F447146

General Info

Members Datasets Scaffolds Average Seq Length
453 278 906 129

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100043330|Ga0070707_1000433303
Length 138
Sequence MSSSREGGVVTAKEVVLTDAAPAPFQGAPYSQAIKAGGFVFVSGQLALEPGHTELRGGTIQEQTEQIFANLAAILQQAGTGLDRLVKTTVFLQDLADFQGMNEVYARHVGDLPPARSTVEVAKLPSGARVEIEAVASL

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
127 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
128 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
129 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
130 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
131 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
136 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
137 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
138 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
139 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
140 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
141 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
142 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
143 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
153 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
154 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
167 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
168 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
169 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
170 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
171 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
172 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
175 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
176 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
177 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
178 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
179 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
180 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
181 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
182 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
183 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
184 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
185 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
186 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
187 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
188 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
189 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
190 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
191 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
192 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
193 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
194 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
195 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
196 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
197 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
198 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
206 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
207 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
208 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
209 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
212 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
216 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
217 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
218 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
219 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
220 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
221 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
222 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
223 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
224 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
225 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
226 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
227 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
228 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
229 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
230 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
244 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
245 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
246 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
247 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
255 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
256 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
257 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
258 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
261 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
262 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
263 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
268 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
274 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
275 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
276 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
277 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
278 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 8.17
Rhizosphere 89.62
Stem 0
Stem Tuber 0
Unclassified 12.8

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100043330 3300005468 Bacteria 4308
2 SwRhRL2b_contig_867711 2162886007 Bacteria 3145
3 JGI24740J21852_10000496 3300001979 Bacteria 16887
4 JGI24740J21852_10019091 3300001979 Bacteria 2420
5 JGI24739J22299_10000610 3300001989 Bacteria 12885
6 JGI24737J22298_10171319 3300001990 Unclassified 641
7 Ga0065704_10086205 3300005289 Bacteria 3144
8 Ga0070658_10864348 3300005327 Bacteria 786
9 Ga0070658_11904726 3300005327 Bacteria 514
10 Ga0070690_100453726 3300005330 Unclassified 951
11 Ga0070660_100792732 3300005339 Unclassified 797
12 Ga0070691_10987884 3300005341 Bacteria 524
13 Ga0070661_100028740 3300005344 Bacteria 4012
14 Ga0070675_100261340 3300005354 Bacteria 1517
15 Ga0070671_100016842 3300005355 Bacteria 5910
16 Ga0070674_102131389 3300005356 Bacteria 512
17 Ga0070688_101135173 3300005365 Unclassified 626
18 Ga0070659_100011631 3300005366 Bacteria 6511
19 Ga0070709_10361560 3300005434 Bacteria 1075
20 Ga0070714_100106129 3300005435 Bacteria 2481
21 Ga0070713_100173622 3300005436 Bacteria 1932
22 Ga0070710_10765010 3300005437 Bacteria 687
23 Ga0070701_10497287 3300005438 Archaea 791
24 Ga0070711_100345737 3300005439 Bacteria 1195
25 Ga0070705_101108576 3300005440 Unclassified 648
26 Ga0070700_100678011 3300005441 Bacteria 817
27 Ga0070694_101095609 3300005444 Bacteria 664
28 Ga0070708_100048582 3300005445 Bacteria 3751
29 Ga0070663_100031134 3300005455 Bacteria 3664
30 Ga0070678_100711979 3300005456 Bacteria 905
31 Ga0070662_100015187 3300005457 Bacteria 5154
32 Ga0070681_11563506 3300005458 Unclassified 585
33 Ga0070685_11059414 3300005466 Unclassified 611
34 Ga0070706_100029249 3300005467 Bacteria 5076
35 Ga0070706_100363946 3300005467 Bacteria 1347
36 Ga0070706_100668771 3300005467 Bacteria 964
37 Ga0070706_101112982 3300005467 Unclassified 727
38 Ga0070707_100003768 3300005468 Bacteria 14293
39 Ga0070707_101612163 3300005468 Unclassified 616
40 Ga0070698_100083452 3300005471 Bacteria 3184
41 Ga0070699_100036836 3300005518 Bacteria 4232
42 Ga0070699_100047391 3300005518 Bacteria 3719
43 Ga0070699_100206519 3300005518 Bacteria 1748
44 Ga0070699_100245925 3300005518 Bacteria 1598
45 Ga0070679_102038491 3300005530 Unclassified 523
46 Ga0068853_100002357 3300005539 Bacteria 14135
47 Ga0068853_100092944 3300005539 Bacteria 2654
48 Ga0070672_100189537 3300005543 Unclassified 1716
49 Ga0070686_100091934 3300005544 Bacteria 2031
50 Ga0070695_100954187 3300005545 Unclassified 695
51 Ga0070704_100854993 3300005549 Bacteria 816
52 Ga0068855_100154154 3300005563 Bacteria 2611
53 Ga0068855_100308718 3300005563 Bacteria 1751
54 Ga0070664_100044227 3300005564 Bacteria 3760
55 Ga0068857_100041698 3300005577 Bacteria 4070
56 Ga0068854_100047940 3300005578 Bacteria 3046
57 Ga0068852_100596339 3300005616 Bacteria 1109
58 Ga0068852_101601720 3300005616 Bacteria 674
59 Ga0068866_10450890 3300005718 Bacteria 841
60 Ga0068851_10036172 3300005834 Bacteria 2471
61 Ga0068862_100986934 3300005844 Bacteria 832
62 Ga0081540_1278310 3300005983 Unclassified 578
63 Ga0081539_10001773 3300005985 Bacteria 34339
64 Ga0070717_10046305 3300006028 Bacteria 3558
65 Ga0070717_11564768 3300006028 Unclassified 598
66 Ga0070715_10261170 3300006163 Bacteria 910
67 Ga0070716_100188144 3300006173 Bacteria 1362
68 Ga0070716_100326677 3300006173 Bacteria 1077
69 Ga0070716_101126738 3300006173 Bacteria 627
70 Ga0070712_100012119 3300006175 Bacteria 5479
71 Ga0070712_100137214 3300006175 Bacteria 1861
72 Ga0070712_100244925 3300006175 Bacteria 1430
73 Ga0075370_10032799 3300006353 Bacteria 2905
74 Ga0068871_100230558 3300006358 Bacteria 1607
75 Ga0075428_100009861 3300006844 Bacteria 10614
76 Ga0075428_102664074 3300006844 Unclassified 510
77 Ga0075436_100328299 3300006914 Bacteria 1100
78 Ga0075436_101471232 3300006914 Bacteria 517
79 Ga0105244_10000470 3300009036 Bacteria 36794
80 Ga0105240_10072600 3300009093 Bacteria 4253
81 Ga0105240_10570303 3300009093 Bacteria 1250
82 Ga0111539_10050603 3300009094 Bacteria 4949
83 Ga0111539_10988294 3300009094 Bacteria 978
84 Ga0105245_10067639 3300009098 Bacteria 3236
85 Ga0114129_10029648 3300009147 Bacteria 7749
86 Ga0114129_10424288 3300009147 Bacteria 1749
87 Ga0105243_10004987 3300009148 Bacteria 10401
88 Ga0105243_10215331 3300009148 Bacteria 1694
89 Ga0105243_11764504 3300009148 Bacteria 649
90 Ga0105241_10647497 3300009174 Bacteria 959
91 Ga0105242_10082186 3300009176 Bacteria 2695
92 Ga0105242_10395280 3300009176 Bacteria 1288
93 Ga0105242_10616125 3300009176 Bacteria 1051
94 Ga0105242_11862416 3300009176 Bacteria 641
95 Ga0105248_10131724 3300009177 Bacteria 2821
96 Ga0105237_10367942 3300009545 Bacteria 1442
97 Ga0105237_11375059 3300009545 Bacteria 712
98 Ga0105238_10241458 3300009551 Bacteria 1784
99 Ga0105238_10623752 3300009551 Bacteria 1087
100 Ga0105249_12483708 3300009553 Bacteria 591
101 Ga0105239_10161780 3300010375 Bacteria 2501
102 Ga0105239_10418929 3300010375 Unclassified 1517
103 Ga0105246_10000099 3300011119 Bacteria 37789
104 Ga0157371_10051845 3300013102 Bacteria 2915
105 Ga0157370_11832474 3300013104 Bacteria 544
106 Ga0157370_11998047 3300013104 Unclassified 520
107 Ga0157369_10043118 3300013105 Bacteria 4919
108 Ga0157374_10158012 3300013296 Unclassified 2207
109 Ga0157378_11659394 3300013297 Unclassified 686
110 Ga0157372_10005814 3300013307 Bacteria 13138
111 Ga0157375_10191211 3300013308 Bacteria 2201
112 Ga0157375_10568288 3300013308 Unclassified 1295
113 Ga0157375_11768652 3300013308 Unclassified 732
114 Ga0157380_10822476 3300014326 Bacteria 948
115 Ga0157380_11750480 3300014326 Bacteria 680
116 Ga0182008_10083925 3300014497 Unclassified 1568
117 Ga0157377_11140157 3300014745 Archaea 600
118 Ga0157376_10204427 3300014969 Bacteria 1819
119 Ga0182006_1033605 3300015261 Bacteria 2055
120 Ga0182006_1270143 3300015261 Bacteria 558
121 Ga0207655_1000845 3300025728 Bacteria 32859
122 Ga0207692_10317258 3300025898 Bacteria 953
123 Ga0207680_10600001 3300025903 Bacteria 788
124 Ga0207685_10091068 3300025905 Bacteria 1284
125 Ga0207699_10433850 3300025906 Bacteria 940
126 Ga0207699_10710454 3300025906 Bacteria 736
127 Ga0207699_10997381 3300025906 Bacteria 619
128 Ga0207684_10840881 3300025910 Bacteria 774
129 Ga0207684_10935325 3300025910 Unclassified 727
130 Ga0207654_10053683 3300025911 Bacteria 2327
131 Ga0207707_11203939 3300025912 Unclassified 613
132 Ga0207695_10028498 3300025913 Bacteria 6191
133 Ga0207695_10567833 3300025913 Bacteria 1016
134 Ga0207693_10005349 3300025915 Bacteria 10728
135 Ga0207693_10034636 3300025915 Bacteria 3983
136 Ga0207693_10051929 3300025915 Bacteria 3215
137 Ga0207693_10061118 3300025915 Bacteria 2951
138 Ga0207663_10055108 3300025916 Bacteria 2493
139 Ga0207663_10165577 3300025916 Bacteria 1565
140 Ga0207663_11023535 3300025916 Bacteria 663
141 Ga0207657_10472114 3300025919 Bacteria 984
142 Ga0207649_10164798 3300025920 Bacteria 1539
143 Ga0207646_10002487 3300025922 Bacteria 21765
144 Ga0207646_10032149 3300025922 Bacteria 4748
145 Ga0207646_10065602 3300025922 Bacteria 3242
146 Ga0207646_10381894 3300025922 Bacteria 1272
147 Ga0207694_10042929 3300025924 Bacteria 3489
148 Ga0207659_10198479 3300025926 Bacteria 1601
149 Ga0207687_10368932 3300025927 Unclassified 1173
150 Ga0207700_10162126 3300025928 Unclassified 1858
151 Ga0207700_10164125 3300025928 Bacteria 1847
152 Ga0207664_10053799 3300025929 Bacteria 3188
153 Ga0207664_10292121 3300025929 Unclassified 1432
154 Ga0207664_11042911 3300025929 Bacteria 732
155 Ga0207644_10470209 3300025931 Bacteria 1034
156 Ga0207690_10591149 3300025932 Bacteria 905
157 Ga0207690_11098777 3300025932 Bacteria 663
158 Ga0207706_10016107 3300025933 Bacteria 6753
159 Ga0207686_10419519 3300025934 Bacteria 1023
160 Ga0207686_10561067 3300025934 Bacteria 894
161 Ga0207709_10006499 3300025935 Bacteria 6565
162 Ga0207709_10482453 3300025935 Bacteria 964
163 Ga0207709_10488017 3300025935 Bacteria 959
164 Ga0207669_10887856 3300025937 Bacteria 744
165 Ga0207669_11654133 3300025937 Bacteria 547
166 Ga0207665_10071834 3300025939 Unclassified 2363
167 Ga0207665_10223031 3300025939 Bacteria 1382
168 Ga0207691_10403428 3300025940 Archaea 1166
169 Ga0207711_10262585 3300025941 Bacteria 1587
170 Ga0207679_10844193 3300025945 Bacteria 836
171 Ga0207667_10180257 3300025949 Bacteria 2169
172 Ga0207651_10107590 3300025960 Unclassified 2085
173 Ga0207668_10123044 3300025972 Bacteria 1968
174 Ga0207640_10208710 3300025981 Bacteria 1486
175 Ga0207640_11125681 3300025981 Bacteria 695
176 Ga0207639_10004983 3300026041 Bacteria 8945
177 Ga0207639_10699013 3300026041 Bacteria 941
178 Ga0207678_10008313 3300026067 Bacteria 9146
179 Ga0207708_10992477 3300026075 Bacteria 729
180 Ga0207702_10118494 3300026078 Bacteria 2365
181 Ga0207702_10585477 3300026078 Bacteria 1094
182 Ga0207676_11285758 3300026095 Unclassified 726
183 Ga0207674_10110987 3300026116 Bacteria 2717
184 Ga0207674_11878049 3300026116 Unclassified 565
185 Ga0207698_10572300 3300026142 Bacteria 1110
186 Ga0207698_11164700 3300026142 Bacteria 784
187 Ga0207428_11111013 3300027907 Archaea 552
188 Ga0265326_10106632 3300028558 Bacteria 795
189 Ga0265319_1002685 3300028563 Bacteria 9536
190 Ga0265319_1058904 3300028563 Bacteria 1250
191 Ga0265334_10014584 3300028573 Bacteria 3275
192 Ga0265318_10003437 3300028577 Bacteria 7951
193 Ga0265318_10037665 3300028577 Bacteria 1852
194 Ga0265323_10094388 3300028653 Bacteria 996
195 Ga0265323_10199483 3300028653 Bacteria 630
196 Ga0265336_10041329 3300028666 Bacteria 1410
197 Ga0265336_10172491 3300028666 Bacteria 643
198 Ga0265338_10027497 3300028800 Bacteria 5704
199 Ga0265338_10156929 3300028800 Bacteria 1761
200 Ga0265338_10212559 3300028800 Bacteria 1450
201 Ga0265320_10013715 3300031240 Bacteria 4647
202 Ga0265320_10119215 3300031240 Bacteria 1204
203 Ga0265325_10010451 3300031241 Bacteria 5375
204 Ga0265325_10026009 3300031241 Bacteria 3175
205 Ga0265325_10046823 3300031241 Bacteria 2241
206 Ga0265329_10009613 3300031242 Bacteria 3595
207 Ga0265340_10008909 3300031247 Bacteria 5407
208 Ga0265340_10326663 3300031247 Bacteria 679
209 Ga0265339_10002969 3300031249 Bacteria 11982
210 Ga0265339_10059176 3300031249 Bacteria 2067
211 Ga0265339_10354667 3300031249 Bacteria 691
212 Ga0265331_10073320 3300031250 Bacteria 1599
213 Ga0265327_10034510 3300031251 Bacteria 2806
214 Ga0265327_10095198 3300031251 Bacteria 1446
215 Ga0265327_10108717 3300031251 Bacteria 1328
216 Ga0265316_10038732 3300031344 Bacteria 3836
217 Ga0265316_10046426 3300031344 Bacteria 3442
218 Ga0265316_10111701 3300031344 Bacteria 2069
219 Ga0307408_100009990 3300031548 Bacteria 6253
220 Ga0307408_100026827 3300031548 Bacteria 3962
221 Ga0307408_100036138 3300031548 Bacteria 3471
222 Ga0307408_100067478 3300031548 Bacteria 2631
223 Ga0307408_101226842 3300031548 Bacteria 700
224 Ga0307408_101355173 3300031548 Unclassified 668
225 Ga0265313_10034710 3300031595 Bacteria 2547
226 Ga0265313_10161856 3300031595 Bacteria 950
227 Ga0316575_10376224 3300031665 Bacteria 607
228 Ga0265314_10012411 3300031711 Bacteria 6954
229 Ga0265314_10032704 3300031711 Bacteria 3822
230 Ga0265314_10583600 3300031711 Unclassified 578
231 Ga0265342_10012098 3300031712 Bacteria 5857
232 Ga0265342_10038293 3300031712 Bacteria 2921
233 Ga0265342_10394189 3300031712 Bacteria 716
234 Ga0307405_10007442 3300031731 Bacteria 5477
235 Ga0307405_10135401 3300031731 Unclassified 1709
236 Ga0307405_10189686 3300031731 Bacteria 1483
237 Ga0307413_10284855 3300031824 Bacteria 1245
238 Ga0307406_10009350 3300031901 Bacteria 5493
239 Ga0307406_10313722 3300031901 Bacteria 1210
240 Ga0307407_10255447 3300031903 Bacteria 1203
241 Ga0307412_10010654 3300031911 Bacteria 5299
242 Ga0307412_10083618 3300031911 Bacteria 2213
243 Ga0307412_10257469 3300031911 Bacteria 1358
244 Ga0307412_10363960 3300031911 Bacteria 1165
245 Ga0307416_100014449 3300032002 Bacteria 5414
246 Ga0307416_100135251 3300032002 Unclassified 2228
247 Ga0307416_100823378 3300032002 Bacteria 1025
248 Ga0307414_10217668 3300032004 Unclassified 1565
249 Ga0307414_10922064 3300032004 Bacteria 801
250 Ga0307411_10012674 3300032005 Bacteria 4614
251 Ga0373951_0145784 3300035091 Bacteria 660
252 Ga0373943_0488306 3300035170 Unclassified 719
253 Ga0373931_0042472 3300035691 Bacteria 2391
254 Ga0373935_0137661 3300035692 Bacteria 1647
255 Ga0373927_0001179 3300035695 Bacteria 19816
256 Ga0373937_0308788 3300036401 Bacteria 1496
257 Ga0373925_0002031 3300037068 Bacteria 16719
258 Ga0395899_0010635 3300037312 Bacteria 7052
259 Ga0395899_0049494 3300037312 Bacteria 3124
260 Ga0395899_0092019 3300037312 Unclassified 2196
261 Ga0395899_0198058 3300037312 Bacteria 1402
262 Ga0395900_0001024 3300037418 Bacteria 35866
263 Ga0395900_0012687 3300037418 Bacteria 8614
264 Ga0395900_0013415 3300037418 Bacteria 8372
265 Ga0395900_0017742 3300037418 Bacteria 7263
266 Ga0395900_0067134 3300037418 Bacteria 3684
267 Ga0395900_0355486 3300037418 Bacteria 1437
268 Ga0395900_0436672 3300037418 Bacteria 1267
269 Ga0395900_0666967 3300037418 Bacteria 976
270 Ga0395898_0002538 3300037466 Bacteria 21397
271 Ga0395898_0004773 3300037466 Bacteria 14746
272 Ga0395898_0045782 3300037466 Bacteria 4299
273 Ga0395898_0055158 3300037466 Bacteria 3876
274 Ga0395898_0671848 3300037466 Unclassified 978
275 Ga0395898_1467356 3300037466 Bacteria 609
276 Ga0395905_0005256 3300037471 Bacteria 13245
277 Ga0395905_0014723 3300037471 Bacteria 7457
278 Ga0395905_0022631 3300037471 Bacteria 5941
279 Ga0395905_0175260 3300037471 Bacteria 2013
280 Ga0395905_0188183 3300037471 Bacteria 1937
281 Ga0395905_0210477 3300037471 Bacteria 1822
282 Ga0395905_0312684 3300037471 Bacteria 1459
283 Ga0395905_0992025 3300037471 Bacteria 743
284 Ga0395901_0001193 3300038443 Bacteria 27667
285 Ga0395901_0004483 3300038443 Bacteria 14079
286 Ga0395901_0006596 3300038443 Bacteria 11730
287 Ga0395901_0012045 3300038443 Bacteria 8772
288 Ga0395901_0234226 3300038443 Bacteria 1916
289 Ga0395901_0436887 3300038443 Bacteria 1340
290 Ga0395901_0621761 3300038443 Bacteria 1087
291 Ga0395901_0629014 3300038443 Bacteria 1079
292 Ga0395901_1539940 3300038443 Bacteria 620
293 Ga0395901_2025268 3300038443 Bacteria 522
294 Ga0439436_0000043 3300041404 Bacteria 37576
295 Ga0439438_039493 3300041405 Bacteria 1229
296 Ga0439439_0011349 3300041406 Bacteria 2142
297 Ga0439447_000771 3300041407 Bacteria 11797
298 Ga0439453_0005941 3300041408 Bacteria 1882
299 Ga0439461_0009620 3300041410 Bacteria 1756
300 Ga0439466_0000999 3300041411 Bacteria 10878
301 Ga0439466_0001208 3300041411 Bacteria 10045
302 Ga0451853_0971624 3300041512 Unclassified 518
303 Ga0439431_0021738 3300041997 Bacteria 1542
304 Ga0439431_0102554 3300041997 Bacteria 787
305 Ga0439441_125583 3300042001 Unclassified 591
306 Ga0439442_003834 3300042002 Bacteria 2978
307 Ga0439442_004041 3300042002 Bacteria 2908
308 Ga0439445_0028420 3300042004 Bacteria 1441
309 Ga0439448_0134176 3300042005 Unclassified 854
310 Ga0439432_000617 3300042006 Bacteria 13386
311 Ga0439449_0000003 3300042007 Bacteria 94735
312 Ga0439449_0059135 3300042007 Bacteria 1415
313 Ga0439450_104023 3300042008 Unclassified 722
314 Ga0439451_001527 3300042009 Bacteria 4577
315 Ga0439452_001291 3300042010 Bacteria 10594
316 Ga0439454_004214 3300042011 Bacteria 1643
317 Ga0439455_0024055 3300042012 Unclassified 1471
318 Ga0439457_001657 3300042014 Bacteria 6616
319 Ga0439462_0000534 3300042015 Bacteria 7553
320 Ga0450911_045065 3300042115 Unclassified 573
321 Ga0450894_007090 3300042131 Bacteria 1444
322 Ga0450898_108581 3300042134 Unclassified 585
323 Ga0450899_007006 3300042135 Bacteria 1224
324 Ga0450899_051280 3300042135 Unclassified 527
325 Ga0450906_010901 3300042145 Bacteria 1709
326 Ga0450907_029903 3300042146 Unclassified 925
327 Ga0450910_014212 3300042147 Bacteria 1164
328 Ga0439446_0000550 3300042156 Bacteria 7579
329 Ga0439434_0019767 3300042435 Bacteria 2020
330 Ga0439434_0020999 3300042435 Bacteria 1961
331 Ga0439435_0021799 3300042436 Bacteria 1667
332 Ga0450918_000094 3300042531 Bacteria 18922
333 Ga0450918_002171 3300042531 Bacteria 3748
334 Ga0466965_0387634 3300044683 Bacteria 770
335 Ga0466966_0061523 3300044684 Bacteria 2368
336 Ga0466957_0237657 3300044842 Bacteria 1208
337 Ga0466959_0092691 3300045049 Bacteria 2168
338 Ga0466959_0141393 3300045049 Bacteria 1701
339 Ga0466958_0058101 3300045836 Bacteria 2352
340 Ga0466958_0169097 3300045836 Bacteria 1384
341 Ga0466967_0078043 3300045976 Bacteria 2982
342 Ga0466967_0086776 3300045976 Bacteria 2836
343 Ga0495629_0192269 3300046459 Bacteria 1412
344 Ga0495651_0374567 3300046462 Bacteria 935
345 Ga0495605_0055744 3300046474 Bacteria 1908
346 Ga0495584_0048242 3300046491 Bacteria 2147
347 Ga0495585_0092087 3300046492 Bacteria 1632
348 Ga0495630_0555185 3300046517 Bacteria 881
349 Ga0495644_0062890 3300046523 Bacteria 1395
350 Ga0495663_0050114 3300046525 Bacteria 1290
351 Ga0495640_0054524 3300046533 Bacteria 2738
352 Ga0495586_0496922 3300046535 Bacteria 704
353 Ga0495609_0138024 3300046538 Bacteria 1041
354 Ga0495656_0038612 3300046615 Bacteria 1979
355 Ga0495668_0132781 3300046616 Bacteria 1363
356 Ga0495611_0115697 3300046648 Bacteria 1250
357 Ga0495659_0008376 3300046664 Bacteria 3291
358 Ga0495588_0073001 3300046674 Bacteria 1786
359 Ga0495670_0799578 3300046691 Bacteria 515
360 Ga0495671_0127509 3300046692 Bacteria 1241
361 Ga0495589_0045229 3300046794 Bacteria 2187
362 Ga0495677_0069398 3300047445 Bacteria 1313
363 Ga0495685_131194 3300047447 Bacteria 819
364 Ga0496100_0031927 3300048903 Bacteria 3278
365 Ga0496100_0113188 3300048903 Bacteria 1888
366 Ga0496100_1579746 3300048903 Bacteria 518
367 Ga0496101_0059494 3300048904 Bacteria 2769
368 Ga0496101_0123258 3300048904 Bacteria 1961
369 Ga0496101_0207720 3300048904 Unclassified 1516
370 Ga0496102_0131806 3300048905 Bacteria 2340
371 Ga0496103_0018155 3300048906 Bacteria 4218
372 Ga0496104_0412595 3300048907 Bacteria 1263
373 Ga0496104_1729733 3300048907 Bacteria 528
374 Ga0496106_0097844 3300048909 Bacteria 2272
375 Ga0496106_0835483 3300048909 Bacteria 729
376 Ga0496107_0010666 3300048910 Bacteria 6389
377 Ga0496108_0010621 3300048911 Bacteria 7469
378 Ga0496108_0094263 3300048911 Bacteria 2548
379 Ga0496108_0731340 3300048911 Bacteria 857
380 Ga0496109_0013960 3300048912 Bacteria 6985
381 Ga0496109_0038581 3300048912 Bacteria 4319
382 Ga0496109_0046500 3300048912 Bacteria 3942
383 Ga0496110_0001516 3300048913 Bacteria 16857
384 Ga0496110_0526517 3300048913 Bacteria 1075
385 Ga0496110_0577372 3300048913 Bacteria 1021
386 Ga0496111_0001509 3300048914 Bacteria 13345
387 Ga0496111_0017242 3300048914 Bacteria 4991
388 Ga0496111_0719881 3300048914 Bacteria 725
389 Ga0496112_0016569 3300048915 Bacteria 6910
390 Ga0496112_0021006 3300048915 Bacteria 6201
391 Ga0496112_0060705 3300048915 Bacteria 3726
392 Ga0496112_0340044 3300048915 Unclassified 1444
393 Ga0496112_0485681 3300048915 Bacteria 1171
394 Ga0496113_0042246 3300048916 Bacteria 3368
395 Ga0496113_0056367 3300048916 Bacteria 2950
396 Ga0496113_0731326 3300048916 Unclassified 789
397 Ga0496114_0211376 3300048917 Bacteria 1701
398 Ga0496114_0228556 3300048917 Unclassified 1634
399 Ga0496114_1246340 3300048917 Bacteria 630
400 Ga0496115_0093433 3300048918 Bacteria 2460
401 Ga0496116_0023225 3300048919 Bacteria 4624
402 Ga0496117_0013280 3300048920 Bacteria 7196
403 Ga0496121_0037441 3300048924 Bacteria 4309
404 Ga0496122_0048275 3300048925 Bacteria 3276
405 Ga0496124_0008684 3300048927 Bacteria 10566
406 Ga0496125_0001750 3300048928 Bacteria 30140
407 Ga0501032_1054159 3300049569 Bacteria 510
408 Ga0501033_0993738 3300049570 Bacteria 561
409 Ga0501036_0199395 3300049572 Bacteria 1683
410 Ga0501039_0374091 3300049575 Bacteria 1119
411 Ga0501040_0061802 3300049576 Unclassified 2577
412 Ga0501046_0117135 3300049580 Bacteria 2029
413 Ga0501048_0580481 3300049582 Bacteria 805
414 Ga0501067_0066476 3300049583 Bacteria 1995
415 Ga0501067_0561690 3300049583 Bacteria 639
416 Ga0501068_0033034 3300049584 Bacteria 3080
417 Ga0501069_0037574 3300049585 Bacteria 2672
418 Ga0501071_0446241 3300049587 Unclassified 990
419 Ga0501072_0020493 3300049588 Bacteria 5125
420 Ga0501072_0204597 3300049588 Bacteria 1574
421 Ga0501072_0415307 3300049588 Bacteria 1067
422 Ga0501074_0316361 3300049590 Bacteria 1109
423 Ga0501075_0115371 3300049591 Bacteria 2042
424 Ga0501075_1171189 3300049591 Bacteria 583
425 Ga0501076_0000182 3300049592 Bacteria 37306
426 Ga0501076_0175253 3300049592 Bacteria 1748
427 Ga0501077_0093720 3300049593 Bacteria 1903
428 Ga0501077_0136227 3300049593 Bacteria 1557
429 Ga0501077_0220236 3300049593 Bacteria 1206
430 Ga0501079_0536160 3300049741 Unclassified 920
431 Ga0501080_0445739 3300049742 Bacteria 1161
432 Ga0501080_1180891 3300049742 Bacteria 658
433 Ga0501081_0007987 3300049743 Bacteria 6865
434 Ga0501081_0458086 3300049743 Unclassified 948
435 Ga0501035_0568320 3300049822 Unclassified 927
436 Ga0501045_0434537 3300049824 Bacteria 976
437 nmdc:mga0k408_62261_c1 3300050493 Bacteria 2169
438 nmdc:mga07m45_12761_c2 3300050496 Bacteria 4141
439 nmdc:mga05p37_408449_c1 3300050507 Bacteria 1583
440 nmdc:mga05p37_8824_c1 3300050507 Bacteria 7753
441 nmdc:mga06r32_215157_c1 3300050510 Bacteria 1909
442 nmdc:mga08y16_366671_c1 3300050511 Bacteria 1478
443 nmdc:mga08y16_958048_c1 3300050511 Bacteria 838
444 nmdc:mga08x19_1045608_c1 3300050514 Bacteria 580
445 nmdc:mga08x19_502647_c1 3300050514 Bacteria 856
446 Ga0495601_0351272 3300053077 Bacteria 959
447 Ga0495619_0317925 3300053085 Bacteria 1078
448 Ga0501084_0009813 3300054114 Bacteria 7915
449 Ga0466962_0217080 3300061719 Bacteria 936
450 Ga0530510_0009063 3300061734 Bacteria 6976
451 Ga0530510_0051710 3300061734 Bacteria 2969
452 Ga0530510_0180823 3300061734 Bacteria 1564
453 Ga0530510_0392215 3300061734 Unclassified 1046
454 Ga0070707_100043330
455 SwRhRL2b_contig_867711
456 JGI24740J21852_10000496
457 JGI24740J21852_10019091
458 JGI24739J22299_10000610
459 JGI24737J22298_10171319
460 Ga0065704_10086205
461 Ga0070658_10864348
462 Ga0070658_11904726
463 Ga0070690_100453726
464 Ga0070660_100792732
465 Ga0070691_10987884
466 Ga0070661_100028740
467 Ga0070675_100261340
468 Ga0070671_100016842
469 Ga0070674_102131389
470 Ga0070688_101135173
471 Ga0070659_100011631
472 Ga0070709_10361560
473 Ga0070714_100106129
474 Ga0070713_100173622
475 Ga0070710_10765010
476 Ga0070701_10497287
477 Ga0070711_100345737
478 Ga0070705_101108576
479 Ga0070700_100678011
480 Ga0070694_101095609
481 Ga0070708_100048582
482 Ga0070663_100031134
483 Ga0070678_100711979
484 Ga0070662_100015187
485 Ga0070681_11563506
486 Ga0070685_11059414
487 Ga0070706_100029249
488 Ga0070706_100363946
489 Ga0070706_100668771
490 Ga0070706_101112982
491 Ga0070707_100003768
492 Ga0070707_101612163
493 Ga0070698_100083452
494 Ga0070699_100036836
495 Ga0070699_100047391
496 Ga0070699_100206519
497 Ga0070699_100245925
498 Ga0070679_102038491
499 Ga0068853_100002357
500 Ga0068853_100092944
501 Ga0070672_100189537
502 Ga0070686_100091934
503 Ga0070695_100954187
504 Ga0070704_100854993
505 Ga0068855_100154154
506 Ga0068855_100308718
507 Ga0070664_100044227
508 Ga0068857_100041698
509 Ga0068854_100047940
510 Ga0068852_100596339
511 Ga0068852_101601720
512 Ga0068866_10450890
513 Ga0068851_10036172
514 Ga0068862_100986934
515 Ga0081540_1278310
516 Ga0081539_10001773
517 Ga0070717_10046305
518 Ga0070717_11564768
519 Ga0070715_10261170
520 Ga0070716_100188144
521 Ga0070716_100326677
522 Ga0070716_101126738
523 Ga0070712_100012119
524 Ga0070712_100137214
525 Ga0070712_100244925
526 Ga0075370_10032799
527 Ga0068871_100230558
528 Ga0075428_100009861
529 Ga0075428_102664074
530 Ga0075436_100328299
531 Ga0075436_101471232
532 Ga0105244_10000470
533 Ga0105240_10072600
534 Ga0105240_10570303
535 Ga0111539_10050603
536 Ga0111539_10988294
537 Ga0105245_10067639
538 Ga0114129_10029648
539 Ga0114129_10424288
540 Ga0105243_10004987
541 Ga0105243_10215331
542 Ga0105243_11764504
543 Ga0105241_10647497
544 Ga0105242_10082186
545 Ga0105242_10395280
546 Ga0105242_10616125
547 Ga0105242_11862416
548 Ga0105248_10131724
549 Ga0105237_10367942
550 Ga0105237_11375059
551 Ga0105238_10241458
552 Ga0105238_10623752
553 Ga0105249_12483708
554 Ga0105239_10161780
555 Ga0105239_10418929
556 Ga0105246_10000099
557 Ga0157371_10051845
558 Ga0157370_11832474
559 Ga0157370_11998047
560 Ga0157369_10043118
561 Ga0157374_10158012
562 Ga0157378_11659394
563 Ga0157372_10005814
564 Ga0157375_10191211
565 Ga0157375_10568288
566 Ga0157375_11768652
567 Ga0157380_10822476
568 Ga0157380_11750480
569 Ga0182008_10083925
570 Ga0157377_11140157
571 Ga0157376_10204427
572 Ga0182006_1033605
573 Ga0182006_1270143
574 Ga0207655_1000845
575 Ga0207692_10317258
576 Ga0207680_10600001
577 Ga0207685_10091068
578 Ga0207699_10433850
579 Ga0207699_10710454
580 Ga0207699_10997381
581 Ga0207684_10840881
582 Ga0207684_10935325
583 Ga0207654_10053683
584 Ga0207707_11203939
585 Ga0207695_10028498
586 Ga0207695_10567833
587 Ga0207693_10005349
588 Ga0207693_10034636
589 Ga0207693_10051929
590 Ga0207693_10061118
591 Ga0207663_10055108
592 Ga0207663_10165577
593 Ga0207663_11023535
594 Ga0207657_10472114
595 Ga0207649_10164798
596 Ga0207646_10002487
597 Ga0207646_10032149
598 Ga0207646_10065602
599 Ga0207646_10381894
600 Ga0207694_10042929
601 Ga0207659_10198479
602 Ga0207687_10368932
603 Ga0207700_10162126
604 Ga0207700_10164125
605 Ga0207664_10053799
606 Ga0207664_10292121
607 Ga0207664_11042911
608 Ga0207644_10470209
609 Ga0207690_10591149
610 Ga0207690_11098777
611 Ga0207706_10016107
612 Ga0207686_10419519
613 Ga0207686_10561067
614 Ga0207709_10006499
615 Ga0207709_10482453
616 Ga0207709_10488017
617 Ga0207669_10887856
618 Ga0207669_11654133
619 Ga0207665_10071834
620 Ga0207665_10223031
621 Ga0207691_10403428
622 Ga0207711_10262585
623 Ga0207679_10844193
624 Ga0207667_10180257
625 Ga0207651_10107590
626 Ga0207668_10123044
627 Ga0207640_10208710
628 Ga0207640_11125681
629 Ga0207639_10004983
630 Ga0207639_10699013
631 Ga0207678_10008313
632 Ga0207708_10992477
633 Ga0207702_10118494
634 Ga0207702_10585477
635 Ga0207676_11285758
636 Ga0207674_10110987
637 Ga0207674_11878049
638 Ga0207698_10572300
639 Ga0207698_11164700
640 Ga0207428_11111013
641 Ga0265326_10106632
642 Ga0265319_1002685
643 Ga0265319_1058904
644 Ga0265334_10014584
645 Ga0265318_10003437
646 Ga0265318_10037665
647 Ga0265323_10094388
648 Ga0265323_10199483
649 Ga0265336_10041329
650 Ga0265336_10172491
651 Ga0265338_10027497
652 Ga0265338_10156929
653 Ga0265338_10212559
654 Ga0265320_10013715
655 Ga0265320_10119215
656 Ga0265325_10010451
657 Ga0265325_10026009
658 Ga0265325_10046823
659 Ga0265329_10009613
660 Ga0265340_10008909
661 Ga0265340_10326663
662 Ga0265339_10002969
663 Ga0265339_10059176
664 Ga0265339_10354667
665 Ga0265331_10073320
666 Ga0265327_10034510
667 Ga0265327_10095198
668 Ga0265327_10108717
669 Ga0265316_10038732
670 Ga0265316_10046426
671 Ga0265316_10111701
672 Ga0307408_100009990
673 Ga0307408_100026827
674 Ga0307408_100036138
675 Ga0307408_100067478
676 Ga0307408_101226842
677 Ga0307408_101355173
678 Ga0265313_10034710
679 Ga0265313_10161856
680 Ga0316575_10376224
681 Ga0265314_10012411
682 Ga0265314_10032704
683 Ga0265314_10583600
684 Ga0265342_10012098
685 Ga0265342_10038293
686 Ga0265342_10394189
687 Ga0307405_10007442
688 Ga0307405_10135401
689 Ga0307405_10189686
690 Ga0307413_10284855
691 Ga0307406_10009350
692 Ga0307406_10313722
693 Ga0307407_10255447
694 Ga0307412_10010654
695 Ga0307412_10083618
696 Ga0307412_10257469
697 Ga0307412_10363960
698 Ga0307416_100014449
699 Ga0307416_100135251
700 Ga0307416_100823378
701 Ga0307414_10217668
702 Ga0307414_10922064
703 Ga0307411_10012674
704 Ga0373951_0145784
705 Ga0373943_0488306
706 Ga0373931_0042472
707 Ga0373935_0137661
708 Ga0373927_0001179
709 Ga0373937_0308788
710 Ga0373925_0002031
711 Ga0395899_0010635
712 Ga0395899_0049494
713 Ga0395899_0092019
714 Ga0395899_0198058
715 Ga0395900_0001024
716 Ga0395900_0012687
717 Ga0395900_0013415
718 Ga0395900_0017742
719 Ga0395900_0067134
720 Ga0395900_0355486
721 Ga0395900_0436672
722 Ga0395900_0666967
723 Ga0395898_0002538
724 Ga0395898_0004773
725 Ga0395898_0045782
726 Ga0395898_0055158
727 Ga0395898_0671848
728 Ga0395898_1467356
729 Ga0395905_0005256
730 Ga0395905_0014723
731 Ga0395905_0022631
732 Ga0395905_0175260
733 Ga0395905_0188183
734 Ga0395905_0210477
735 Ga0395905_0312684
736 Ga0395905_0992025
737 Ga0395901_0001193
738 Ga0395901_0004483
739 Ga0395901_0006596
740 Ga0395901_0012045
741 Ga0395901_0234226
742 Ga0395901_0436887
743 Ga0395901_0621761
744 Ga0395901_0629014
745 Ga0395901_1539940
746 Ga0395901_2025268
747 Ga0439436_0000043
748 Ga0439438_039493
749 Ga0439439_0011349
750 Ga0439447_000771
751 Ga0439453_0005941
752 Ga0439461_0009620
753 Ga0439466_0000999
754 Ga0439466_0001208
755 Ga0451853_0971624
756 Ga0439431_0021738
757 Ga0439431_0102554
758 Ga0439441_125583
759 Ga0439442_003834
760 Ga0439442_004041
761 Ga0439445_0028420
762 Ga0439448_0134176
763 Ga0439432_000617
764 Ga0439449_0000003
765 Ga0439449_0059135
766 Ga0439450_104023
767 Ga0439451_001527
768 Ga0439452_001291
769 Ga0439454_004214
770 Ga0439455_0024055
771 Ga0439457_001657
772 Ga0439462_0000534
773 Ga0450911_045065
774 Ga0450894_007090
775 Ga0450898_108581
776 Ga0450899_007006
777 Ga0450899_051280
778 Ga0450906_010901
779 Ga0450907_029903
780 Ga0450910_014212
781 Ga0439446_0000550
782 Ga0439434_0019767
783 Ga0439434_0020999
784 Ga0439435_0021799
785 Ga0450918_000094
786 Ga0450918_002171
787 Ga0466965_0387634
788 Ga0466966_0061523
789 Ga0466957_0237657
790 Ga0466959_0092691
791 Ga0466959_0141393
792 Ga0466958_0058101
793 Ga0466958_0169097
794 Ga0466967_0078043
795 Ga0466967_0086776
796 Ga0495629_0192269
797 Ga0495651_0374567
798 Ga0495605_0055744
799 Ga0495584_0048242
800 Ga0495585_0092087
801 Ga0495630_0555185
802 Ga0495644_0062890
803 Ga0495663_0050114
804 Ga0495640_0054524
805 Ga0495586_0496922
806 Ga0495609_0138024
807 Ga0495656_0038612
808 Ga0495668_0132781
809 Ga0495611_0115697
810 Ga0495659_0008376
811 Ga0495588_0073001
812 Ga0495670_0799578
813 Ga0495671_0127509
814 Ga0495589_0045229
815 Ga0495677_0069398
816 Ga0495685_131194
817 Ga0496100_0031927
818 Ga0496100_0113188
819 Ga0496100_1579746
820 Ga0496101_0059494
821 Ga0496101_0123258
822 Ga0496101_0207720
823 Ga0496102_0131806
824 Ga0496103_0018155
825 Ga0496104_0412595
826 Ga0496104_1729733
827 Ga0496106_0097844
828 Ga0496106_0835483
829 Ga0496107_0010666
830 Ga0496108_0010621
831 Ga0496108_0094263
832 Ga0496108_0731340
833 Ga0496109_0013960
834 Ga0496109_0038581
835 Ga0496109_0046500
836 Ga0496110_0001516
837 Ga0496110_0526517
838 Ga0496110_0577372
839 Ga0496111_0001509
840 Ga0496111_0017242
841 Ga0496111_0719881
842 Ga0496112_0016569
843 Ga0496112_0021006
844 Ga0496112_0060705
845 Ga0496112_0340044
846 Ga0496112_0485681
847 Ga0496113_0042246
848 Ga0496113_0056367
849 Ga0496113_0731326
850 Ga0496114_0211376
851 Ga0496114_0228556
852 Ga0496114_1246340
853 Ga0496115_0093433
854 Ga0496116_0023225
855 Ga0496117_0013280
856 Ga0496121_0037441
857 Ga0496122_0048275
858 Ga0496124_0008684
859 Ga0496125_0001750
860 Ga0501032_1054159
861 Ga0501033_0993738
862 Ga0501036_0199395
863 Ga0501039_0374091
864 Ga0501040_0061802
865 Ga0501046_0117135
866 Ga0501048_0580481
867 Ga0501067_0066476
868 Ga0501067_0561690
869 Ga0501068_0033034
870 Ga0501069_0037574
871 Ga0501071_0446241
872 Ga0501072_0020493
873 Ga0501072_0204597
874 Ga0501072_0415307
875 Ga0501074_0316361
876 Ga0501075_0115371
877 Ga0501075_1171189
878 Ga0501076_0000182
879 Ga0501076_0175253
880 Ga0501077_0093720
881 Ga0501077_0136227
882 Ga0501077_0220236
883 Ga0501079_0536160
884 Ga0501080_0445739
885 Ga0501080_1180891
886 Ga0501081_0007987
887 Ga0501081_0458086
888 Ga0501035_0568320
889 Ga0501045_0434537
890 nmdc:mga0k408_62261_c1
891 nmdc:mga07m45_12761_c2
892 nmdc:mga05p37_408449_c1
893 nmdc:mga05p37_8824_c1
894 nmdc:mga06r32_215157_c1
895 nmdc:mga08y16_366671_c1
896 nmdc:mga08y16_958048_c1
897 nmdc:mga08x19_1045608_c1
898 nmdc:mga08x19_502647_c1
899 Ga0495601_0351272
900 Ga0495619_0317925
901 Ga0501084_0009813
902 Ga0466962_0217080
903 Ga0530510_0009063
904 Ga0530510_0051710
905 Ga0530510_0180823
906 Ga0530510_0392215

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

18

138

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5yu2-assembly1.cif.gz_B structure of ribonuclease yabj 0.9305 5 127
5y6u-assembly1.cif.gz_C crystal structure of wild-type yabj protein from bacillus subtilis (natto). 0.9302 4 127
7zs6-assembly1.cif.gz_CCC crystal structure of apis mellifera rida 0.9274 2 128
1jd1-assembly1.cif.gz_F crystal structure of yeo7_yeast 0.9268 2 127
3quw-assembly1.cif.gz_A crystal structure of yeast mmf1 0.926 2 127
ID Description Score Start End Superfamily
1jd1F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9268 2 127 3.30.1330.40
af_Q86KR5_2_129_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9247 1 127 3.30.1330.40
1nq3C00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.92 2 127 3.30.1330.40
1jd1F00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.9197 2 127 3.30.1330.40
3m1xA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.919 1 126 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A7C3KED2-F1-model_v4 Reactive intermediate/imine deaminase 0.9522 1 125 GO:0005829
GO:0019239
AF-A0A2N4UWD5-F1-model_v4 Regulator 0.9436 2 127 GO:0005829
GO:0019239
AF-A0A1G0WK31-F1-model_v4 Reactive intermediate/imine deaminase 0.9412 3 125 GO:0005829
GO:0019239
AF-E0ULP8-F1-model_v4 Endoribonuclease L-PSP 0.939 1 127 GO:0005829
GO:0019239
AF-A0A2V7E0C1-F1-model_v4 Reactive intermediate/imine deaminase 0.9379 1 126 GO:0005829
GO:0019239

Map