F447102

General Info

Members Datasets Scaffolds Average Seq Length
452 288 904 424

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|8020953355|8020953446
Length 458
Sequence VLGAGVIGVTTAWHLREAGCDVTVIEREADVAQATSLGNAGVIAPGYVTPWAAPGMPGKILKYLFKPASPLIFRPTLDAAQWRWIARWLRECEFERFRVNKQRMQRIAYYSRACLRAFRDRHPFDYGASRGYLQLLRGAFDVEMVQPALKVLRDAGIAFRELDAAGCTAIEPGLRWARQAPVGGIYLPDDEAGDCARFTRELRSLCEANGVTFRFRTEIRALDVAGGKVRGVRVSATGTDGRSPRDEGTGIDTPDIDLRGAGQPGRPAAGRAASSATKPRDVLLEADAVVVALGVDSAGLLRPHGIDVPLYPVKGYSATLTVVDDEKAPHAALMDESLKTAITRFGPTLRVAGTAELGNRHAALRQQALDTLMKVLDDWFPHAAERASARFWVGRRPMTPDGPPLLGASHIDGLWLNVGHGSTGWAMSMGSGKVLADLVTGREPEIDLSGLTLARYER

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
13 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
16 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
19 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
24 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
39 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
52 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
53 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
54 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
59 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
62 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
63 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
90 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
93 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
94 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
95 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
98 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
110 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
111 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
112 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
113 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
114 3300042116 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126F_E14_082316_1792 Metagenome Rhizosphere
115 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
116 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
117 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
118 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
119 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
120 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
121 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
122 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
123 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
124 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
134 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
146 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
147 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
152 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
156 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
166 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
167 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
168 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
172 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
173 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
174 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
181 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
182 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
193 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
194 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
199 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
200 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
201 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
202 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
208 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
209 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
210 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
211 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
212 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
213 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
214 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
215 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
218 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
227 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
228 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
231 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
232 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
233 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
234 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
235 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
236 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
237 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
238 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
239 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
240 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
241 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
242 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
243 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
244 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
245 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
246 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
247 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
248 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
249 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
250 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
251 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
252 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
253 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
254 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
255 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
256 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
257 2818991452 Burkholderia cepacia 561 Isolate Unclassified
258 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
259 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
260 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
261 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
262 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
263 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
264 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
265 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
266 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
267 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
268 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
269 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
270 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
271 2904564687 Burkholderia sp. 571 Isolate Unclassified
272 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
273 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
274 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
275 2928170801 Burkholderia sp. 572 Isolate Unclassified
276 2928536128 Burkholderia sola 565 Isolate Unclassified
277 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
278 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
279 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
280 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
281 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
282 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere
283 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
284 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
285 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
286 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
287 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
288 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 86.95
Metatranscriptomes 0
Isolates 13.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.82
Nodule 2.88
Rhizoplane 3.1
Rhizosphere 64.82
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001324 3300001979 Bacteria 11257
2 JGI24737J22298_10020367 3300001990 Bacteria 2117
3 JGI24735J21928_10000155 3300002067 Bacteria 24058
4 JGI24735J21928_10001750 3300002067 Bacteria 7658
5 JGI25156J39149_1000418 3300002705 Bacteria 26417
6 JGI25156J39149_1001488 3300002705 Bacteria 9800
7 JGI25156J39149_1005143 3300002705 Bacteria 3843
8 JGI25151J46595_10001148 3300003187 Bacteria 19196
9 JGI25151J46595_10001220 3300003187 Bacteria 18383
10 JGI25165J46597_1002446 3300003214 Bacteria 5979
11 rootH2_10079005 3300003320 Bacteria 7297
12 rootH2_10129063 3300003320 Bacteria 2923
13 rootL2_10146905 3300003322 Bacteria 2994
14 rootH1_10196331 3300003323 Bacteria 2752
15 JGI25160J50197_1001789 3300003354 Bacteria 10401
16 Ga0055533_1000529 3300003756 Bacteria 13667
17 Ga0055533_1003739 3300003756 Bacteria 2952
18 Ga0055532_1000092 3300003758 Bacteria 103243
19 Ga0055532_1001701 3300003758 Bacteria 5663
20 Ga0055532_1001763 3300003758 Bacteria 5444
21 Ga0055527_1000035 3300003760 Bacteria 138481
22 Ga0055535_1000050 3300003761 Bacteria 138481
23 Ga0055535_1001431 3300003761 Bacteria 12173
24 Ga0055542_1000120 3300003762 Bacteria 103243
25 Ga0055542_1001129 3300003762 Bacteria 15863
26 Ga0055529_1000089 3300003763 Bacteria 138481
27 Ga0055529_1000948 3300003763 Bacteria 15232
28 Ga0055526_1002549 3300003771 Bacteria 12236
29 Ga0055526_1002553 3300003771 Bacteria 12225
30 Ga0055524_1000401 3300003775 Bacteria 37009
31 Ga0055536_1000365 3300003781 Bacteria 33614
32 Ga0055534_1001121 3300003784 Bacteria 11364
33 Ga0055528_1011117 3300003790 Bacteria 3603
34 Ga0055531_10001824 3300003794 Bacteria 15095
35 Ga0058692_1000904 3300003856 Bacteria 11693
36 Ga0065165_1003668 3300005262 Bacteria 10478
37 Ga0070682_100051202 3300005337 Bacteria 2580
38 Ga0070660_100010032 3300005339 Bacteria 6681
39 Ga0070659_100006676 3300005366 Bacteria 8339
40 Ga0070663_100000524 3300005455 Bacteria 20208
41 Ga0070662_100044313 3300005457 Bacteria 3186
42 Ga0068867_100000175 3300005459 Bacteria 41852
43 Ga0070665_100028557 3300005548 Bacteria 5618
44 Ga0068855_100010176 3300005563 Bacteria 11335
45 Ga0068855_100088646 3300005563 Bacteria 3574
46 Ga0068855_100134814 3300005563 Bacteria 2818
47 Ga0068856_100158849 3300005614 Bacteria 2271
48 Ga0068852_100007222 3300005616 Bacteria 8100
49 Ga0075365_10071070 3300006038 Bacteria 2342
50 Ga0075366_10030306 3300006195 Bacteria 3180
51 Ga0075370_10001010 3300006353 Bacteria 11647
52 Ga0099826_10000004 3300006948 Bacteria 802669
53 Ga0105251_10049577 3300009011 Bacteria 2009
54 Ga0105240_10005791 3300009093 Bacteria 18327
55 Ga0105240_10021398 3300009093 Bacteria 8602
56 Ga0105240_10042020 3300009093 Bacteria 5828
57 Ga0105240_10166384 3300009093 Bacteria 2615
58 Ga0105245_10286709 3300009098 Bacteria 1611
59 Ga0105243_10000770 3300009148 Bacteria 30670
60 Ga0105241_10254407 3300009174 Bacteria 1490
61 Ga0105242_10343589 3300009176 Bacteria 1376
62 Ga0105237_10003275 3300009545 Bacteria 19332
63 Ga0105238_10000102 3300009551 Bacteria 94910
64 Ga0105239_10001547 3300010375 Bacteria 30388
65 Ga0105239_10181241 3300010375 Bacteria 2357
66 Ga0157369_10019485 3300013105 Bacteria 7592
67 Ga0157377_10000014 3300014745 Bacteria 213961
68 Ga0157379_10078911 3300014968 Bacteria 2949
69 Ga0182007_10012347 3300015262 Bacteria 3289
70 Ga0183361_10015 3300016635 Bacteria 166772
71 Ga0209566_100312 3300025225 Bacteria 43942
72 Ga0209674_100153 3300025226 Bacteria 94333
73 Ga0209674_100272 3300025226 Bacteria 39275
74 Ga0209674_102953 3300025226 Bacteria 3337
75 Ga0209672_100054 3300025228 Bacteria 222217
76 Ga0209672_100073 3300025228 Bacteria 166621
77 Ga0209147_100085 3300025229 Bacteria 185813
78 Ga0209147_100093 3300025229 Bacteria 167196
79 Ga0209147_100832 3300025229 Bacteria 14549
80 Ga0209563_101295 3300025230 Bacteria 6834
81 Ga0207427_101047 3300025231 Bacteria 11492
82 Ga0209258_100140 3300025242 Bacteria 167245
83 Ga0209258_100168 3300025242 Bacteria 145329
84 Ga0209148_1000119 3300025254 Bacteria 188079
85 Ga0209148_1000140 3300025254 Bacteria 166819
86 Ga0209759_1000281 3300025256 Bacteria 71594
87 Ga0209759_1000329 3300025256 Bacteria 62253
88 Ga0209759_1000362 3300025256 Bacteria 58080
89 Ga0209759_1013248 3300025256 Bacteria 2242
90 Ga0209233_1000173 3300025261 Bacteria 145995
91 Ga0209565_1000066 3300025263 Bacteria 173062
92 Ga0209455_1000125 3300025272 Bacteria 166819
93 Ga0209455_1000244 3300025272 Bacteria 67136
94 Ga0209673_1000098 3300025273 Bacteria 193352
95 Ga0209673_1034546 3300025273 Bacteria 1526
96 Ga0209675_1000084 3300025291 Bacteria 152066
97 Ga0209675_1001045 3300025291 Bacteria 17234
98 Ga0209676_1000014 3300025292 Bacteria 793514
99 Ga0209025_1000365 3300025294 Bacteria 95783
100 Ga0209025_1000437 3300025294 Bacteria 82190
101 Ga0209025_1002968 3300025294 Bacteria 16847
102 Ga0209564_1000539 3300025295 Bacteria 61208
103 Ga0209564_1000901 3300025295 Bacteria 38935
104 Ga0209564_1002826 3300025295 Bacteria 12866
105 Ga0209564_1011630 3300025295 Bacteria 3922
106 Ga0209256_1000331 3300025299 Bacteria 79942
107 Ga0207426_1000199 3300025302 Bacteria 145826
108 Ga0209051_1000110 3300025303 Bacteria 153230
109 Ga0209051_1016489 3300025303 Bacteria 3339
110 Ga0209257_1000012 3300025304 Bacteria 1111138
111 Ga0209257_1000045 3300025304 Bacteria 484429
112 Ga0207647_10055119 3300025904 Bacteria 2444
113 Ga0207647_10077683 3300025904 Bacteria 1995
114 Ga0207695_10003429 3300025913 Bacteria 22375
115 Ga0207695_10005064 3300025913 Bacteria 17675
116 Ga0207695_10169741 3300025913 Bacteria 2108
117 Ga0207671_10001495 3300025914 Bacteria 26983
118 Ga0207693_10027472 3300025915 Bacteria 4498
119 Ga0207657_10017935 3300025919 Bacteria 6773
120 Ga0207694_10000176 3300025924 Bacteria 66165
121 Ga0207690_10002863 3300025932 Bacteria 10392
122 Ga0207706_10014854 3300025933 Bacteria 7050
123 Ga0207709_10013137 3300025935 Bacteria 4567
124 Ga0207689_10092952 3300025942 Bacteria 2478
125 Ga0207667_10017312 3300025949 Bacteria 8116
126 Ga0207678_10001691 3300026067 Bacteria 20214
127 Ga0207648_10000142 3300026089 Bacteria 71593
128 Ga0207698_10024832 3300026142 Bacteria 4212
129 Ga0209371_1000575 3300027312 Bacteria 33050
130 Ga0209371_1001567 3300027312 Bacteria 15036
131 Ga0209282_1000035 3300027666 Bacteria 137066
132 Ga0209974_10000306 3300027876 Bacteria 15939
133 Ga0268266_10012109 3300028379 Bacteria 7465
134 Ga0307515_10000022 3300028794 Bacteria 404064
135 Ga0307515_10000191 3300028794 Bacteria 149201
136 Ga0307515_10025661 3300028794 Bacteria 10184
137 Ga0307515_10058388 3300028794 Bacteria 5557
138 Ga0268256_1000875 3300030500 Bacteria 20997
139 Ga0268256_1001343 3300030500 Bacteria 15036
140 Ga0307513_10026755 3300031456 Bacteria 6638
141 Ga0307509_10057726 3300031507 Bacteria 4114
142 Ga0307408_100003563 3300031548 Bacteria 10608
143 Ga0307508_10000017 3300031616 Bacteria 203567
144 Ga0307516_10036093 3300031730 Bacteria 4951
145 Ga0307405_10036191 3300031731 Bacteria 2955
146 Ga0307412_10000056 3300031911 Bacteria 145861
147 Ga0307409_100200170 3300031995 Bacteria 1786
148 Ga0307416_100009684 3300032002 Bacteria 6326
149 Ga0307414_10035859 3300032004 Bacteria 3305
150 Ga0395899_0001564 3300037312 Bacteria 19269
151 Ga0395899_0003106 3300037312 Bacteria 13222
152 Ga0395899_0012064 3300037312 Bacteria 6620
153 Ga0395899_0012534 3300037312 Bacteria 6498
154 Ga0395900_0008097 3300037418 Bacteria 10820
155 Ga0395900_0011209 3300037418 Bacteria 9167
156 Ga0395900_0013558 3300037418 Bacteria 8326
157 Ga0395900_0052641 3300037418 Bacteria 4190
158 Ga0395900_0064536 3300037418 Bacteria 3762
159 Ga0395900_0154753 3300037418 Bacteria 2342
160 Ga0395900_0276116 3300037418 Bacteria 1674
161 Ga0395898_0031295 3300037466 Bacteria 5318
162 Ga0395905_0002605 3300037471 Bacteria 19856
163 Ga0395905_0009528 3300037471 Bacteria 9487
164 Ga0395905_0023360 3300037471 Bacteria 5844
165 Ga0395905_0033634 3300037471 Bacteria 4814
166 Ga0395905_0081051 3300037471 Bacteria 3041
167 Ga0395905_0087621 3300037471 Bacteria 2918
168 Ga0395901_0002522 3300038443 Bacteria 18545
169 Ga0395901_0003709 3300038443 Bacteria 15400
170 Ga0436361_0037196 3300039447 Bacteria 2587
171 Ga0439436_0015587 3300041404 Bacteria 2285
172 Ga0439436_0026500 3300041404 Bacteria 1699
173 Ga0439449_0002251 3300042007 Bacteria 7586
174 Ga0439462_0003530 3300042015 Bacteria 3756
175 Ga0450911_001137 3300042115 Bacteria 6577
176 Ga0450912_000284 3300042116 Bacteria 2285
177 Ga0450898_000983 3300042134 Bacteria 3595
178 Ga0450898_001580 3300042134 Bacteria 3039
179 Ga0439446_0004830 3300042156 Bacteria 3436
180 Ga0439434_0008896 3300042435 Bacteria 2951
181 Ga0439435_0035206 3300042436 Bacteria 1380
182 Ga0439464_0008229 3300042439 Bacteria 2733
183 Ga0450893_0004321 3300042532 Bacteria 2264
184 Ga0451577_0113064 3300042876 Bacteria 2430
185 Ga0466972_0000285 3300044658 Bacteria 31510
186 Ga0466972_0000508 3300044658 Bacteria 19348
187 Ga0453683_0001993 3300044673 Bacteria 16524
188 Ga0466965_0000473 3300044683 Bacteria 14207
189 Ga0466964_0001829 3300044706 Bacteria 7406
190 Ga0466968_0001709 3300044735 Bacteria 7910
191 Ga0466970_0061413 3300044765 Bacteria 2013
192 Ga0466959_0005993 3300045049 Bacteria 8388
193 Ga0451576_0082807 3300045051 Bacteria 3337
194 Ga0466967_0094770 3300045976 Bacteria 2719
195 Ga0495592_0121385 3300046454 Bacteria 1838
196 Ga0495603_0000734 3300046455 Bacteria 18663
197 Ga0495603_0003264 3300046455 Bacteria 9656
198 Ga0495603_0124045 3300046455 Bacteria 1505
199 Ga0495590_0001899 3300046457 Bacteria 8843
200 Ga0495590_0004680 3300046457 Bacteria 5488
201 Ga0495590_0023900 3300046457 Bacteria 2155
202 Ga0495591_001305 3300046458 Bacteria 15753
203 Ga0495629_0000162 3300046459 Bacteria 58860
204 Ga0495629_0001379 3300046459 Bacteria 19148
205 Ga0495629_0030147 3300046459 Bacteria 3846
206 Ga0495638_0014949 3300046460 Bacteria 5227
207 Ga0495641_0010319 3300046461 Bacteria 5422
208 Ga0495651_0049019 3300046462 Bacteria 3261
209 Ga0495651_0065939 3300046462 Bacteria 2764
210 Ga0495651_0069576 3300046462 Bacteria 2680
211 Ga0495653_0001542 3300046463 Bacteria 17981
212 Ga0495653_0001687 3300046463 Bacteria 17383
213 Ga0495653_0046313 3300046463 Bacteria 3368
214 Ga0495650_0044361 3300046471 Bacteria 1880
215 Ga0495580_0001709 3300046472 Bacteria 19286
216 Ga0495580_0002400 3300046472 Bacteria 16370
217 Ga0495580_0014280 3300046472 Bacteria 6025
218 Ga0495580_0016881 3300046472 Bacteria 5472
219 Ga0495580_0046826 3300046472 Bacteria 3067
220 Ga0495580_0066304 3300046472 Bacteria 2527
221 Ga0495582_0002198 3300046473 Bacteria 10919
222 Ga0495582_0011445 3300046473 Bacteria 4887
223 Ga0495582_0012580 3300046473 Bacteria 4665
224 Ga0495605_0003171 3300046474 Bacteria 9884
225 Ga0495605_0010333 3300046474 Bacteria 5226
226 Ga0495605_0010922 3300046474 Bacteria 5073
227 Ga0495605_0033489 3300046474 Bacteria 2607
228 Ga0495662_0010139 3300046476 Bacteria 4619
229 Ga0495664_0001070 3300046477 Bacteria 14161
230 Ga0495664_0064029 3300046477 Bacteria 2191
231 Ga0495664_0080578 3300046477 Bacteria 1951
232 Ga0495596_0001163 3300046500 Bacteria 15424
233 Ga0495596_0001951 3300046500 Bacteria 11391
234 Ga0495596_0006023 3300046500 Bacteria 5657
235 Ga0495607_0025059 3300046501 Bacteria 3714
236 Ga0495583_0049756 3300046506 Bacteria 1917
237 Ga0495606_0014872 3300046507 Bacteria 6042
238 Ga0495608_0003857 3300046511 Bacteria 10774
239 Ga0495608_0026341 3300046511 Bacteria 3965
240 Ga0495610_0003726 3300046512 Bacteria 11667
241 Ga0495610_0004088 3300046512 Bacteria 10938
242 Ga0495616_0002965 3300046513 Bacteria 11024
243 Ga0495618_0002471 3300046514 Bacteria 11863
244 Ga0495618_0004161 3300046514 Bacteria 8931
245 Ga0495618_0091420 3300046514 Bacteria 1945
246 Ga0495628_0003612 3300046516 Bacteria 13836
247 Ga0495628_0039403 3300046516 Bacteria 3779
248 Ga0495628_0062856 3300046516 Bacteria 2909
249 Ga0495628_0071348 3300046516 Bacteria 2707
250 Ga0495630_0033931 3300046517 Bacteria 3807
251 Ga0495630_0058295 3300046517 Bacteria 2894
252 Ga0495630_0132741 3300046517 Bacteria 1891
253 Ga0495630_0223823 3300046517 Bacteria 1436
254 Ga0495632_0007474 3300046519 Bacteria 6857
255 Ga0495643_0042666 3300046522 Bacteria 2471
256 Ga0495643_0105249 3300046522 Bacteria 1441
257 Ga0495648_0004162 3300046524 Bacteria 12440
258 Ga0495648_0055208 3300046524 Bacteria 2395
259 Ga0495666_0001360 3300046526 Bacteria 11853
260 Ga0495666_0022087 3300046526 Bacteria 3152
261 Ga0495652_0018699 3300046529 Bacteria 6176
262 Ga0495652_0025160 3300046529 Bacteria 5270
263 Ga0495652_0135087 3300046529 Bacteria 1947
264 Ga0495665_0003493 3300046531 Bacteria 8530
265 Ga0495665_0007415 3300046531 Bacteria 5930
266 Ga0495665_0030535 3300046531 Bacteria 2884
267 Ga0495640_0003238 3300046533 Bacteria 13099
268 Ga0495640_0008301 3300046533 Bacteria 8142
269 Ga0495640_0034329 3300046533 Bacteria 3598
270 Ga0495586_0002228 3300046535 Bacteria 10537
271 Ga0495587_0000463 3300046536 Bacteria 28424
272 Ga0495587_0049249 3300046536 Bacteria 2494
273 Ga0495587_0091958 3300046536 Bacteria 1752
274 Ga0495609_0002440 3300046538 Bacteria 11434
275 Ga0495597_0012347 3300046542 Bacteria 4122
276 Ga0495645_0025548 3300046543 Bacteria 4287
277 Ga0495622_0000349 3300046557 Bacteria 32902
278 Ga0495634_0062712 3300046642 Bacteria 2468
279 Ga0495611_0041593 3300046648 Bacteria 2050
280 Ga0495625_0005094 3300046660 Bacteria 12158
281 Ga0495635_0002193 3300046663 Bacteria 13283
282 Ga0495635_0004444 3300046663 Bacteria 9714
283 Ga0495661_0007612 3300046665 Bacteria 7547
284 Ga0495661_0017318 3300046665 Bacteria 4760
285 Ga0495657_0055655 3300046675 Bacteria 2638
286 Ga0495599_0002788 3300046678 Bacteria 10186
287 Ga0495599_0007738 3300046678 Bacteria 6522
288 Ga0495599_0009016 3300046678 Bacteria 6078
289 Ga0495599_0085588 3300046678 Bacteria 1969
290 Ga0495599_0108642 3300046678 Bacteria 1728
291 Ga0495623_0004772 3300046679 Bacteria 8905
292 Ga0495623_0035512 3300046679 Bacteria 3194
293 Ga0495646_0002044 3300046680 Bacteria 12233
294 Ga0495646_0002817 3300046680 Bacteria 10764
295 Ga0495646_0021344 3300046680 Bacteria 4092
296 Ga0495613_0001086 3300046689 Bacteria 20760
297 Ga0495613_0013650 3300046689 Bacteria 6027
298 Ga0495624_0002939 3300046690 Bacteria 12754
299 Ga0495624_0009490 3300046690 Bacteria 6739
300 Ga0495624_0018705 3300046690 Bacteria 4631
301 Ga0495624_0024364 3300046690 Bacteria 3982
302 Ga0495671_0003485 3300046692 Bacteria 9651
303 Ga0495649_0003524 3300046694 Bacteria 10529
304 Ga0495649_0007972 3300046694 Bacteria 6405
305 Ga0495649_0027318 3300046694 Bacteria 3167
306 Ga0495649_0113134 3300046694 Bacteria 1438
307 Ga0495589_0011814 3300046794 Bacteria 4532
308 Ga0495589_0051191 3300046794 Bacteria 2042
309 Ga0495600_0002282 3300046809 Bacteria 10932
310 Ga0495581_0001139 3300047315 Bacteria 14552
311 Ga0495581_0004859 3300047315 Bacteria 7777
312 Ga0495581_0051999 3300047315 Bacteria 2366
313 Ga0495604_0010632 3300047317 Bacteria 7298
314 Ga0495604_0028746 3300047317 Bacteria 4423
315 Ga0495604_0057275 3300047317 Bacteria 2996
316 Ga0495604_0088750 3300047317 Bacteria 2299
317 Ga0495674_0020747 3300047319 Bacteria 6083
318 Ga0495674_0025864 3300047319 Bacteria 5373
319 Ga0495674_0043644 3300047319 Bacteria 3990
320 Ga0495672_0031806 3300047320 Bacteria 3291
321 Ga0495672_0076739 3300047320 Bacteria 1875
322 Ga0495676_0014085 3300047321 Bacteria 7159
323 Ga0495676_0019564 3300047321 Bacteria 5954
324 Ga0495676_0063101 3300047321 Bacteria 2890
325 Ga0495680_0002154 3300047322 Bacteria 20419
326 Ga0495680_0033806 3300047322 Bacteria 4137
327 Ga0495683_0003086 3300047323 Bacteria 9769
328 Ga0495683_0010632 3300047323 Bacteria 4856
329 Ga0495683_0014922 3300047323 Bacteria 4046
330 Ga0495683_0059779 3300047323 Bacteria 1890
331 Ga0495687_013771 3300047443 Bacteria 4199
332 Ga0495687_036743 3300047443 Bacteria 2188
333 Ga0495687_069939 3300047443 Bacteria 1411
334 Ga0495675_0011029 3300047444 Bacteria 5665
335 Ga0495679_000617 3300047446 Bacteria 24016
336 Ga0495679_000750 3300047446 Bacteria 20735
337 Ga0495679_006448 3300047446 Bacteria 5045
338 Ga0495673_0029863 3300047469 Bacteria 2568
339 Ga0495673_0036738 3300047469 Bacteria 2243
340 Ga0495684_0035145 3300047471 Bacteria 3845
341 Ga0495593_0003694 3300047673 Bacteria 9139
342 Ga0495593_0032068 3300047673 Bacteria 2866
343 Ga0495602_0015150 3300048088 Bacteria 7791
344 Ga0495602_0019599 3300048088 Bacteria 6711
345 Ga0495602_0020786 3300048088 Bacteria 6477
346 Ga0495614_0005364 3300048089 Bacteria 5785
347 Ga0495626_0034692 3300048091 Bacteria 2412
348 Ga0495626_0039379 3300048091 Bacteria 2237
349 Ga0496101_0007655 3300048904 Bacteria 7012
350 Ga0496102_0013902 3300048905 Bacteria 6983
351 Ga0496102_0017849 3300048905 Bacteria 6222
352 Ga0496103_0001492 3300048906 Bacteria 15642
353 Ga0496103_0030670 3300048906 Bacteria 3273
354 Ga0496105_0141476 3300048908 Bacteria 1980
355 Ga0496106_0000162 3300048909 Bacteria 48305
356 Ga0496112_0200104 3300048915 Bacteria 1957
357 Ga0496113_0166456 3300048916 Bacteria 1744
358 Ga0496116_0082271 3300048919 Bacteria 1992
359 Ga0496117_0007541 3300048920 Bacteria 10603
360 Ga0496117_0096328 3300048920 Bacteria 1888
361 Ga0496118_0008687 3300048921 Bacteria 10440
362 Ga0496118_0017211 3300048921 Bacteria 6590
363 Ga0496119_0050867 3300048922 Bacteria 2550
364 Ga0496121_0006767 3300048924 Bacteria 14066
365 Ga0496121_0009882 3300048924 Bacteria 10873
366 Ga0496121_0018436 3300048924 Bacteria 7037
367 Ga0496121_0022736 3300048924 Bacteria 6067
368 Ga0496121_0047118 3300048924 Bacteria 3681
369 Ga0496121_0065386 3300048924 Bacteria 2959
370 Ga0496121_0087006 3300048924 Bacteria 2454
371 Ga0496122_0003093 3300048925 Bacteria 22367
372 Ga0496123_0002770 3300048926 Bacteria 20934
373 Ga0496124_0152719 3300048927 Bacteria 1809
374 Ga0496125_0012086 3300048928 Bacteria 8591
375 Ga0496125_0034876 3300048928 Bacteria 4426
376 Ga0496126_0004713 3300048929 Bacteria 16102
377 Ga0496126_0004910 3300048929 Bacteria 15611
378 Ga0495682_0051860 3300049460 Bacteria 1491
379 Ga0501043_0000141 3300049579 Bacteria 67326
380 Ga0501046_0000047 3300049580 Bacteria 140344
381 Ga0501047_0000058 3300049581 Bacteria 139202
382 Ga0501047_0070809 3300049581 Bacteria 3357
383 Ga0501047_0166089 3300049581 Bacteria 2078
384 Ga0501048_0000475 3300049582 Bacteria 28030
385 Ga0501263_001653 3300049760 Bacteria 2147
386 Ga0501035_0110313 3300049822 Bacteria 2411
387 Ga0501044_0017880 3300049823 Bacteria 7605
388 Ga0501044_0078280 3300049823 Bacteria 3351
389 Ga0501045_0074856 3300049824 Bacteria 2493
390 nmdc:mga07m45_5769_c1 3300050496 Bacteria 6199
391 Ga0500578_0018907 3300053086 Bacteria 4423
392 Ga0500658_0040856 3300053134 Bacteria 1859
393 Ga0466962_0107799 3300061719 Bacteria 1340
394 8020953446 8020953355 Bacteria 7439080
395 2501084082 2501025502 Bacteria 9641094
396 2501414392 2501025504 Bacteria 8008976
397 2509130812 2508501125 Bacteria 7208311
398 2511093365 2510917013 Bacteria 9951648
399 2511099815 2510917014 Bacteria 8296963
400 2511102414 2510917015 Bacteria 7950052
401 2512348407 2512047030 Bacteria 9031815
402 2513956863 2513237150 Bacteria 6553639
403 2513962631 2513237151 Bacteria 6309801
404 2514043393 2513237165 Bacteria 6771773
405 2516022267 2515154189 Bacteria 9629850
406 2527080622 2526164713 Bacteria 6780608
407 2563061559 2562617112 Bacteria 10918404
408 2587755156 2585428062 Bacteria 6842168
409 2599741082 2599185239 Bacteria 8686614
410 2599748389 2599185240 Bacteria 7968121
411 2600210301 2599185355 Bacteria 7968906
412 2676745774 2675903129 Bacteria 7964495
413 2713478576 2711768613 Bacteria 11048459
414 2738823994 2738541296 Bacteria 7285013
415 2738836385 2738541298 Bacteria 7286732
416 2738877915 2738541306 Bacteria 7284992
417 2739189621 2738543002 Bacteria 7284546
418 2739224508 2738543008 Bacteria 7282815
419 2746087259 2744054900 Bacteria 8399525
420 2746093234 2744054901 Bacteria 8397047
421 2819636838 2818991452 Bacteria 8442785
422 2834642025 2834641062 Bacteria 5559922
423 2842332154 2842324504 Bacteria 9364110
424 2842356394 2842348783 Bacteria 9002918
425 2842461252 2842454564 Bacteria 8730687
426 2856289370 2856287931 Bacteria 7223934
427 2857362243 2857357740 Bacteria 9937880
428 2863426457 2863421361 Bacteria 7300805
429 2870069363 2870068957 Bacteria 8925310
430 2883091401 2883087390 Bacteria 9532701
431 2885272393 2885270888 Bacteria 9831543
432 2900637102 2900634093 Bacteria 10263517
433 2904442367 2904439833 Bacteria 5931679
434 2904490149 2904483920 Bacteria 7545285
435 2904569378 2904564687 Bacteria 7609577
436 2904576785 2904571731 Bacteria 7608790
437 2919050618 2919046199 Bacteria 5567169
438 2919533318 2919527303 Bacteria 7718827
439 2928176295 2928170801 Bacteria 8785406
440 2928542055 2928536128 Bacteria 7657547
441 2945934533 2945934425 Bacteria 7444609
442 2990704908 2990703756 Bacteria 7715990
443 642426572 641736151 Bacteria 7477263
444 642623169 642555113 Bacteria 8214658
445 644747751 644736347 Bacteria 6476522
446 8003404433 8003400568 Bacteria 5535898
447 8018847968 8018845410 Bacteria 8933938
448 8020939007 8020938398 Bacteria 7472757
449 8020947723 8020945358 Bacteria 8467355
450 8021127552 8021120328 Bacteria 8782274
451 8039099702 8039098773 Bacteria 6602928
452 8055307381 8055301274 Bacteria 8587385
453 JGI24740J21852_10001324
454 JGI24737J22298_10020367
455 JGI24735J21928_10000155
456 JGI24735J21928_10001750
457 JGI25156J39149_1000418
458 JGI25156J39149_1001488
459 JGI25156J39149_1005143
460 JGI25151J46595_10001148
461 JGI25151J46595_10001220
462 JGI25165J46597_1002446
463 rootH2_10079005
464 rootH2_10129063
465 rootL2_10146905
466 rootH1_10196331
467 JGI25160J50197_1001789
468 Ga0055533_1000529
469 Ga0055533_1003739
470 Ga0055532_1000092
471 Ga0055532_1001701
472 Ga0055532_1001763
473 Ga0055527_1000035
474 Ga0055535_1000050
475 Ga0055535_1001431
476 Ga0055542_1000120
477 Ga0055542_1001129
478 Ga0055529_1000089
479 Ga0055529_1000948
480 Ga0055526_1002549
481 Ga0055526_1002553
482 Ga0055524_1000401
483 Ga0055536_1000365
484 Ga0055534_1001121
485 Ga0055528_1011117
486 Ga0055531_10001824
487 Ga0058692_1000904
488 Ga0065165_1003668
489 Ga0070682_100051202
490 Ga0070660_100010032
491 Ga0070659_100006676
492 Ga0070663_100000524
493 Ga0070662_100044313
494 Ga0068867_100000175
495 Ga0070665_100028557
496 Ga0068855_100010176
497 Ga0068855_100088646
498 Ga0068855_100134814
499 Ga0068856_100158849
500 Ga0068852_100007222
501 Ga0075365_10071070
502 Ga0075366_10030306
503 Ga0075370_10001010
504 Ga0099826_10000004
505 Ga0105251_10049577
506 Ga0105240_10005791
507 Ga0105240_10021398
508 Ga0105240_10042020
509 Ga0105240_10166384
510 Ga0105245_10286709
511 Ga0105243_10000770
512 Ga0105241_10254407
513 Ga0105242_10343589
514 Ga0105237_10003275
515 Ga0105238_10000102
516 Ga0105239_10001547
517 Ga0105239_10181241
518 Ga0157369_10019485
519 Ga0157377_10000014
520 Ga0157379_10078911
521 Ga0182007_10012347
522 Ga0183361_10015
523 Ga0209566_100312
524 Ga0209674_100153
525 Ga0209674_100272
526 Ga0209674_102953
527 Ga0209672_100054
528 Ga0209672_100073
529 Ga0209147_100085
530 Ga0209147_100093
531 Ga0209147_100832
532 Ga0209563_101295
533 Ga0207427_101047
534 Ga0209258_100140
535 Ga0209258_100168
536 Ga0209148_1000119
537 Ga0209148_1000140
538 Ga0209759_1000281
539 Ga0209759_1000329
540 Ga0209759_1000362
541 Ga0209759_1013248
542 Ga0209233_1000173
543 Ga0209565_1000066
544 Ga0209455_1000125
545 Ga0209455_1000244
546 Ga0209673_1000098
547 Ga0209673_1034546
548 Ga0209675_1000084
549 Ga0209675_1001045
550 Ga0209676_1000014
551 Ga0209025_1000365
552 Ga0209025_1000437
553 Ga0209025_1002968
554 Ga0209564_1000539
555 Ga0209564_1000901
556 Ga0209564_1002826
557 Ga0209564_1011630
558 Ga0209256_1000331
559 Ga0207426_1000199
560 Ga0209051_1000110
561 Ga0209051_1016489
562 Ga0209257_1000012
563 Ga0209257_1000045
564 Ga0207647_10055119
565 Ga0207647_10077683
566 Ga0207695_10003429
567 Ga0207695_10005064
568 Ga0207695_10169741
569 Ga0207671_10001495
570 Ga0207693_10027472
571 Ga0207657_10017935
572 Ga0207694_10000176
573 Ga0207690_10002863
574 Ga0207706_10014854
575 Ga0207709_10013137
576 Ga0207689_10092952
577 Ga0207667_10017312
578 Ga0207678_10001691
579 Ga0207648_10000142
580 Ga0207698_10024832
581 Ga0209371_1000575
582 Ga0209371_1001567
583 Ga0209282_1000035
584 Ga0209974_10000306
585 Ga0268266_10012109
586 Ga0307515_10000022
587 Ga0307515_10000191
588 Ga0307515_10025661
589 Ga0307515_10058388
590 Ga0268256_1000875
591 Ga0268256_1001343
592 Ga0307513_10026755
593 Ga0307509_10057726
594 Ga0307408_100003563
595 Ga0307508_10000017
596 Ga0307516_10036093
597 Ga0307405_10036191
598 Ga0307412_10000056
599 Ga0307409_100200170
600 Ga0307416_100009684
601 Ga0307414_10035859
602 Ga0395899_0001564
603 Ga0395899_0003106
604 Ga0395899_0012064
605 Ga0395899_0012534
606 Ga0395900_0008097
607 Ga0395900_0011209
608 Ga0395900_0013558
609 Ga0395900_0052641
610 Ga0395900_0064536
611 Ga0395900_0154753
612 Ga0395900_0276116
613 Ga0395898_0031295
614 Ga0395905_0002605
615 Ga0395905_0009528
616 Ga0395905_0023360
617 Ga0395905_0033634
618 Ga0395905_0081051
619 Ga0395905_0087621
620 Ga0395901_0002522
621 Ga0395901_0003709
622 Ga0436361_0037196
623 Ga0439436_0015587
624 Ga0439436_0026500
625 Ga0439449_0002251
626 Ga0439462_0003530
627 Ga0450911_001137
628 Ga0450912_000284
629 Ga0450898_000983
630 Ga0450898_001580
631 Ga0439446_0004830
632 Ga0439434_0008896
633 Ga0439435_0035206
634 Ga0439464_0008229
635 Ga0450893_0004321
636 Ga0451577_0113064
637 Ga0466972_0000285
638 Ga0466972_0000508
639 Ga0453683_0001993
640 Ga0466965_0000473
641 Ga0466964_0001829
642 Ga0466968_0001709
643 Ga0466970_0061413
644 Ga0466959_0005993
645 Ga0451576_0082807
646 Ga0466967_0094770
647 Ga0495592_0121385
648 Ga0495603_0000734
649 Ga0495603_0003264
650 Ga0495603_0124045
651 Ga0495590_0001899
652 Ga0495590_0004680
653 Ga0495590_0023900
654 Ga0495591_001305
655 Ga0495629_0000162
656 Ga0495629_0001379
657 Ga0495629_0030147
658 Ga0495638_0014949
659 Ga0495641_0010319
660 Ga0495651_0049019
661 Ga0495651_0065939
662 Ga0495651_0069576
663 Ga0495653_0001542
664 Ga0495653_0001687
665 Ga0495653_0046313
666 Ga0495650_0044361
667 Ga0495580_0001709
668 Ga0495580_0002400
669 Ga0495580_0014280
670 Ga0495580_0016881
671 Ga0495580_0046826
672 Ga0495580_0066304
673 Ga0495582_0002198
674 Ga0495582_0011445
675 Ga0495582_0012580
676 Ga0495605_0003171
677 Ga0495605_0010333
678 Ga0495605_0010922
679 Ga0495605_0033489
680 Ga0495662_0010139
681 Ga0495664_0001070
682 Ga0495664_0064029
683 Ga0495664_0080578
684 Ga0495596_0001163
685 Ga0495596_0001951
686 Ga0495596_0006023
687 Ga0495607_0025059
688 Ga0495583_0049756
689 Ga0495606_0014872
690 Ga0495608_0003857
691 Ga0495608_0026341
692 Ga0495610_0003726
693 Ga0495610_0004088
694 Ga0495616_0002965
695 Ga0495618_0002471
696 Ga0495618_0004161
697 Ga0495618_0091420
698 Ga0495628_0003612
699 Ga0495628_0039403
700 Ga0495628_0062856
701 Ga0495628_0071348
702 Ga0495630_0033931
703 Ga0495630_0058295
704 Ga0495630_0132741
705 Ga0495630_0223823
706 Ga0495632_0007474
707 Ga0495643_0042666
708 Ga0495643_0105249
709 Ga0495648_0004162
710 Ga0495648_0055208
711 Ga0495666_0001360
712 Ga0495666_0022087
713 Ga0495652_0018699
714 Ga0495652_0025160
715 Ga0495652_0135087
716 Ga0495665_0003493
717 Ga0495665_0007415
718 Ga0495665_0030535
719 Ga0495640_0003238
720 Ga0495640_0008301
721 Ga0495640_0034329
722 Ga0495586_0002228
723 Ga0495587_0000463
724 Ga0495587_0049249
725 Ga0495587_0091958
726 Ga0495609_0002440
727 Ga0495597_0012347
728 Ga0495645_0025548
729 Ga0495622_0000349
730 Ga0495634_0062712
731 Ga0495611_0041593
732 Ga0495625_0005094
733 Ga0495635_0002193
734 Ga0495635_0004444
735 Ga0495661_0007612
736 Ga0495661_0017318
737 Ga0495657_0055655
738 Ga0495599_0002788
739 Ga0495599_0007738
740 Ga0495599_0009016
741 Ga0495599_0085588
742 Ga0495599_0108642
743 Ga0495623_0004772
744 Ga0495623_0035512
745 Ga0495646_0002044
746 Ga0495646_0002817
747 Ga0495646_0021344
748 Ga0495613_0001086
749 Ga0495613_0013650
750 Ga0495624_0002939
751 Ga0495624_0009490
752 Ga0495624_0018705
753 Ga0495624_0024364
754 Ga0495671_0003485
755 Ga0495649_0003524
756 Ga0495649_0007972
757 Ga0495649_0027318
758 Ga0495649_0113134
759 Ga0495589_0011814
760 Ga0495589_0051191
761 Ga0495600_0002282
762 Ga0495581_0001139
763 Ga0495581_0004859
764 Ga0495581_0051999
765 Ga0495604_0010632
766 Ga0495604_0028746
767 Ga0495604_0057275
768 Ga0495604_0088750
769 Ga0495674_0020747
770 Ga0495674_0025864
771 Ga0495674_0043644
772 Ga0495672_0031806
773 Ga0495672_0076739
774 Ga0495676_0014085
775 Ga0495676_0019564
776 Ga0495676_0063101
777 Ga0495680_0002154
778 Ga0495680_0033806
779 Ga0495683_0003086
780 Ga0495683_0010632
781 Ga0495683_0014922
782 Ga0495683_0059779
783 Ga0495687_013771
784 Ga0495687_036743
785 Ga0495687_069939
786 Ga0495675_0011029
787 Ga0495679_000617
788 Ga0495679_000750
789 Ga0495679_006448
790 Ga0495673_0029863
791 Ga0495673_0036738
792 Ga0495684_0035145
793 Ga0495593_0003694
794 Ga0495593_0032068
795 Ga0495602_0015150
796 Ga0495602_0019599
797 Ga0495602_0020786
798 Ga0495614_0005364
799 Ga0495626_0034692
800 Ga0495626_0039379
801 Ga0496101_0007655
802 Ga0496102_0013902
803 Ga0496102_0017849
804 Ga0496103_0001492
805 Ga0496103_0030670
806 Ga0496105_0141476
807 Ga0496106_0000162
808 Ga0496112_0200104
809 Ga0496113_0166456
810 Ga0496116_0082271
811 Ga0496117_0007541
812 Ga0496117_0096328
813 Ga0496118_0008687
814 Ga0496118_0017211
815 Ga0496119_0050867
816 Ga0496121_0006767
817 Ga0496121_0009882
818 Ga0496121_0018436
819 Ga0496121_0022736
820 Ga0496121_0047118
821 Ga0496121_0065386
822 Ga0496121_0087006
823 Ga0496122_0003093
824 Ga0496123_0002770
825 Ga0496124_0152719
826 Ga0496125_0012086
827 Ga0496125_0034876
828 Ga0496126_0004713
829 Ga0496126_0004910
830 Ga0495682_0051860
831 Ga0501043_0000141
832 Ga0501046_0000047
833 Ga0501047_0000058
834 Ga0501047_0070809
835 Ga0501047_0166089
836 Ga0501048_0000475
837 Ga0501263_001653
838 Ga0501035_0110313
839 Ga0501044_0017880
840 Ga0501044_0078280
841 Ga0501045_0074856
842 nmdc:mga07m45_5769_c1
843 Ga0500578_0018907
844 Ga0500658_0040856
845 Ga0466962_0107799
846 8020953446
847 2501084082
848 2501414392
849 2509130812
850 2511093365
851 2511099815
852 2511102414
853 2512348407
854 2513956863
855 2513962631
856 2514043393
857 2516022267
858 2527080622
859 2563061559
860 2587755156
861 2599741082
862 2599748389
863 2600210301
864 2676745774
865 2713478576
866 2738823994
867 2738836385
868 2738877915
869 2739189621
870 2739224508
871 2746087259
872 2746093234
873 2819636838
874 2834642025
875 2842332154
876 2842356394
877 2842461252
878 2856289370
879 2857362243
880 2863426457
881 2870069363
882 2883091401
883 2885272393
884 2900637102
885 2904442367
886 2904490149
887 2904569378
888 2904576785
889 2919050618
890 2919533318
891 2928176295
892 2928542055
893 2945934533
894 2990704908
895 642426572
896 642623169
897 644747751
898 8003404433
899 8018847968
900 8020939007
901 8020947723
902 8021127552
903 8039099702
904 8055307381

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01266

DAO

FAD dependent oxidoreductase

1

438

0.9

PF13450

NAD_binding_8

NAD(P)-binding Rossmann-like domain

1

58

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oc4-assembly1.cif.gz_A crystal structure of a pyridine nucleotide-disulfide family oxidoreductase from the enterococcus faecalis v583 0.8815 198 246
3oc4-assembly1.cif.gz_B crystal structure of a pyridine nucleotide-disulfide family oxidoreductase from the enterococcus faecalis v583 0.875 198 246
3itj-assembly2.cif.gz_C crystal structure of saccharomyces cerevisiae thioredoxin reductase 1 (trr1) 0.8746 203 239
7cyx-assembly1.cif.gz_A crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 0.8518 2 395
4ysh-assembly1.cif.gz_A crystal structure of glycine oxidase from geobacillus kaustophilus 0.8485 2 406
ID Description Score Start End Superfamily
4ykgA03 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8803 192 236 3.50.50.60
3ctyB02 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8711 193 245 3.50.50.60
af_P96261_93_276_3.30.9.10 Alpha Beta;2-Layer Sandwich;D-Amino Acid Oxidase; Chain A, domain 2;D-Amino Acid Oxidase, subunit A, domain 2 0.869 126 332 3.30.9.10
3gsiA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8641 184 406 3.50.50.60
3e1tA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8639 188 246 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A839A0Z1-F1-model_v4 deleted 0.9677 2 398
AF-A0A6N9SSC0-F1-model_v4 FAD-dependent oxidoreductase 0.9669 2 398 GO:0005737
GO:0005886
GO:0008718
GO:0055130
AF-A4SNB0-F1-model_v4 D-amino acid dehydrogenase (EC 1.4.99.-) 0.9661 2 407 GO:0005737
GO:0005886
GO:0008718
GO:0055130
AF-A0A8B3G9I7-F1-model_v4 deleted 0.9658 237 409
AF-A0A847DWZ4-F1-model_v4 D-amino acid dehydrogenase 0.9654 2 408 GO:0005737
GO:0005886
GO:0008718
GO:0055130

Map