F447067

General Info

Members Datasets Scaffolds Average Seq Length
452 339 311 169

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0398898|Ga0501034_0398898_426_1004
Length 192
Sequence VHEAQIEPDAPRRPNREKENMPYRKQTGGLAALILTGAAILFVPAPASAEDPVNTGYFGDVAIKGYDPVAYFTENRAVEGSPAYSYRWLGADWHFASAENRDRFIADPGKYAPQYGGYCADGVSFGTVTTNIDPKAWRIIDGKLYLSYDPGAADGFEKKPTKVVDSQKHWSEVQNTLISDKMHKDWQHMPAD

Samples

Sample ID Description Type Environment
1 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
2 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
3 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
4 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
5 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
6 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
7 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
8 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
9 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
10 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
11 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
12 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
13 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
14 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
15 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
16 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
17 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
18 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
19 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
20 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
21 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
22 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
23 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
24 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
25 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
26 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
27 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
28 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
29 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
30 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
31 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
32 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
33 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
34 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
35 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
36 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
37 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
38 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
39 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
40 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
41 2643221557 Ensifer sp. Root558 Isolate Unclassified
42 2643221607 Rhizobium sp. Root73 Isolate Unclassified
43 2643221610 Ensifer sp. Root74 Isolate Unclassified
44 2643221618 Ensifer sp. Root231 Isolate Unclassified
45 2643221626 Ensifer sp. Root31 Isolate Unclassified
46 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
47 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
48 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
49 2643221655 Ensifer sp. Root1252 Isolate Unclassified
50 2643221659 Ensifer sp. Root127 Isolate Unclassified
51 2643221668 Ensifer sp. Root423 Isolate Unclassified
52 2643221675 Ensifer sp. Root1298 Isolate Unclassified
53 2643221680 Ensifer sp. Root1312 Isolate Unclassified
54 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
55 2643221688 Rhizobium sp. Root482 Isolate Unclassified
56 2643221698 Ensifer sp. Root142 Isolate Unclassified
57 2643221712 Ensifer sp. Root258 Isolate Unclassified
58 2643221723 Ensifer sp. Root278 Isolate Unclassified
59 2643221726 Ensifer sp. Root954 Isolate Unclassified
60 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
61 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
62 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
63 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
64 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
65 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
66 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
67 2791355266 Rhizobium sp. L43 Isolate Nodule
68 2802429633 Rhizobium anhuiense J3 Isolate Nodule
69 2802429634 Rhizobium anhuiense S10 Isolate Nodule
70 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
71 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
72 2802429637 Rhizobium anhuiense C15 Isolate Nodule
73 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
74 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
75 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
76 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
77 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
78 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
79 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
80 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
81 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
82 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
83 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
84 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
85 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
86 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
87 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
88 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
89 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
90 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
91 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
92 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
93 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
94 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
95 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
96 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
97 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
98 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
99 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
100 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
101 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
102 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
103 2844163670 Ensifer sp. 1H6 Isolate Unclassified
104 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
105 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
106 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
107 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
108 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
109 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
110 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
111 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
112 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
113 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
114 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
115 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
116 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
117 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
118 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
119 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
120 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
121 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
122 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
123 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
124 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
125 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
126 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
127 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
128 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
129 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
130 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
131 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
132 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
133 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
134 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
135 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
136 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
137 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
138 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
139 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
140 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
141 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
142 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
143 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
144 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
145 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
146 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
147 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
148 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
149 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
150 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
151 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
152 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
153 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
154 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
155 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
156 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
157 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
158 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
159 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
160 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
161 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
162 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
163 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
164 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
165 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
166 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
167 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
168 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
169 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
170 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
171 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
172 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
173 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
174 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
175 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
176 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
177 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
178 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
179 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
181 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
182 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
183 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
184 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
185 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
187 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
190 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
191 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
192 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
205 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
208 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
211 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
212 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
213 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
214 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
215 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
216 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
217 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
218 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
219 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
220 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
221 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
222 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
223 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
224 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
225 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
226 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
227 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
228 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
229 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
232 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
233 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
234 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
235 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
236 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
237 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
238 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
239 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
240 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
241 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
242 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
243 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
244 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
245 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
246 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
249 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
250 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
251 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
252 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
253 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
254 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
255 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
256 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
257 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
258 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
259 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
260 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
261 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
262 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
263 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
266 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
267 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
270 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
273 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
274 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
275 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
276 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
288 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
289 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
290 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
291 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
292 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
294 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
295 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
296 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
297 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
298 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
299 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
300 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
301 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
302 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
303 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
304 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
305 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
306 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
307 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
308 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
309 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
310 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
311 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
312 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
313 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
314 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
315 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
316 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
317 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
318 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
319 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
320 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
321 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
322 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
323 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
324 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
325 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
326 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
327 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
328 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
329 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
330 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
331 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
332 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
333 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
334 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
335 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
336 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
337 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
338 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
339 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.58
Metatranscriptomes 0.22
Isolates 31.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 29.2
Nodule 15.71
Rhizoplane 2.21
Rhizosphere 37.39
Stem 0
Stem Tuber 0
Unclassified 15.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1000104 3300002739 Bacteria 19745
2 JGI25152J39213_1008219 3300002773 Bacteria 2609
3 JGI25151J46595_10003074 3300003187 Bacteria 9411
4 JGI25151J46595_10006715 3300003187 Bacteria 5736
5 JGI25151J46595_10007485 3300003187 Bacteria 5342
6 JGI25151J46595_10011459 3300003187 Bacteria 4074
7 JGI25165J46597_1007904 3300003214 Bacteria 1719
8 JGI25153J46596_10002046 3300003215 Bacteria 11886
9 rootH1_10004415 3300003316 Bacteria 7698
10 rootH2_10136158 3300003320 Bacteria 7010
11 rootH2_10269522 3300003320 Bacteria 1128
12 rootL2_10062219 3300003322 Bacteria 19772
13 rootH1_10237323 3300003323 Bacteria 4508
14 JGI25160J50197_1000068 3300003354 Bacteria 112790
15 JGI25160J50197_1000097 3300003354 Bacteria 87619
16 JGI25160J50197_1000879 3300003354 Bacteria 15801
17 JGI25160J50197_1006055 3300003354 Bacteria 4944
18 JGI25161J50226_1000048 3300003374 Bacteria 112790
19 JGI25161J50226_1000118 3300003374 Bacteria 58587
20 JGI25161J50226_1001249 3300003374 Bacteria 8215
21 JGI25161J50226_1004441 3300003374 Bacteria 2935
22 Ga0055539_1012861 3300003752 Bacteria 1027
23 Ga0055526_1000756 3300003771 Bacteria 24169
24 Ga0055526_1002180 3300003771 Bacteria 13429
25 Ga0055524_1003470 3300003775 Bacteria 7645
26 Ga0055524_1030325 3300003775 Bacteria 1579
27 Ga0055524_1068908 3300003775 Bacteria 691
28 Ga0055536_1051327 3300003781 Bacteria 904
29 Ga0055528_1000801 3300003790 Bacteria 21717
30 Ga0055528_1002403 3300003790 Bacteria 10073
31 Ga0055528_1024413 3300003790 Bacteria 1811
32 Ga0055528_1073429 3300003790 Bacteria 614
33 Ga0055540_1062006 3300003792 Bacteria 746
34 Ga0055531_10023680 3300003794 Bacteria 2292
35 Ga0055543_1000046 3300004625 Bacteria 113628
36 Ga0055543_1000304 3300004625 Bacteria 34441
37 Ga0055543_1000918 3300004625 Bacteria 13728
38 Ga0065165_1000175 3300005262 Bacteria 113628
39 Ga0065165_1000427 3300005262 Bacteria 66083
40 Ga0065165_1004321 3300005262 Bacteria 8934
41 Ga0070658_10758957 3300005327 Bacteria 842
42 Ga0070682_100636365 3300005337 Bacteria 847
43 Ga0070667_100038378 3300005367 Bacteria 4015
44 Ga0070665_100711142 3300005548 Bacteria 1018
45 Ga0068855_100251083 3300005563 Bacteria 1973
46 Ga0068854_100110331 3300005578 Bacteria 2074
47 Ga0068856_101986632 3300005614 Bacteria 592
48 Ga0068852_100698329 3300005616 Bacteria 1024
49 Ga0068862_100771254 3300005844 Bacteria 937
50 Ga0075365_10002482 3300006038 Bacteria 9065
51 Ga0075368_10007782 3300006042 Bacteria 3796
52 Ga0075363_100447778 3300006048 Bacteria 762
53 Ga0075362_10000537 3300006177 Bacteria 11051
54 Ga0075367_10003052 3300006178 Bacteria 7847
55 Ga0075369_10002735 3300006186 Bacteria 6323
56 Ga0075369_10018164 3300006186 Bacteria 2861
57 Ga0075366_10000974 3300006195 Bacteria 13992
58 Ga0075370_10017234 3300006353 Bacteria 3900
59 Ga0079104_1000014 3300006946 Bacteria 337362
60 Ga0105244_10268159 3300009036 Bacteria 793
61 Ga0105250_10021463 3300009092 Bacteria 2606
62 Ga0105240_10000201 3300009093 Bacteria 121112
63 Ga0105243_11785876 3300009148 Bacteria 646
64 Ga0105248_10424241 3300009177 Bacteria 1498
65 Ga0105237_10002064 3300009545 Bacteria 25480
66 Ga0105239_10006222 3300010375 Bacteria 13891
67 Ga0157322_1000680 3300012490 Bacteria 1401
68 Ga0171463_1004 3300013249 Bacteria 437207
69 Ga0183363_1024 3300015690 Bacteria 54122
70 Ga0209436_100198 3300025208 Bacteria 27841
71 Ga0209436_103168 3300025208 Bacteria 4500
72 Ga0207425_1002279 3300025245 Bacteria 6903
73 Ga0207425_1004352 3300025245 Bacteria 4281
74 Ga0209677_100392 3300025253 Bacteria 26530
75 Ga0209129_1000771 3300025258 Bacteria 20312
76 Ga0209129_1002759 3300025258 Bacteria 8205
77 Ga0209129_1003019 3300025258 Bacteria 7650
78 Ga0209233_1000217 3300025261 Bacteria 106187
79 Ga0209673_1000325 3300025273 Bacteria 87535
80 Ga0209673_1002930 3300025273 Bacteria 10739
81 Ga0209673_1004764 3300025273 Bacteria 7131
82 Ga0209130_1000020 3300025284 Bacteria 379297
83 Ga0209130_1000027 3300025284 Bacteria 327700
84 Ga0209130_1000144 3300025284 Bacteria 114000
85 Ga0209025_1001166 3300025294 Bacteria 37252
86 Ga0209025_1001393 3300025294 Bacteria 32216
87 Ga0209025_1012219 3300025294 Bacteria 5534
88 Ga0209025_1102231 3300025294 Bacteria 904
89 Ga0209564_1000111 3300025295 Bacteria 212210
90 Ga0209564_1000628 3300025295 Bacteria 53862
91 Ga0209564_1001458 3300025295 Bacteria 24030
92 Ga0209564_1024533 3300025295 Bacteria 2058
93 Ga0209758_1002077 3300025297 Bacteria 21309
94 Ga0209758_1002732 3300025297 Bacteria 17369
95 Ga0209758_1003160 3300025297 Bacteria 15476
96 Ga0209758_1003551 3300025297 Bacteria 14026
97 Ga0209758_1031994 3300025297 Bacteria 2146
98 Ga0209050_1002663 3300025298 Bacteria 14592
99 Ga0209256_1000132 3300025299 Bacteria 160806
100 Ga0209256_1000245 3300025299 Bacteria 96643
101 Ga0209256_1001004 3300025299 Bacteria 33460
102 Ga0209256_1009986 3300025299 Bacteria 4061
103 Ga0209256_1022389 3300025299 Bacteria 1913
104 Ga0207426_1000008 3300025302 Bacteria 848730
105 Ga0207426_1000039 3300025302 Bacteria 439937
106 Ga0207426_1000072 3300025302 Bacteria 327700
107 Ga0207426_1000126 3300025302 Bacteria 213341
108 Ga0209051_1000829 3300025303 Bacteria 31990
109 Ga0209051_1001000 3300025303 Bacteria 27153
110 Ga0209051_1031295 3300025303 Bacteria 2050
111 Ga0209051_1033503 3300025303 Bacteria 1941
112 Ga0209257_1007667 3300025304 Bacteria 6454
113 Ga0207695_10000118 3300025913 Bacteria 237085
114 Ga0207671_10000175 3300025914 Bacteria 98920
115 Ga0207681_10212868 3300025923 Bacteria 1491
116 Ga0207694_10263175 3300025924 Bacteria 1413
117 Ga0207709_10601928 3300025935 Bacteria 870
118 Ga0207691_10544748 3300025940 Bacteria 984
119 Ga0207711_10380406 3300025941 Bacteria 1310
120 Ga0207667_10334216 3300025949 Bacteria 1547
121 Ga0207640_10090328 3300025981 Bacteria 2119
122 Ga0207658_10131846 3300025986 Bacteria 2009
123 Ga0209281_1000032 3300027111 Bacteria 401727
124 Ga0268266_10209829 3300028379 Bacteria 1786
125 Ga0307515_10163910 3300028794 Bacteria 2251
126 Ga0307513_10041727 3300031456 Bacteria 5060
127 Ga0307408_100084740 3300031548 Bacteria 2378
128 Ga0307408_100897039 3300031548 Bacteria 811
129 Ga0307412_11013468 3300031911 Bacteria 734
130 Ga0307409_101784423 3300031995 Bacteria 644
131 Ga0307414_10163730 3300032004 Bacteria 1770
132 Ga0307414_10505241 3300032004 Bacteria 1070
133 Ga0439465_0011769 3300041413 Bacteria 2742
134 Ga0439465_0042106 3300041413 Bacteria 1479
135 Ga0451789_1342244 3300041443 Bacteria 1434
136 Ga0451793_0284112 3300041452 Bacteria 1222
137 Ga0451795_0943962 3300041456 Bacteria 946
138 Ga0451837_1558169 3300041494 Bacteria 1649
139 Ga0451839_1488730 3300041496 Bacteria 4876
140 Ga0451845_0050999 3300041501 Bacteria 971
141 Ga0451847_0393698 3300041503 Bacteria 3245
142 Ga0451851_0019019 3300041507 Bacteria 3265
143 Ga0451843_1574520 3300041509 Bacteria 775
144 Ga0451855_1082456 3300041511 Bacteria 692
145 Ga0451853_1556647 3300041512 Bacteria 825
146 Ga0452268_44823 3300041907 Bacteria 1531
147 Ga0439449_0114404 3300042007 Bacteria 1000
148 Ga0439462_0017780 3300042015 Bacteria 1843
149 Ga0439434_0103891 3300042435 Bacteria 917
150 Ga0450918_038015 3300042531 Bacteria 860
151 Ga0466970_0221663 3300044765 Bacteria 1056
152 Ga0495627_109427 3300046453 Bacteria 785
153 Ga0495590_0045087 3300046457 Bacteria 1538
154 Ga0495638_0000397 3300046460 Bacteria 53684
155 Ga0495605_0000412 3300046474 Bacteria 39061
156 Ga0495605_0035736 3300046474 Bacteria 2510
157 Ga0495605_0232292 3300046474 Bacteria 794
158 Ga0495584_0163994 3300046491 Unclassified 1130
159 Ga0495584_0313853 3300046491 Bacteria 796
160 Ga0495584_0400723 3300046491 Bacteria 697
161 Ga0495585_0002484 3300046492 Bacteria 13152
162 Ga0495585_0078298 3300046492 Bacteria 1793
163 Ga0495596_0103336 3300046500 Bacteria 1107
164 Ga0495607_0047113 3300046501 Bacteria 2527
165 Ga0495583_0000721 3300046506 Bacteria 42331
166 Ga0495583_0016672 3300046506 Bacteria 3937
167 Ga0495583_0017222 3300046506 Bacteria 3847
168 Ga0495583_0019782 3300046506 Bacteria 3506
169 Ga0495606_0056788 3300046507 Bacteria 2525
170 Ga0495606_0068165 3300046507 Bacteria 2252
171 Ga0495606_0084723 3300046507 Bacteria 1962
172 Ga0495606_0391331 3300046507 Bacteria 726
173 Ga0495610_0033331 3300046512 Bacteria 2664
174 Ga0495610_0045911 3300046512 Bacteria 2159
175 Ga0495610_0240207 3300046512 Bacteria 722
176 Ga0495616_0106060 3300046513 Bacteria 1311
177 Ga0495620_0029091 3300046515 Bacteria 2561
178 Ga0495620_0194968 3300046515 Bacteria 780
179 Ga0495620_0327557 3300046515 Bacteria 581
180 Ga0495620_0375111 3300046515 Bacteria 539
181 Ga0495631_0002543 3300046518 Bacteria 10230
182 Ga0495631_0024495 3300046518 Bacteria 2787
183 Ga0495632_0019926 3300046519 Bacteria 3644
184 Ga0495632_0021309 3300046519 Bacteria 3494
185 Ga0495643_0012998 3300046522 Bacteria 5001
186 Ga0495643_0019272 3300046522 Bacteria 3950
187 Ga0495643_0020126 3300046522 Bacteria 3854
188 Ga0495643_0148023 3300046522 Bacteria 1165
189 Ga0495654_0113447 3300046530 Bacteria 1234
190 Ga0495654_0188511 3300046530 Bacteria 889
191 Ga0495609_0009359 3300046538 Bacteria 4744
192 Ga0495597_0022590 3300046542 Bacteria 2916
193 Ga0495597_0035782 3300046542 Unclassified 2239
194 Ga0495597_0314563 3300046542 Bacteria 606
195 Ga0495633_0032691 3300046558 Bacteria 2512
196 Ga0495668_0001138 3300046616 Bacteria 27251
197 Ga0495668_0035261 3300046616 Bacteria 2804
198 Ga0495668_0145671 3300046616 Bacteria 1296
199 Ga0495611_0002829 3300046648 Bacteria 7754
200 Ga0495611_0226228 3300046648 Bacteria 870
201 Ga0495625_0004266 3300046660 Bacteria 13606
202 Ga0495625_0013401 3300046660 Bacteria 6589
203 Ga0495625_0030954 3300046660 Bacteria 3985
204 Ga0495625_0077848 3300046660 Bacteria 2316
205 Ga0495625_0344739 3300046660 Bacteria 943
206 Ga0495661_0025545 3300046665 Bacteria 3814
207 Ga0495670_0022112 3300046691 Bacteria 3140
208 Ga0495670_0177638 3300046691 Bacteria 1123
209 Ga0495670_0293184 3300046691 Bacteria 871
210 Ga0495671_0164494 3300046692 Bacteria 1079
211 Ga0495671_0251445 3300046692 Bacteria 853
212 Ga0495589_0211938 3300046794 Bacteria 912
213 Ga0495660_0015697 3300046810 Bacteria 4373
214 Ga0495636_0034138 3300047318 Bacteria 2093
215 Ga0495672_0019847 3300047320 Bacteria 4421
216 Ga0495683_0101836 3300047323 Bacteria 1380
217 Ga0495687_040275 3300047443 Bacteria 2059
218 Ga0495687_041933 3300047443 Bacteria 2004
219 Ga0495673_0050913 3300047469 Bacteria 1816
220 Ga0495681_0025072 3300047470 Bacteria 3126
221 Ga0495686_0021410 3300047472 Bacteria 4294
222 Ga0495686_0196014 3300047472 Bacteria 1161
223 Ga0495686_0318346 3300047472 Bacteria 853
224 Ga0495626_0017258 3300048091 Bacteria 3651
225 Ga0495626_0116960 3300048091 Unclassified 1150
226 Ga0496106_0000601 3300048909 Bacteria 25684
227 Ga0496106_1264029 3300048909 Bacteria 574
228 Ga0496111_0001521 3300048914 Bacteria 13303
229 Ga0496116_0027910 3300048919 Bacteria 4100
230 Ga0496117_0155179 3300048920 Bacteria 1349
231 Ga0496117_0416026 3300048920 Bacteria 674
232 Ga0496118_0037381 3300048921 Bacteria 3907
233 Ga0496119_0228189 3300048922 Bacteria 949
234 Ga0496120_0172135 3300048923 Bacteria 1070
235 Ga0496121_0007830 3300048924 Bacteria 12785
236 Ga0496121_0155129 3300048924 Bacteria 1681
237 Ga0496121_0470191 3300048924 Bacteria 805
238 Ga0496122_0017654 3300048925 Bacteria 6654
239 Ga0496124_0098931 3300048927 Bacteria 2366
240 Ga0496124_0186771 3300048927 Bacteria 1590
241 Ga0496125_0047509 3300048928 Bacteria 3588
242 Ga0496125_0084891 3300048928 Bacteria 2402
243 Ga0495678_022576 3300049459 Bacteria 2749
244 Ga0495678_043931 3300049459 Unclassified 1771
245 Ga0495682_0073830 3300049460 Bacteria 1227
246 Ga0501032_0275221 3300049569 Bacteria 1090
247 Ga0501033_0077637 3300049570 Bacteria 2437
248 Ga0501034_0350403 3300049571 Bacteria 1405
249 Ga0501034_0398898 3300049571 Bacteria 1298
250 Ga0501036_0046486 3300049572 Bacteria 3676
251 Ga0501037_0075909 3300049573 Bacteria 2440
252 Ga0501038_0105591 3300049574 Bacteria 2339
253 Ga0501039_0021771 3300049575 Bacteria 4918
254 Ga0501046_0194453 3300049580 Bacteria 1512
255 Ga0501046_0212670 3300049580 Bacteria 1435
256 Ga0501047_0361769 3300049581 Bacteria 1287
257 Ga0501048_0133534 3300049582 Bacteria 1754
258 Ga0501067_0042355 3300049583 Bacteria 2528
259 Ga0501068_0149787 3300049584 Bacteria 1466
260 Ga0501070_0029603 3300049586 Bacteria 4589
261 Ga0501073_0061557 3300049589 Bacteria 2619
262 Ga0501073_0366225 3300049589 Bacteria 995
263 Ga0501083_0170273 3300049744 Bacteria 1423
264 Ga0501035_0714232 3300049822 Bacteria 807
265 Ga0501044_0975602 3300049823 Bacteria 720
266 nmdc:mga03683_2853_c1 3300050489 Bacteria 5452
267 nmdc:mga03n38_393407_c1 3300050490 Bacteria 762
268 nmdc:mga03n38_8822_c2 3300050490 Bacteria 3305
269 nmdc:mga00v17_53095_c1 3300050491 Bacteria 2469
270 nmdc:mga0yw44_11147_c1 3300050492 Bacteria 4624
271 nmdc:mga0k408_11233_c1 3300050493 Bacteria 4869
272 nmdc:mga06z11_15600_c2 3300050494 Bacteria 2849
273 nmdc:mga06z11_194450_c1 3300050494 Bacteria 1175
274 nmdc:mga0sz30_32478_c1 3300050516 Bacteria 2165
275 nmdc:mga0sz30_6761_c1 3300050516 Bacteria 4277
276 Ga0500578_0068727 3300053086 Bacteria 2258
277 Ga0500578_0270110 3300053086 Bacteria 1017
278 Ga0500644_0023973 3300053088 Bacteria 1860
279 Ga0500646_0174898 3300053090 Bacteria 724
280 Ga0500583_0265751 3300053092 Bacteria 845
281 Ga0500651_0083288 3300053093 Bacteria 1979
282 Ga0500566_0218612 3300053094 Bacteria 949
283 Ga0500650_0326497 3300053098 Bacteria 675
284 Ga0500556_0293455 3300053104 Bacteria 636
285 Ga0500557_001411 3300053105 Bacteria 3896
286 Ga0500569_004027 3300053109 Bacteria 3056
287 Ga0500569_020532 3300053109 Bacteria 1735
288 Ga0500594_0001742 3300053118 Bacteria 4735
289 Ga0500618_000041 3300053125 Bacteria 111404
290 Ga0500618_002312 3300053125 Bacteria 7312
291 Ga0500642_0211879 3300053130 Bacteria 899
292 Ga0500652_060578 3300053131 Bacteria 1558
293 Ga0500658_0002671 3300053134 Bacteria 6848
294 Ga0500658_0010699 3300053134 Bacteria 3383
295 Ga0500658_0053669 3300053134 Bacteria 1654
296 Ga0500568_0000405 3300053139 Bacteria 32864
297 Ga0500568_0005388 3300053139 Bacteria 6618
298 Ga0500577_0026077 3300053142 Bacteria 1986
299 Ga0500588_0350119 3300053146 Bacteria 561
300 Ga0500604_0054467 3300053151 Bacteria 1242
301 Ga0500604_0055187 3300053151 Bacteria 1235
302 Ga0500616_0001238 3300053153 Bacteria 25631
303 Ga0500616_0122810 3300053153 Bacteria 1237
304 Ga0500620_161560 3300053155 Bacteria 777
305 Ga0500622_0000210 3300053156 Bacteria 61827
306 Ga0500622_0315868 3300053156 Bacteria 660
307 Ga0500627_0084194 3300053158 Bacteria 1419
308 Ga0500633_0007723 3300053160 Bacteria 2728
309 Ga0500633_0092849 3300053160 Bacteria 1104
310 Ga0500599_015679 3300053736 Bacteria 1042
311 Ga0501082_0031180 3300060353 Bacteria 4595

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046515 Ga0495620_0375111 Ga0495620_0375111_56_520 152
2 3300046453 Ga0495627_109427 Ga0495627_109427_16_480 153
3 3300046460 Ga0495638_0000397 Ga0495638_0000397_38636_39100 153
4 3300046474 Ga0495605_0000412 Ga0495605_0000412_5616_6080 153
5 3300046491 Ga0495584_0400723 Ga0495584_0400723_93_557 153
6 3300046492 Ga0495585_0002484 Ga0495585_0002484_9382_9846 153
7 3300046506 Ga0495583_0017222 Ga0495583_0017222_959_1423 153
8 3300046507 Ga0495606_0391331 Ga0495606_0391331_235_699 153
9 3300046515 Ga0495620_0194968 Ga0495620_0194968_291_755 153
10 3300046518 Ga0495631_0002543 Ga0495631_0002543_6392_6856 153
11 3300046519 Ga0495632_0021309 Ga0495632_0021309_309_773 153
12 3300046522 Ga0495643_0148023 Ga0495643_0148023_635_1099 153
13 3300046530 Ga0495654_0113447 Ga0495654_0113447_738_1202 153
14 3300046538 Ga0495609_0009359 Ga0495609_0009359_3196_3660 153
15 3300046542 Ga0495597_0314563 Ga0495597_0314563_119_583 153
16 3300046616 Ga0495668_0001138 Ga0495668_0001138_12356_12820 153
17 3300046648 Ga0495611_0002829 Ga0495611_0002829_3873_4337 153
18 3300046660 Ga0495625_0004266 Ga0495625_0004266_8612_9076 153
19 3300046691 Ga0495670_0022112 Ga0495670_0022112_1945_2409 153
20 3300046692 Ga0495671_0164494 Ga0495671_0164494_74_538 153
21 3300047320 Ga0495672_0019847 Ga0495672_0019847_850_1314 153
22 3300048091 Ga0495626_0017258 Ga0495626_0017258_1651_2115 153
23 3300049459 Ga0495678_022576 Ga0495678_022576_910_1374 153
24 3300049460 Ga0495682_0073830 Ga0495682_0073830_36_500 153
25 3300050489 nmdc:mga03683_2853_c1 nmdc:mga03683_2853_c1_4941_5405 153
26 3300053086 Ga0500578_0068727 Ga0500578_0068727_243_707 153
27 3300053092 Ga0500583_0265751 Ga0500583_0265751_297_761 153
28 3300053098 Ga0500650_0326497 Ga0500650_0326497_116_580 153
29 3300053104 Ga0500556_0293455 Ga0500556_0293455_111_575 153
30 3300053105 Ga0500557_001411 Ga0500557_001411_318_782 153
31 3300053109 Ga0500569_004027 Ga0500569_004027_505_969 153
32 3300053118 Ga0500594_0001742 Ga0500594_0001742_3104_3568 153
33 3300053130 Ga0500642_0211879 Ga0500642_0211879_293_757 153
34 3300053131 Ga0500652_060578 Ga0500652_060578_27_491 153
35 3300053134 Ga0500658_0053669 Ga0500658_0053669_914_1378 153
36 3300053139 Ga0500568_0000405 Ga0500568_0000405_3295_3759 153
37 3300053146 Ga0500588_0350119 Ga0500588_0350119_73_537 153
38 3300053153 Ga0500616_0001238 Ga0500616_0001238_12960_13424 153
39 3300053160 Ga0500633_0092849 Ga0500633_0092849_210_674 153
40 3300053736 Ga0500599_015679 Ga0500599_015679_75_539 153
41 3300048927 Ga0496124_0098931 Ga0496124_0098931_1866_2336 155
42 iso_pu_bacteria 2989771324 2989776367 155
43 3300050494 nmdc:mga06z11_194450_c1 nmdc:mga06z11_194450_c1_684_1160 157
44 3300049581 Ga0501047_0361769 Ga0501047_0361769_581_1057 158
45 iso_pu_bacteria 2838686498 2838692071 158
46 iso_pu_bacteria 2838729681 2838732783 158
47 iso_pu_bacteria 2838742623 2838749755 158
48 iso_pu_bacteria 2841851746 2841855881 158
49 iso_pu_bacteria 2842156927 2842157127 158
50 iso_pu_bacteria 2842163707 2842167787 158
51 iso_pu_bacteria 2842180545 2842181289 158
52 iso_pu_bacteria 2842217011 2842217546 158
53 iso_pu_bacteria 2842229732 2842230660 158
54 iso_pu_bacteria 2842243621 2842245240 158
55 iso_pu_bacteria 2842257432 2842259053 158
56 iso_pu_bacteria 2842271015 2842276277 158
57 iso_pu_bacteria 2842304105 2842304580 158
58 iso_pu_bacteria 2857516855 2857520003 158
59 iso_pu_bacteria 639633055 639648828 158
60 3300025935 Ga0207709_10601928 Ga0207709_106019282 159
61 3300053125 Ga0500618_002312 Ga0500618_002312_3825_4322 159
62 iso_pu_bacteria 2599185236 2599718133 160
63 iso_pu_bacteria 2821123053 2821130856 160
64 iso_pu_bacteria 2838680041 2838681944 160
65 iso_pu_bacteria 2838707686 2838710245 160
66 iso_pu_bacteria 2857531043 2857537691 160
67 iso_pu_bacteria 2643221618 2644109951 161
68 iso_pu_bacteria 2643221626 2644150227 161
69 iso_pu_bacteria 2643221655 2644312831 161
70 iso_pu_bacteria 2643221659 2644336377 161
71 iso_pu_bacteria 2643221698 2644546025 161
72 iso_pu_bacteria 2643221712 2644618561 161
73 iso_pu_bacteria 2844163670 2844164142 161
74 iso_pu_bacteria 2941499720 2941501144 161
75 3300025297 Ga0209758_1003160 Ga0209758_10031603 162
76 3300031995 Ga0307409_101784423 Ga0307409_1017844231 162
77 3300041501 Ga0451845_0050999 Ga0451845_0050999_304_795 162
78 3300041509 Ga0451843_1574520 Ga0451843_1574520_115_606 162
79 3300041511 Ga0451855_1082456 Ga0451855_1082456_170_661 162
80 3300041512 Ga0451853_1556647 Ga0451853_1556647_208_699 162
81 3300046474 Ga0495605_0232292 Ga0495605_0232292_17_523 162
82 3300046794 Ga0495589_0211938 Ga0495589_0211938_11_502 162
83 iso_pu_bacteria 2599185352 2600193560 162
84 iso_pu_bacteria 2643221557 2643808252 162
85 iso_pu_bacteria 2643221610 2644068558 162
86 iso_pu_bacteria 2643221668 2644379686 162
87 iso_pu_bacteria 2643221675 2644419627 162
88 iso_pu_bacteria 2643221680 2644452984 162
89 iso_pu_bacteria 2643221723 2644677278 162
90 iso_pu_bacteria 2643221726 2644688987 162
91 iso_pu_bacteria 2802429633 2806043463 162
92 iso_pu_bacteria 2920822456 2920825751 162
93 3300009036 Ga0105244_10268159 Ga0105244_102681592 163
94 3300047472 Ga0495686_0196014 Ga0495686_0196014_98_589 163
95 3300048909 Ga0496106_0000601 Ga0496106_0000601_11067_11558 163
96 3300048909 Ga0496106_1264029 Ga0496106_1264029_56_559 163
97 3300049570 Ga0501033_0077637 Ga0501033_0077637_1216_1716 163
98 3300049586 Ga0501070_0029603 Ga0501070_0029603_2104_2604 163
99 3300049744 Ga0501083_0170273 Ga0501083_0170273_912_1403 163
100 3300053088 Ga0500644_0023973 Ga0500644_0023973_208_699 163
101 3300053093 Ga0500651_0083288 Ga0500651_0083288_463_954 163
102 3300053094 Ga0500566_0218612 Ga0500566_0218612_345_836 163
103 3300053134 Ga0500658_0010699 Ga0500658_0010699_1655_2146 163
104 3300053139 Ga0500568_0005388 Ga0500568_0005388_3402_3893 163
105 3300053151 Ga0500604_0054467 Ga0500604_0054467_728_1219 163
106 3300053155 Ga0500620_161560 Ga0500620_161560_12_503 163
107 iso_pu_bacteria 2510917022 2511134345 163
108 iso_pu_bacteria 2582581299 2585229404 163
109 iso_pu_bacteria 2582581308 2585280881 163
110 iso_pu_bacteria 2585427527 2585530585 163
111 iso_pu_bacteria 2585427530 2585554763 163
112 iso_pu_bacteria 2585427531 2585561934 163
113 iso_pu_bacteria 2585427609 2585907673 163
114 iso_pu_bacteria 2585428125 2587983094 163
115 iso_pu_bacteria 2615840626 2616310736 163
116 iso_pu_bacteria 2818991453 2819641113 163
117 iso_pu_bacteria 8005645114 8005650373 163
118 3300006946 Ga0079104_1000014 Ga0079104_1000014218 164
119 3300027111 Ga0209281_1000032 Ga0209281_1000032218 164
120 3300041456 Ga0451795_0943962 Ga0451795_0943962_191_700 164
121 3300046507 Ga0495606_0056788 Ga0495606_0056788_1022_1531 164
122 3300048914 Ga0496111_0001521 Ga0496111_0001521_7604_8101 164
123 3300053125 Ga0500618_000041 Ga0500618_000041_2649_3146 164
124 iso_pu_bacteria 2513237351 2514592269 164
125 iso_pu_bacteria 2643221634 2644194951 164
126 iso_pu_bacteria 2643221643 2644238760 164
127 iso_pu_bacteria 2894652903 2894654710 164
128 iso_pu_bacteria 8054558443 8054559145 164
129 3300003214 JGI25165J46597_1007904 JGI25165J46597_10079042 165
130 3300003316 rootH1_10004415 rootH1_100044153 165
131 3300003320 rootH2_10136158 rootH2_101361583 165
132 3300003322 rootL2_10062219 rootL2_1006221921 165
133 3300003323 rootH1_10237323 rootH1_102373233 165
134 3300003752 Ga0055539_1012861 Ga0055539_10128612 165
135 3300005327 Ga0070658_10758957 Ga0070658_107589572 165
136 3300005367 Ga0070667_100038378 Ga0070667_1000383785 165
137 3300005563 Ga0068855_100251083 Ga0068855_1002510831 165
138 3300005578 Ga0068854_100110331 Ga0068854_1001103313 165
139 3300005614 Ga0068856_101986632 Ga0068856_1019866321 165
140 3300005616 Ga0068852_100698329 Ga0068852_1006983292 165
141 3300006353 Ga0075370_10017234 Ga0075370_100172342 165
142 3300009093 Ga0105240_10000201 Ga0105240_1000020159 165
143 3300009148 Ga0105243_11785876 Ga0105243_117858761 165
144 3300009177 Ga0105248_10424241 Ga0105248_104242412 165
145 3300009545 Ga0105237_10002064 Ga0105237_100020649 165
146 3300010375 Ga0105239_10006222 Ga0105239_100062229 165
147 3300025253 Ga0209677_100392 Ga0209677_10039211 165
148 3300025261 Ga0209233_1000217 Ga0209233_100021722 165
149 3300025913 Ga0207695_10000118 Ga0207695_10000118177 165
150 3300025914 Ga0207671_10000175 Ga0207671_1000017523 165
151 3300025924 Ga0207694_10263175 Ga0207694_102631752 165
152 3300025940 Ga0207691_10544748 Ga0207691_105447482 165
153 3300025941 Ga0207711_10380406 Ga0207711_103804061 165
154 3300025949 Ga0207667_10334216 Ga0207667_103342162 165
155 3300025981 Ga0207640_10090328 Ga0207640_100903282 165
156 3300025986 Ga0207658_10131846 Ga0207658_101318462 165
157 3300046506 Ga0495583_0000721 Ga0495583_0000721_28655_29164 165
158 3300046515 Ga0495620_0327557 Ga0495620_0327557_32_544 165
159 3300046660 Ga0495625_0344739 Ga0495625_0344739_90_599 165
160 3300047469 Ga0495673_0050913 Ga0495673_0050913_1250_1759 165
161 iso_pu_bacteria 2582581867 2585404682 165
162 iso_pu_bacteria 2585427590 2585823767 165
163 iso_pu_bacteria 2923556063 2923561226 165
164 3300003187 JGI25151J46595_10006715 JGI25151J46595_100067154 166
165 3300003354 JGI25160J50197_1000097 JGI25160J50197_100009712 166
166 3300003374 JGI25161J50226_1001249 JGI25161J50226_10012495 166
167 3300003771 Ga0055526_1000756 Ga0055526_10007563 166
168 3300003781 Ga0055536_1051327 Ga0055536_10513272 166
169 3300003794 Ga0055531_10023680 Ga0055531_100236802 166
170 3300004625 Ga0055543_1000918 Ga0055543_100091813 166
171 3300005262 Ga0065165_1000427 Ga0065165_100042746 166
172 3300013249 Ga0171463_1004 Ga0171463_100418 166
173 3300015690 Ga0183363_1024 Ga0183363_102418 166
174 3300025284 Ga0209130_1000027 Ga0209130_100002712 166
175 3300025294 Ga0209025_1001393 Ga0209025_100139319 166
176 3300025294 Ga0209025_1102231 Ga0209025_11022312 166
177 3300025295 Ga0209564_1000111 Ga0209564_100011114 166
178 3300025295 Ga0209564_1024533 Ga0209564_10245333 166
179 3300025298 Ga0209050_1002663 Ga0209050_100266312 166
180 3300025299 Ga0209256_1000132 Ga0209256_1000132142 166
181 3300025299 Ga0209256_1001004 Ga0209256_100100419 166
182 3300025302 Ga0207426_1000072 Ga0207426_1000072303 166
183 3300025303 Ga0209051_1033503 Ga0209051_10335032 166
184 3300025304 Ga0209257_1007667 Ga0209257_10076672 166
185 3300046491 Ga0495584_0163994 Ga0495584_0163994_41_556 166
186 3300046506 Ga0495583_0016672 Ga0495583_0016672_2489_3004 166
187 3300046515 Ga0495620_0029091 Ga0495620_0029091_1211_1726 166
188 3300046522 Ga0495643_0019272 Ga0495643_0019272_2491_3006 166
189 3300046542 Ga0495597_0035782 Ga0495597_0035782_894_1409 166
190 3300046660 Ga0495625_0030954 Ga0495625_0030954_974_1489 166
191 3300047443 Ga0495687_040275 Ga0495687_040275_951_1466 166
192 3300048091 Ga0495626_0116960 Ga0495626_0116960_194_709 166
193 3300049459 Ga0495678_043931 Ga0495678_043931_374_889 166
194 iso_pu_bacteria 2510917030 2511199104 166
195 iso_pu_bacteria 2582581298 2585222933 166
196 iso_pu_bacteria 2585427529 2585545516 166
197 iso_pu_bacteria 2919100787 2919107579 166
198 iso_pu_bacteria 3005409236 3005412275 166
199 iso_pu_bacteria 3005445848 3005448525 166
200 3300003790 Ga0055528_1024413 Ga0055528_10244132 167
201 3300025273 Ga0209673_1004764 Ga0209673_10047642 167
202 3300031548 Ga0307408_100084740 Ga0307408_1000847403 167
203 3300031911 Ga0307412_11013468 Ga0307412_110134682 167
204 3300049572 Ga0501036_0046486 Ga0501036_0046486_2827_3345 167
205 3300049574 Ga0501038_0105591 Ga0501038_0105591_1427_1945 167
206 3300049582 Ga0501048_0133534 Ga0501048_0133534_640_1158 167
207 3300049584 Ga0501068_0149787 Ga0501068_0149787_247_765 167
208 iso_pu_bacteria 2510461069 2510842742 167
209 iso_pu_bacteria 2513237144 2513907647 167
210 iso_pu_bacteria 2513237146 2513925589 167
211 iso_pu_bacteria 2599185170 2599418712 167
212 iso_pu_bacteria 2838035591 2838037597 167
213 iso_pu_bacteria 2838661181 2838662605 167
214 iso_pu_bacteria 2933016740 2933022005 167
215 3300028794 Ga0307515_10163910 Ga0307515_101639102 168
216 3300032004 Ga0307414_10163730 Ga0307414_101637302 168
217 3300032004 Ga0307414_10505241 Ga0307414_105052412 168
218 3300042007 Ga0439449_0114404 Ga0439449_0114404_235_756 168
219 3300042015 Ga0439462_0017780 Ga0439462_0017780_42_563 168
220 3300044765 Ga0466970_0221663 Ga0466970_0221663_290_814 168
221 3300049571 Ga0501034_0398898 Ga0501034_0398898_426_1004 168
222 3300049573 Ga0501037_0075909 Ga0501037_0075909_511_1089 168
223 3300049575 Ga0501039_0021771 Ga0501039_0021771_2656_3234 168
224 3300049580 Ga0501046_0212670 Ga0501046_0212670_310_888 168
225 3300049589 Ga0501073_0061557 Ga0501073_0061557_492_1070 168
226 3300049822 Ga0501035_0714232 Ga0501035_0714232_38_616 168
227 3300053151 Ga0500604_0055187 Ga0500604_0055187_256_780 168
228 iso_pu_bacteria 2643221607 2644046572 168
229 iso_pu_bacteria 2643221636 2644202278 168
230 iso_pu_bacteria 2643221686 2644479361 168
231 iso_pu_bacteria 2643221688 2644494027 168
232 iso_pu_bacteria 2765235802 2765466022 168
233 iso_pu_bacteria 2767802442 2770197772 168
234 iso_pu_bacteria 2775506902 2776271810 168
235 iso_pu_bacteria 2775506904 2776279675 168
236 iso_pu_bacteria 2839993093 2839995204 168
237 iso_pu_bacteria 2896384573 2896385856 168
238 iso_pu_bacteria 2904578770 2904583296 168
239 iso_pu_bacteria 2919119836 2919121084 168
240 iso_pu_bacteria 2920760137 2920761787 168
241 iso_pu_bacteria 2954011201 2954012271 168
242 iso_pu_bacteria 2996310559 2996315110 168
243 iso_pu_bacteria 3003930520 3003934313 168
244 3300003187 JGI25151J46595_10003074 JGI25151J46595_1000307410 169
245 3300003187 JGI25151J46595_10007485 JGI25151J46595_100074855 169
246 3300003354 JGI25160J50197_1000068 JGI25160J50197_100006820 169
247 3300003354 JGI25160J50197_1000879 JGI25160J50197_100087914 169
248 3300003374 JGI25161J50226_1000048 JGI25161J50226_100004820 169
249 3300003374 JGI25161J50226_1004441 JGI25161J50226_10044412 169
250 3300003775 Ga0055524_1003470 Ga0055524_10034706 169
251 3300003775 Ga0055524_1068908 Ga0055524_10689081 169
252 3300003790 Ga0055528_1000801 Ga0055528_100080116 169
253 3300003792 Ga0055540_1062006 Ga0055540_10620061 169
254 3300004625 Ga0055543_1000046 Ga0055543_100004685 169
255 3300005262 Ga0065165_1000175 Ga0065165_100017520 169
256 3300006038 Ga0075365_10002482 Ga0075365_100024826 169
257 3300006042 Ga0075368_10007782 Ga0075368_100077823 169
258 3300006048 Ga0075363_100447778 Ga0075363_1004477781 169
259 3300006177 Ga0075362_10000537 Ga0075362_100005376 169
260 3300006178 Ga0075367_10003052 Ga0075367_100030522 169
261 3300006186 Ga0075369_10002735 Ga0075369_100027357 169
262 3300006195 Ga0075366_10000974 Ga0075366_100009746 169
263 3300012490 Ga0157322_1000680 Ga0157322_10006802 169
264 3300025208 Ga0209436_103168 Ga0209436_1031683 169
265 3300025245 Ga0207425_1004352 Ga0207425_10043522 169
266 3300025258 Ga0209129_1000771 Ga0209129_10007718 169
267 3300025273 Ga0209673_1000325 Ga0209673_100032585 169
268 3300025284 Ga0209130_1000144 Ga0209130_100014422 169
269 3300025294 Ga0209025_1001166 Ga0209025_100116625 169
270 3300025295 Ga0209564_1001458 Ga0209564_100145816 169
271 3300025297 Ga0209758_1002732 Ga0209758_10027327 169
272 3300025297 Ga0209758_1031994 Ga0209758_10319942 169
273 3300025299 Ga0209256_1000245 Ga0209256_100024588 169
274 3300025299 Ga0209256_1022389 Ga0209256_10223891 169
275 3300025302 Ga0207426_1000039 Ga0207426_1000039413 169
276 3300025302 Ga0207426_1000126 Ga0207426_100012621 169
277 3300025303 Ga0209051_1001000 Ga0209051_100100026 169
278 3300025303 Ga0209051_1031295 Ga0209051_10312953 169
279 3300031456 Ga0307513_10041727 Ga0307513_100417272 169
280 3300031548 Ga0307408_100897039 Ga0307408_1008970392 169
281 3300041413 Ga0439465_0011769 Ga0439465_0011769_629_1153 169
282 3300041443 Ga0451789_1342244 Ga0451789_1342244_676_1200 169
283 3300041452 Ga0451793_0284112 Ga0451793_0284112_192_716 169
284 3300041494 Ga0451837_1558169 Ga0451837_1558169_80_616 169
285 3300041496 Ga0451839_1488730 Ga0451839_1488730_2755_3279 169
286 3300041503 Ga0451847_0393698 Ga0451847_0393698_590_1114 169
287 3300041507 Ga0451851_0019019 Ga0451851_0019019_590_1114 169
288 3300041907 Ga0452268_44823 Ga0452268_44823_667_1191 169
289 3300042435 Ga0439434_0103891 Ga0439434_0103891_41_565 169
290 3300042531 Ga0450918_038015 Ga0450918_038015_323_847 169
291 3300046474 Ga0495605_0035736 Ga0495605_0035736_833_1357 169
292 3300046491 Ga0495584_0313853 Ga0495584_0313853_31_555 169
293 3300046492 Ga0495585_0078298 Ga0495585_0078298_1143_1667 169
294 3300046500 Ga0495596_0103336 Ga0495596_0103336_101_658 169
295 3300046501 Ga0495607_0047113 Ga0495607_0047113_37_594 169
296 3300046507 Ga0495606_0068165 Ga0495606_0068165_508_1029 169
297 3300046507 Ga0495606_0084723 Ga0495606_0084723_164_721 169
298 3300046512 Ga0495610_0033331 Ga0495610_0033331_148_705 169
299 3300046512 Ga0495610_0240207 Ga0495610_0240207_40_564 169
300 3300046513 Ga0495616_0106060 Ga0495616_0106060_709_1233 169
301 3300046518 Ga0495631_0024495 Ga0495631_0024495_884_1441 169
302 3300046519 Ga0495632_0019926 Ga0495632_0019926_1694_2251 169
303 3300046522 Ga0495643_0020126 Ga0495643_0020126_2640_3197 169
304 3300046530 Ga0495654_0188511 Ga0495654_0188511_210_767 169
305 3300046542 Ga0495597_0022590 Ga0495597_0022590_1043_1600 169
306 3300046558 Ga0495633_0032691 Ga0495633_0032691_1848_2372 169
307 3300046616 Ga0495668_0035261 Ga0495668_0035261_1219_1776 169
308 3300046616 Ga0495668_0145671 Ga0495668_0145671_659_1183 169
309 3300046648 Ga0495611_0226228 Ga0495611_0226228_197_721 169
310 3300046660 Ga0495625_0013401 Ga0495625_0013401_153_677 169
311 3300046660 Ga0495625_0077848 Ga0495625_0077848_758_1285 169
312 3300046665 Ga0495661_0025545 Ga0495661_0025545_2703_3227 169
313 3300046691 Ga0495670_0177638 Ga0495670_0177638_240_764 169
314 3300046691 Ga0495670_0293184 Ga0495670_0293184_162_704 169
315 3300046692 Ga0495671_0251445 Ga0495671_0251445_26_583 169
316 3300046810 Ga0495660_0015697 Ga0495660_0015697_1922_2479 169
317 3300047318 Ga0495636_0034138 Ga0495636_0034138_65_622 169
318 3300047323 Ga0495683_0101836 Ga0495683_0101836_198_755 169
319 3300047443 Ga0495687_041933 Ga0495687_041933_684_1241 169
320 3300047470 Ga0495681_0025072 Ga0495681_0025072_2375_2899 169
321 3300047472 Ga0495686_0021410 Ga0495686_0021410_1811_2368 169
322 3300047472 Ga0495686_0318346 Ga0495686_0318346_182_706 169
323 3300048920 Ga0496117_0416026 Ga0496117_0416026_45_602 169
324 3300048922 Ga0496119_0228189 Ga0496119_0228189_395_916 169
325 3300048923 Ga0496120_0172135 Ga0496120_0172135_518_1039 169
326 3300048924 Ga0496121_0155129 Ga0496121_0155129_1072_1629 169
327 3300048924 Ga0496121_0470191 Ga0496121_0470191_130_651 169
328 3300048928 Ga0496125_0084891 Ga0496125_0084891_688_1209 169
329 3300050490 nmdc:mga03n38_393407_c1 nmdc:mga03n38_393407_c1_76_633 169
330 3300050490 nmdc:mga03n38_8822_c2 nmdc:mga03n38_8822_c2_209_733 169
331 3300050491 nmdc:mga00v17_53095_c1 nmdc:mga00v17_53095_c1_1497_2021 169
332 3300050492 nmdc:mga0yw44_11147_c1 nmdc:mga0yw44_11147_c1_3179_3703 169
333 3300050493 nmdc:mga0k408_11233_c1 nmdc:mga0k408_11233_c1_2363_2887 169
334 3300050494 nmdc:mga06z11_15600_c2 nmdc:mga06z11_15600_c2_1702_2226 169
335 3300050516 nmdc:mga0sz30_6761_c1 nmdc:mga0sz30_6761_c1_2655_3179 169
336 3300053086 Ga0500578_0270110 Ga0500578_0270110_189_746 169
337 3300053090 Ga0500646_0174898 Ga0500646_0174898_152_676 169
338 3300053109 Ga0500569_020532 Ga0500569_020532_913_1437 169
339 3300053134 Ga0500658_0002671 Ga0500658_0002671_4374_4931 169
340 3300053142 Ga0500577_0026077 Ga0500577_0026077_1361_1918 169
341 3300053153 Ga0500616_0122810 Ga0500616_0122810_273_830 169
342 3300053156 Ga0500622_0315868 Ga0500622_0315868_30_572 169
343 3300053158 Ga0500627_0084194 Ga0500627_0084194_317_844 169
344 iso_pu_bacteria 2510065019 2510133598 169
345 iso_pu_bacteria 2510461076 2510895000 169
346 iso_pu_bacteria 2513237084 2513573886 169
347 iso_pu_bacteria 2513237085 2513577569 169
348 iso_pu_bacteria 2513237093 2513629785 169
349 iso_pu_bacteria 2513237103 2513708425 169
350 iso_pu_bacteria 2513237162 2514022441 169
351 iso_pu_bacteria 2515075009 2515112587 169
352 iso_pu_bacteria 2515154114 2515640081 169
353 iso_pu_bacteria 2515154116 2515655720 169
354 iso_pu_bacteria 2515154134 2515740173 169
355 iso_pu_bacteria 2516653077 2517036322 169
356 iso_pu_bacteria 2516653085 2517076684 169
357 iso_pu_bacteria 2582581306 2585270485 169
358 iso_pu_bacteria 2582581865 2585386323 169
359 iso_pu_bacteria 2582581866 2585395852 169
360 iso_pu_bacteria 2585427526 2585527079 169
361 iso_pu_bacteria 2585427528 2585537829 169
362 iso_pu_bacteria 2585427593 2585835779 169
363 iso_pu_bacteria 2724679232 2725950566 169
364 iso_pu_bacteria 2738541333 2739032488 169
365 iso_pu_bacteria 2765235942 2766066837 169
366 iso_pu_bacteria 2791355266 2793360682 169
367 iso_pu_bacteria 2802429634 2806050603 169
368 iso_pu_bacteria 2802429635 2806057420 169
369 iso_pu_bacteria 2802429636 2806064801 169
370 iso_pu_bacteria 2802429637 2806072068 169
371 iso_pu_bacteria 2838694306 2838696515 169
372 iso_pu_bacteria 2840764183 2840769853 169
373 iso_pu_bacteria 2842077413 2842078419 169
374 iso_pu_bacteria 2842110456 2842114108 169
375 iso_pu_bacteria 2842118031 2842119072 169
376 iso_pu_bacteria 2842237096 2842239657 169
377 iso_pu_bacteria 2842291075 2842292081 169
378 iso_pu_bacteria 2842370503 2842372510 169
379 iso_pu_bacteria 2842377471 2842378477 169
380 iso_pu_bacteria 2842384541 2842385582 169
381 iso_pu_bacteria 2844454524 2844458874 169
382 iso_pu_bacteria 2933570622 2933571852 169
383 iso_pu_bacteria 2933586486 2933590204 169
384 iso_pu_bacteria 2935894831 2935897629 169
385 iso_pu_bacteria 2935901341 2935905396 169
386 iso_pu_bacteria 2936367885 2936372426 169
387 iso_pu_bacteria 2936375103 2936376584 169
388 iso_pu_bacteria 8005307578 8005312454 169
389 iso_pu_bacteria 8005376324 8005379499 169
390 iso_pu_bacteria 8005460587 8005463262 169
391 iso_pu_bacteria 8005556819 8005557412 169
392 iso_pu_bacteria 8005563573 8005568591 169
393 iso_pu_bacteria 8005570704 8005574545 169
394 iso_pu_bacteria 8018163183 8018166497 169
395 iso_pu_bacteria 8023680758 8023685095 169
396 iso_pu_bacteria 8024479707 8024483250 169
397 iso_pu_bacteria 8057874678 8057874746 169
398 3300002739 JGI25158J39367_1000104 JGI25158J39367_10001048 170
399 3300002773 JGI25152J39213_1008219 JGI25152J39213_10082193 170
400 3300003187 JGI25151J46595_10011459 JGI25151J46595_100114592 170
401 3300003215 JGI25153J46596_10002046 JGI25153J46596_100020462 170
402 3300003320 rootH2_10269522 rootH2_102695222 170
403 3300003354 JGI25160J50197_1006055 JGI25160J50197_10060554 170
404 3300003374 JGI25161J50226_1000118 JGI25161J50226_100011823 170
405 3300003771 Ga0055526_1002180 Ga0055526_100218011 170
406 3300003775 Ga0055524_1030325 Ga0055524_10303252 170
407 3300003790 Ga0055528_1002403 Ga0055528_100240312 170
408 3300003790 Ga0055528_1073429 Ga0055528_10734291 170
409 3300004625 Ga0055543_1000304 Ga0055543_100030422 170
410 3300005262 Ga0065165_1004321 Ga0065165_100432113 170
411 3300005337 Ga0070682_100636365 Ga0070682_1006363651 170
412 3300005548 Ga0070665_100711142 Ga0070665_1007111421 170
413 3300005844 Ga0068862_100771254 Ga0068862_1007712542 170
414 3300006186 Ga0075369_10018164 Ga0075369_100181642 170
415 3300009092 Ga0105250_10021463 Ga0105250_100214631 170
416 3300025208 Ga0209436_100198 Ga0209436_10019823 170
417 3300025245 Ga0207425_1002279 Ga0207425_10022794 170
418 3300025258 Ga0209129_1002759 Ga0209129_10027597 170
419 3300025258 Ga0209129_1003019 Ga0209129_10030197 170
420 3300025273 Ga0209673_1002930 Ga0209673_10029303 170
421 3300025284 Ga0209130_1000020 Ga0209130_1000020175 170
422 3300025294 Ga0209025_1012219 Ga0209025_10122192 170
423 3300025295 Ga0209564_1000628 Ga0209564_100062818 170
424 3300025297 Ga0209758_1002077 Ga0209758_10020777 170
425 3300025297 Ga0209758_1003551 Ga0209758_10035517 170
426 3300025299 Ga0209256_1009986 Ga0209256_10099864 170
427 3300025302 Ga0207426_1000008 Ga0207426_1000008244 170
428 3300025303 Ga0209051_1000829 Ga0209051_100082934 170
429 3300025923 Ga0207681_10212868 Ga0207681_102128682 170
430 3300028379 Ga0268266_10209829 Ga0268266_102098292 170
431 3300041413 Ga0439465_0042106 Ga0439465_0042106_944_1456 170
432 3300046457 Ga0495590_0045087 Ga0495590_0045087_310_822 170
433 3300046506 Ga0495583_0019782 Ga0495583_0019782_2762_3274 170
434 3300046512 Ga0495610_0045911 Ga0495610_0045911_411_923 170
435 3300046522 Ga0495643_0012998 Ga0495643_0012998_4076_4588 170
436 3300048919 Ga0496116_0027910 Ga0496116_0027910_662_1174 170
437 3300048920 Ga0496117_0155179 Ga0496117_0155179_313_825 170
438 3300048921 Ga0496118_0037381 Ga0496118_0037381_92_604 170
439 3300048924 Ga0496121_0007830 Ga0496121_0007830_2931_3443 170
440 3300048925 Ga0496122_0017654 Ga0496122_0017654_3619_4131 170
441 3300048927 Ga0496124_0186771 Ga0496124_0186771_899_1411 170
442 3300048928 Ga0496125_0047509 Ga0496125_0047509_2867_3379 170
443 3300049569 Ga0501032_0275221 Ga0501032_0275221_78_590 170
444 3300049571 Ga0501034_0350403 Ga0501034_0350403_115_627 170
445 3300049580 Ga0501046_0194453 Ga0501046_0194453_736_1248 170
446 3300049583 Ga0501067_0042355 Ga0501067_0042355_1611_2123 170
447 3300049589 Ga0501073_0366225 Ga0501073_0366225_271_783 170
448 3300049823 Ga0501044_0975602 Ga0501044_0975602_89_601 170
449 3300050516 nmdc:mga0sz30_32478_c1 nmdc:mga0sz30_32478_c1_1537_2049 170
450 3300053156 Ga0500622_0000210 Ga0500622_0000210_18405_18917 170
451 3300053160 Ga0500633_0007723 Ga0500633_0007723_614_1126 170
452 3300060353 Ga0501082_0031180 Ga0501082_0031180_419_931 170

Feature Viewer

pLDDT pTM Quality
49.61 0.45 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map