129
261 3300028573 Ga0265334_10005772 Ga0265334_100057724 129
262 3300028573 Ga0265334_10080533 Ga0265334_100805333 129
263 3300028573 Ga0265334_10092217 Ga0265334_100922172 129
264 3300028577 Ga0265318_10030480 Ga0265318_100304803 129
265 3300028577 Ga0265318_10074564 Ga0265318_100745642 129
266 3300028654 Ga0265322_10020345 Ga0265322_100203452 129
267 3300028666 Ga0265336_10013442 Ga0265336_100134424 129
268 3300028800 Ga0265338_10084162 Ga0265338_100841624 129
269 3300028800 Ga0265338_10125280 Ga0265338_101252803 129
270 3300028800 Ga0265338_10728779 Ga0265338_107287792 129
271 3300029957 Ga0265324_10070083 Ga0265324_100700831 129
272 3300031238 Ga0265332_10026698 Ga0265332_100266982 129
273 3300031239 Ga0265328_10029778 Ga0265328_100297782 129
274 3300031240 Ga0265320_10013134 Ga0265320_100131345 129
275 3300031240 Ga0265320_10071470 Ga0265320_100714702 129
276 3300031241 Ga0265325_10029772 Ga0265325_100297723 129
277 3300031241 Ga0265325_10192244 Ga0265325_101922442 129
278 3300031249 Ga0265339_10099881 Ga0265339_100998813 129
279 3300031249 Ga0265339_10373598 Ga0265339_103735982 129
280 3300031344 Ga0265316_10025703 Ga0265316_100257033 129
281 3300031711 Ga0265314_10097591 Ga0265314_100975912 129
282 3300031712 Ga0265342_10203096 Ga0265342_102030962 129
283 3300035692 Ga0373935_0219578 Ga0373935_0219578_245_640 129
284 3300035692 Ga0373935_1095657 Ga0373935_1095657_31_423 129
285 3300036401 Ga0373937_1097883 Ga0373937_1097883_339_731 129
286 3300037068 Ga0373925_0475909 Ga0373925_0475909_66_458 129
287 3300046663 Ga0495635_0801815 Ga0495635_0801815_148_540 129
288 3300048907 Ga0496104_0029071 Ga0496104_0029071_1012_1407 129
289 3300049568 Ga0501031_0103581 Ga0501031_0103581_767_1162 129
290 3300049568 Ga0501031_0331720 Ga0501031_0331720_410_805 129
291 3300049570 Ga0501033_0748003 Ga0501033_0748003_167_562 129
292 3300049572 Ga0501036_0487710 Ga0501036_0487710_472_867 129
293 3300049575 Ga0501039_0127183 Ga0501039_0127183_1451_1846 129
294 3300049576 Ga0501040_0162546 Ga0501040_0162546_444_839 129
295 3300049577 Ga0501041_0267592 Ga0501041_0267592_330_725 129
296 3300049577 Ga0501041_0457282 Ga0501041_0457282_388_783 129
297 3300049578 Ga0501042_0247361 Ga0501042_0247361_110_505 129
298 3300049578 Ga0501042_0588861 Ga0501042_0588861_173_568 129
299 3300049580 Ga0501046_0254718 Ga0501046_0254718_533_928 129
300 3300049582 Ga0501048_0450146 Ga0501048_0450146_260_655 129
301 3300049584 Ga0501068_0412426 Ga0501068_0412426_172_567 129
302 3300049588 Ga0501072_0311450 Ga0501072_0311450_320_715 129
303 3300049590 Ga0501074_0282530 Ga0501074_0282530_763_1158 129
304 3300049590 Ga0501074_0437615 Ga0501074_0437615_501_896 129
305 3300049591 Ga0501075_0065612 Ga0501075_0065612_125_520 129
306 3300049591 Ga0501075_0325976 Ga0501075_0325976_261_656 129
307 3300049591 Ga0501075_0480452 Ga0501075_0480452_185_580 129
308 3300049593 Ga0501077_0315788 Ga0501077_0315788_365_760 129
309 3300049593 Ga0501077_0443038 Ga0501077_0443038_106_501 129
310 3300049742 Ga0501080_0337156 Ga0501080_0337156_900_1295 129
311 3300049742 Ga0501080_0542775 Ga0501080_0542775_429_824 129
312 3300049743 Ga0501081_0179158 Ga0501081_0179158_605_1000 129
313 3300049744 Ga0501083_0435841 Ga0501083_0435841_416_811 129
314 3300049823 Ga0501044_0806630 Ga0501044_0806630_160_555 129
315 3300049824 Ga0501045_0020791 Ga0501045_0020791_3668_4063 129
316 3300049824 Ga0501045_0056931 Ga0501045_0056931_1066_1461 129
317 3300049824 Ga0501045_0937589 Ga0501045_0937589_218_613 129
318 3300050515 nmdc:mga0a205_79891_c1 nmdc:mga0a205_79891_c1_705_1097 129
319 3300053085 Ga0495619_0177738 Ga0495619_0177738_535_927 129
320 3300054114 Ga0501084_0240734 Ga0501084_0240734_1092_1487 129
321 3300060353 Ga0501082_0309619 Ga0501082_0309619_774_1169 129
322 3300060353 Ga0501082_0649202 Ga0501082_0649202_132_527 129
323 3300061734 Ga0530510_0015123 Ga0530510_0015123_2690_3085 129
324 3300061734 Ga0530510_0634072 Ga0530510_0634072_228_623 129
325 3300005327 Ga0070658_10872075 Ga0070658_108720752 131
326 3300005328 Ga0070676_10091284 Ga0070676_100912842 131
327 3300005329 Ga0070683_100196291 Ga0070683_1001962912 131
328 3300005331 Ga0070670_100037836 Ga0070670_1000378363 131
329 3300005334 Ga0068869_100108377 Ga0068869_1001083772 131
330 3300005339 Ga0070660_100855515 Ga0070660_1008555152 131
331 3300005340 Ga0070689_100078025 Ga0070689_1000780255 131
332 3300005341 Ga0070691_10053577 Ga0070691_100535774 131
333 3300005343 Ga0070687_100002534 Ga0070687_1000025344 131
334 3300005344 Ga0070661_100840773 Ga0070661_1008407732 131
335 3300005347 Ga0070668_100470104 Ga0070668_1004701041 131
336 3300005353 Ga0070669_100082810 Ga0070669_1000828103 131
337 3300005354 Ga0070675_100010076 Ga0070675_1000100762 131
338 3300005355 Ga0070671_100453209 Ga0070671_1004532092 131
339 3300005356 Ga0070674_100004038 Ga0070674_1000040381 131
340 3300005364 Ga0070673_100026338 Ga0070673_1000263384 131
341 3300005365 Ga0070688_100130969 Ga0070688_1001309692 131
342 3300005366 Ga0070659_100023913 Ga0070659_1000239134 131
343 3300005437 Ga0070710_11013945 Ga0070710_110139452 131
344 3300005440 Ga0070705_100855934 Ga0070705_1008559342 131
345 3300005444 Ga0070694_100250680 Ga0070694_1002506801 131
346 3300005445 Ga0070708_100041068 Ga0070708_1000410681 131
347 3300005455 Ga0070663_100577744 Ga0070663_1005777442 131
348 3300005459 Ga0068867_100088840 Ga0068867_1000888403 131
349 3300005466 Ga0070685_10012464 Ga0070685_100124645 131
350 3300005467 Ga0070706_100002673 Ga0070706_1000026738 131
351 3300005471 Ga0070698_100106085 Ga0070698_1001060852 131
352 3300005518 Ga0070699_100412442 Ga0070699_1004124422 131
353 3300005535 Ga0070684_100035666 Ga0070684_1000356663 131
354 3300005535 Ga0070684_102121083 Ga0070684_1021210831 131
355 3300005539 Ga0068853_100186114 Ga0068853_1001861141 131
356 3300005543 Ga0070672_100262008 Ga0070672_1002620081 131
357 3300005544 Ga0070686_100007488 Ga0070686_1000074883 131
358 3300005564 Ga0070664_100457574 Ga0070664_1004575742 131
359 3300005564 Ga0070664_100900429 Ga0070664_1009004292 131
360 3300005578 Ga0068854_100007542 Ga0068854_1000075422 131
361 3300005615 Ga0070702_100002645 Ga0070702_1000026453 131
362 3300005616 Ga0068852_100805573 Ga0068852_1008055732 131
363 3300005617 Ga0068859_100555107 Ga0068859_1005551072 131
364 3300005618 Ga0068864_100014152 Ga0068864_1000141525 131
365 3300005718 Ga0068866_10011362 Ga0068866_100113622 131
366 3300005840 Ga0068870_10004223 Ga0068870_100042236 131
367 3300005842 Ga0068858_100098470 Ga0068858_1000984703 131
368 3300005843 Ga0068860_100073876 Ga0068860_1000738765 131
369 3300006358 Ga0068871_100501575 Ga0068871_1005015752 131
370 3300006871 Ga0075434_100419843 Ga0075434_1004198432 131
371 3300006881 Ga0068865_100003323 Ga0068865_1000033238 131
372 3300006931 Ga0097620_100555068 Ga0097620_1005550682 131
373 3300009036 Ga0105244_10565172 Ga0105244_105651721 131
374 3300009094 Ga0111539_10020328 Ga0111539_100203283 131
375 3300009098 Ga0105245_10026836 Ga0105245_100268366 131
376 3300009098 Ga0105245_10429196 Ga0105245_104291962 131
377 3300009101 Ga0105247_11237105 Ga0105247_112371052 131
378 3300009148 Ga0105243_10007751 Ga0105243_100077518 131
379 3300009148 Ga0105243_10097864 Ga0105243_100978642 131
380 3300009174 Ga0105241_10296960 Ga0105241_102969602 131
381 3300009551 Ga0105238_10263013 Ga0105238_102630133 131
382 3300009553 Ga0105249_10032318 Ga0105249_100323183 131
383 3300009553 Ga0105249_10034978 Ga0105249_100349784 131
384 3300010375 Ga0105239_10075368 Ga0105239_100753683 131
385 3300011119 Ga0105246_10048048 Ga0105246_100480483 131
386 3300011119 Ga0105246_10534961 Ga0105246_105349612 131
387 3300013296 Ga0157374_10664867 Ga0157374_106648671 131
388 3300013306 Ga0163162_10104729 Ga0163162_101047293 131
389 3300013306 Ga0163162_10822450 Ga0163162_108224502 131
390 3300013308 Ga0157375_10008137 Ga0157375_100081377 131
391 3300014325 Ga0163163_10018899 Ga0163163_100188995 131
392 3300014325 Ga0163163_10214718 Ga0163163_102147183 131
393 3300014325 Ga0163163_12832997 Ga0163163_128329972 131
394 3300014326 Ga0157380_10010124 Ga0157380_100101247 131
395 3300014745 Ga0157377_10001871 Ga0157377_100018719 131
396 3300014745 Ga0157377_10531142 Ga0157377_105311422 131
397 3300025901 Ga0207688_10110921 Ga0207688_101109213 131
398 3300025903 Ga0207680_10175268 Ga0207680_101752682 131
399 3300025907 Ga0207645_10173769 Ga0207645_101737693 131
400 3300025908 Ga0207643_10004561 Ga0207643_100045616 131
401 3300025910 Ga0207684_10092878 Ga0207684_100928783 131
402 3300025911 Ga0207654_10219216 Ga0207654_102192162 131
403 3300025917 Ga0207660_11340212 Ga0207660_113402121 131
404 3300025918 Ga0207662_10012310 Ga0207662_100123105 131
405 3300025919 Ga0207657_10023977 Ga0207657_100239773 131
406 3300025920 Ga0207649_10202609 Ga0207649_102026092 131
407 3300025922 Ga0207646_11219060 Ga0207646_112190602 131
408 3300025923 Ga0207681_10082770 Ga0207681_100827703 131
409 3300025924 Ga0207694_10077664 Ga0207694_100776641 131
410 3300025925 Ga0207650_10809526 Ga0207650_108095262 131
411 3300025926 Ga0207659_10041810 Ga0207659_100418102 131
412 3300025926 Ga0207659_10613740 Ga0207659_106137401 131
413 3300025927 Ga0207687_10047418 Ga0207687_100474182 131
414 3300025932 Ga0207690_10197829 Ga0207690_101978292 131
415 3300025933 Ga0207706_10035925 Ga0207706_100359252 131
416 3300025933 Ga0207706_10387783 Ga0207706_103877832 131
417 3300025936 Ga0207670_10282459 Ga0207670_102824592 131
418 3300025937 Ga0207669_10033555 Ga0207669_100335552 131
419 3300025940 Ga0207691_10081321 Ga0207691_100813212 131
420 3300025940 Ga0207691_10337063 Ga0207691_103370632 131
421 3300025942 Ga0207689_10520485 Ga0207689_105204851 131
422 3300025945 Ga0207679_10023805 Ga0207679_100238052 131
423 3300025960 Ga0207651_10008152 Ga0207651_100081525 131
424 3300025961 Ga0207712_10172472 Ga0207712_101724722 131
425 3300025961 Ga0207712_10439771 Ga0207712_104397712 131
426 3300025972 Ga0207668_10524959 Ga0207668_105249592 131
427 3300025981 Ga0207640_10018979 Ga0207640_100189795 131
428 3300026023 Ga0207677_10270933 Ga0207677_102709333 131
429 3300026035 Ga0207703_10267723 Ga0207703_102677231 131
430 3300026041 Ga0207639_10109528 Ga0207639_101095283 131
431 3300026075 Ga0207708_10003005 Ga0207708_100030055 131
432 3300026088 Ga0207641_10210506 Ga0207641_102105062 131
433 3300026089 Ga0207648_10003422 Ga0207648_100034229 131
434 3300026095 Ga0207676_10956297 Ga0207676_109562972 131
435 3300026116 Ga0207674_10009525 Ga0207674_100095254 131
436 3300026118 Ga0207675_100038773 Ga0207675_1000387736 131
437 3300026142 Ga0207698_10143968 Ga0207698_101439683 131
438 3300027907 Ga0207428_10399545 Ga0207428_103995452 131
439 3300028381 Ga0268264_10092179 Ga0268264_100921795 131
440 3300028381 Ga0268264_11459108 Ga0268264_114591082 131
441 3300048904 Ga0496101_0068185 Ga0496101_0068185_391_786 131
442 3300048905 Ga0496102_0685097 Ga0496102_0685097_436_831 131
443 3300048906 Ga0496103_0578308 Ga0496103_0578308_25_420 131
444 3300048911 Ga0496108_0227340 Ga0496108_0227340_706_1104 131
445 3300048912 Ga0496109_0055610 Ga0496109_0055610_1947_2342 131
446 3300048913 Ga0496110_0015619 Ga0496110_0015619_1268_1663 131
447 3300048915 Ga0496112_0043996 Ga0496112_0043996_2885_3283 131
448 3300048915 Ga0496112_0403993 Ga0496112_0403993_448_843 131
449 3300048916 Ga0496113_0201890 Ga0496113_0201890_981_1376 131
450 3300048916 Ga0496113_0491309 Ga0496113_0491309_47_445 131
451 3300048917 Ga0496114_0159393 Ga0496114_0159393_415_810 131
452 3300050511 nmdc:mga08y16_368082_c1 nmdc:mga08y16_368082_c1_577_972 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

28

145

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.9752 2 127
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.9671 2 127
3v4d-assembly1.cif.gz_A crystal structure of rutc protein a member of the yjgf family from e.coli 0.9333 2 128
6izh-assembly1.cif.gz_E crystal structure of deaminase amne from pseudomonas sp. ap-3 0.9267 20 129
3v4d-assembly1.cif.gz_A crystal structure of rutc protein a member of the yjgf family from e.coli 0.9258 2 128
ID Description Score Start End Superfamily
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9752 2 127 3.30.1330.40
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9671 2 127 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9116 19 127 3.30.1330.40
af_P0AFQ5_1_128_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9092 1 129 3.30.1330.40
af_Q86I26_20_139_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9062 18 127 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A6J4KFE1-F1-model_v4 RidA/YER057c/UK114 superfamily, group 6 0.9889 3 126
AF-K0EMN1-F1-model_v4 Endoribonuclease 0.9859 2 129
AF-A0A4Y3KUV6-F1-model_v4 Enamine deaminase RidA 0.9834 2 128
AF-A0A6G9Y4Z1-F1-model_v4 DUF998 domain-containing protein 0.9822 2 129 GO:0016020
AF-A0A2D5JJJ8-F1-model_v4 RidA family protein 0.9797 2 130

Feature Viewer

pLDDT pTM Quality
94.92 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map