F447186

General Info

Members Datasets Scaffolds Average Seq Length
453 225 906 109

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10985323|Ga0163162_109853232
Length 113
Sequence VLRVCDIWRDLCASADLLPGEMKSTFDEVTGTPIVVFNLDGELYALEDQCTHDEFELSSGTFDTAEASIECVLHGARFDIRDGRALCAPAYSPVARFPVKREHDGVWARDDRD

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
7 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
8 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
16 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
41 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
44 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
45 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
52 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
53 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
54 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
55 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
56 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
58 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
62 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
87 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
88 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
89 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
90 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
104 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
105 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
106 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
107 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
108 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
109 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
110 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
111 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
112 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
113 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
114 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
115 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
116 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
117 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
118 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
119 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
120 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
121 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
122 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
123 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
124 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
125 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
126 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
127 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
128 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
129 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
135 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
139 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
140 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
143 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
144 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
145 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
146 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
149 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
152 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
160 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
171 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
177 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
178 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
187 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
188 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
189 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
190 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
191 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
192 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
193 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
194 2643221695 Lysobacter sp. Root494 Isolate Unclassified
195 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
196 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
197 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
198 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
199 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
200 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
201 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
202 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
203 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
204 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
205 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
206 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
207 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
208 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
209 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
210 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
211 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
212 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
213 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
214 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
215 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
216 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
217 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
218 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
219 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
220 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
221 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
222 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
223 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
224 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
225 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.05
Metatranscriptomes 0.22
Isolates 7.73

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 17.44
Nodule 0.44
Rhizoplane 4.86
Rhizosphere 50.55
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10985323 3300013306 Bacteria 953
2 SwRhRL2b_contig_401154 2162886007 Bacteria 2805
3 JGI25151J46595_10111130 3300003187 Bacteria 716
4 rootH2_10039162 3300003320 Bacteria 2157
5 rootH1_10199012 3300003323 Bacteria 2854
6 Ga0055526_1000355 3300003771 Bacteria 37199
7 Ga0055526_1002703 3300003771 Bacteria 11790
8 Ga0055526_1064230 3300003771 Bacteria 769
9 Ga0055537_1000017 3300003773 Bacteria 123856
10 Ga0055537_1000272 3300003773 Bacteria 37332
11 Ga0055524_1000398 3300003775 Bacteria 37199
12 Ga0055524_1005005 3300003775 Bacteria 6001
13 Ga0055524_1055592 3300003775 Bacteria 859
14 Ga0055536_1002484 3300003781 Bacteria 10344
15 Ga0055536_1003225 3300003781 Bacteria 8842
16 Ga0055536_1008755 3300003781 Bacteria 4293
17 Ga0055536_1043849 3300003781 Bacteria 1036
18 Ga0055536_1082513 3300003781 Bacteria 607
19 Ga0055534_1000253 3300003784 Bacteria 37199
20 Ga0055534_1000882 3300003784 Bacteria 13654
21 Ga0055534_1040892 3300003784 Bacteria 683
22 Ga0055528_1000356 3300003790 Bacteria 37199
23 Ga0055528_1000365 3300003790 Bacteria 36744
24 Ga0055530_10001130 3300003791 Bacteria 20812
25 Ga0055530_10001990 3300003791 Bacteria 13865
26 Ga0055540_1062465 3300003792 Bacteria 742
27 Ga0055531_10002556 3300003794 Bacteria 12105
28 Ga0055531_10011290 3300003794 Bacteria 4328
29 Ga0055531_10011390 3300003794 Bacteria 4293
30 Ga0055531_10027498 3300003794 Bacteria 1994
31 Ga0058692_1000022 3300003856 Bacteria 237321
32 Ga0065165_1054725 3300005262 Bacteria 1117
33 Ga0065704_10071078 3300005289 Bacteria 13339
34 Ga0065704_10086819 3300005289 Bacteria 3082
35 Ga0065704_10328650 3300005289 Bacteria 841
36 Ga0065704_10401792 3300005289 Bacteria 751
37 Ga0070670_100091667 3300005331 Bacteria 2613
38 Ga0070677_10291712 3300005333 Bacteria 825
39 Ga0070682_100675268 3300005337 Bacteria 825
40 Ga0070692_10583296 3300005345 Bacteria 737
41 Ga0070668_100028380 3300005347 Bacteria 4249
42 Ga0070669_100128405 3300005353 Bacteria 1942
43 Ga0070669_100251524 3300005353 Bacteria 1407
44 Ga0070675_100242847 3300005354 Bacteria 1574
45 Ga0070671_100086795 3300005355 Bacteria 2618
46 Ga0070674_100027348 3300005356 Bacteria 3737
47 Ga0070667_100471075 3300005367 Bacteria 1149
48 Ga0070667_101032832 3300005367 Bacteria 767
49 Ga0070667_101606334 3300005367 Bacteria 611
50 Ga0070714_101568078 3300005435 Bacteria 643
51 Ga0070700_101226769 3300005441 Bacteria 627
52 Ga0070678_100037148 3300005456 Bacteria 3417
53 Ga0068867_100071979 3300005459 Bacteria 2587
54 Ga0070672_100128859 3300005543 Bacteria 2078
55 Ga0070665_100149365 3300005548 Bacteria 2340
56 Ga0070664_100578866 3300005564 Bacteria 1040
57 Ga0068854_101314769 3300005578 Bacteria 651
58 Ga0081539_10035968 3300005985 Bacteria 2969
59 Ga0075365_10304869 3300006038 Bacteria 1121
60 Ga0075363_100313635 3300006048 Bacteria 912
61 Ga0075364_10193558 3300006051 Bacteria 1377
62 Ga0075364_10237616 3300006051 Bacteria 1237
63 Ga0075364_10361678 3300006051 Bacteria 989
64 Ga0075364_10718526 3300006051 Bacteria 682
65 Ga0075364_10782509 3300006051 Bacteria 651
66 Ga0105251_10002625 3300009011 Bacteria 13873
67 Ga0105244_10031991 3300009036 Bacteria 2789
68 Ga0105244_10053403 3300009036 Bacteria 2053
69 Ga0105243_10705195 3300009148 Bacteria 984
70 Ga0105242_10175500 3300009176 Bacteria 1886
71 Ga0157373_10081331 3300013100 Bacteria 2284
72 Ga0157373_10161381 3300013100 Bacteria 1577
73 Ga0157373_10170259 3300013100 Bacteria 1532
74 Ga0157373_10704500 3300013100 Bacteria 740
75 Ga0157371_10000786 3300013102 Bacteria 36566
76 Ga0157371_10108444 3300013102 Bacteria 1970
77 Ga0157371_10325939 3300013102 Bacteria 1115
78 Ga0157370_10080284 3300013104 Bacteria 3071
79 Ga0157370_10327833 3300013104 Bacteria 1412
80 Ga0157370_10514388 3300013104 Bacteria 1099
81 Ga0157370_11353354 3300013104 Bacteria 641
82 Ga0157369_10131951 3300013105 Bacteria 2646
83 Ga0163162_10358133 3300013306 Bacteria 1592
84 Ga0157372_12603112 3300013307 Bacteria 581
85 Ga0157380_10073036 3300014326 Bacteria 2780
86 Ga0182008_10000772 3300014497 Bacteria 22439
87 Ga0182008_10036699 3300014497 Bacteria 2452
88 Ga0182008_10860104 3300014497 Bacteria 531
89 Ga0182006_1006592 3300015261 Bacteria 5379
90 Ga0182006_1033403 3300015261 Bacteria 2063
91 Ga0182006_1035517 3300015261 Bacteria 1986
92 Ga0182006_1037447 3300015261 Bacteria 1922
93 Ga0182007_10000574 3300015262 Bacteria 21633
94 Ga0182005_1000770 3300015265 Bacteria 14604
95 Ga0183360_10001 3300015689 Bacteria 3943671
96 Ga0163161_10014416 3300017792 Bacteria 5503
97 Ga0163161_10015718 3300017792 Bacteria 5277
98 Ga0163161_10018163 3300017792 Bacteria 4930
99 Ga0163161_10021321 3300017792 Bacteria 4555
100 Ga0163161_10367051 3300017792 Bacteria 1148
101 Ga0163161_10380992 3300017792 Bacteria 1127
102 Ga0209565_1000005 3300025263 Bacteria 947317
103 Ga0209565_1000031 3300025263 Bacteria 320341
104 Ga0209673_1000011 3300025273 Bacteria 586604
105 Ga0209673_1000164 3300025273 Bacteria 138082
106 Ga0209673_1105701 3300025273 Bacteria 598
107 Ga0209130_1003328 3300025284 Bacteria 6924
108 Ga0209675_1000004 3300025291 Bacteria 947166
109 Ga0209675_1000015 3300025291 Bacteria 403517
110 Ga0209675_1061144 3300025291 Bacteria 744
111 Ga0209676_1000110 3300025292 Bacteria 214083
112 Ga0209676_1000517 3300025292 Bacteria 60583
113 Ga0209676_1001548 3300025292 Bacteria 20683
114 Ga0209676_1004276 3300025292 Bacteria 8051
115 Ga0209676_1010322 3300025292 Bacteria 3910
116 Ga0209676_1058078 3300025292 Bacteria 978
117 Ga0209025_1007487 3300025294 Bacteria 8118
118 Ga0209025_1073238 3300025294 Bacteria 1203
119 Ga0209025_1185614 3300025294 Bacteria 528
120 Ga0209564_1000018 3300025295 Bacteria 586913
121 Ga0209564_1000037 3300025295 Bacteria 414794
122 Ga0209050_1000674 3300025298 Bacteria 51506
123 Ga0209050_1000726 3300025298 Bacteria 48194
124 Ga0209050_1019959 3300025298 Bacteria 2517
125 Ga0209050_1037968 3300025298 Bacteria 1380
126 Ga0209256_1000021 3300025299 Bacteria 537097
127 Ga0209256_1002261 3300025299 Bacteria 16322
128 Ga0209256_1003595 3300025299 Bacteria 10672
129 Ga0209256_1007172 3300025299 Bacteria 5598
130 Ga0209256_1011569 3300025299 Bacteria 3509
131 Ga0209051_1002655 3300025303 Bacteria 12505
132 Ga0209257_1000129 3300025304 Bacteria 214155
133 Ga0209257_1000670 3300025304 Bacteria 53641
134 Ga0209257_1001774 3300025304 Bacteria 23862
135 Ga0209257_1002916 3300025304 Bacteria 15775
136 Ga0209257_1002951 3300025304 Bacteria 15605
137 Ga0207713_1075031 3300025735 Bacteria 1235
138 Ga0207681_10010090 3300025923 Bacteria 5780
139 Ga0207681_10319733 3300025923 Bacteria 1234
140 Ga0207650_10086796 3300025925 Bacteria 2383
141 Ga0207659_10254474 3300025926 Bacteria 1426
142 Ga0207664_10942739 3300025929 Bacteria 774
143 Ga0207644_10075713 3300025931 Bacteria 2474
144 Ga0207709_10004442 3300025935 Bacteria 8105
145 Ga0207679_10884902 3300025945 Bacteria 816
146 Ga0207668_10017831 3300025972 Bacteria 4456
147 Ga0207658_10372261 3300025986 Bacteria 1249
148 Ga0207658_10722058 3300025986 Bacteria 901
149 Ga0207648_10356744 3300026089 Bacteria 1319
150 Ga0207676_11422489 3300026095 Bacteria 690
151 Ga0207683_10029946 3300026121 Bacteria 4715
152 Ga0209371_1000004 3300027312 Bacteria 1098197
153 Ga0209969_1013695 3300027360 Bacteria 1176
154 Ga0209983_1000493 3300027665 Bacteria 8493
155 Ga0209971_1005324 3300027682 Bacteria 3059
156 Ga0209974_10008676 3300027876 Bacteria 3464
157 Ga0268266_10147439 3300028379 Bacteria 2117
158 Ga0268256_1000005 3300030500 Bacteria 1082342
159 Ga0316176_1084937 3300030732 Bacteria 2211
160 Ga0316176_1165439 3300030732 Bacteria 2421
161 Ga0316183_1008117 3300030742 Bacteria 7888
162 Ga0316181_1284613 3300030744 Bacteria 2792
163 Ga0316182_1034774 3300030745 Bacteria 2861
164 Ga0316182_1319342 3300030745 Bacteria 1893
165 Ga0307513_10012001 3300031456 Bacteria 10728
166 Ga0307513_10062298 3300031456 Bacteria 3943
167 Ga0307408_100401226 3300031548 Bacteria 1177
168 Ga0307408_102231387 3300031548 Bacteria 529
169 Ga0307405_10609425 3300031731 Bacteria 892
170 Ga0307413_10101245 3300031824 Bacteria 1904
171 Ga0307413_10391729 3300031824 Bacteria 1086
172 Ga0307413_11021951 3300031824 Bacteria 710
173 Ga0307413_11906977 3300031824 Bacteria 534
174 Ga0307413_12130221 3300031824 Bacteria 507
175 Ga0307410_10623136 3300031852 Bacteria 902
176 Ga0307410_10966535 3300031852 Bacteria 733
177 Ga0307406_10630728 3300031901 Bacteria 887
178 Ga0307406_11295778 3300031901 Bacteria 636
179 Ga0307407_10745081 3300031903 Bacteria 741
180 Ga0307412_10001236 3300031911 Bacteria 14465
181 Ga0307412_10111866 3300031911 Bacteria 1951
182 Ga0307412_10750250 3300031911 Bacteria 842
183 Ga0307412_10919044 3300031911 Bacteria 768
184 Ga0307409_100260955 3300031995 Bacteria 1590
185 Ga0307416_101727301 3300032002 Bacteria 730
186 Ga0307416_102840242 3300032002 Bacteria 579
187 Ga0307414_10001111 3300032004 Bacteria 13729
188 Ga0307414_10019813 3300032004 Bacteria 4178
189 Ga0307414_10036314 3300032004 Bacteria 3289
190 Ga0307414_10226794 3300032004 Bacteria 1537
191 Ga0307414_10380456 3300032004 Bacteria 1220
192 Ga0307414_10388677 3300032004 Bacteria 1208
193 Ga0307414_11303130 3300032004 Bacteria 674
194 Ga0307414_11468349 3300032004 Bacteria 634
195 Ga0307414_11917642 3300032004 Bacteria 553
196 Ga0307411_10067462 3300032005 Bacteria 2407
197 Ga0307411_11176925 3300032005 Unclassified 694
198 Ga0307411_11258382 3300032005 Bacteria 673
199 Ga0237819_14026 3300038705 Bacteria 952
200 Ga0237819_14090 3300038705 Bacteria 948
201 Ga0439436_0006351 3300041404 Bacteria 3628
202 Ga0439436_0015544 3300041404 Bacteria 2289
203 Ga0439436_0085379 3300041404 Bacteria 879
204 Ga0439439_0016225 3300041406 Bacteria 1823
205 Ga0439439_0118406 3300041406 Bacteria 737
206 Ga0439439_0217094 3300041406 Bacteria 560
207 Ga0439447_005494 3300041407 Bacteria 4208
208 Ga0439465_0008603 3300041413 Bacteria 3221
209 Ga0439465_0113684 3300041413 Bacteria 944
210 Ga0439465_0400830 3300041413 Bacteria 522
211 Ga0451787_228229 3300041441 Bacteria 553
212 Ga0451789_1245730 3300041443 Bacteria 1381
213 Ga0451791_1002058 3300041451 Bacteria 597
214 Ga0451791_1524172 3300041451 Bacteria 1007
215 Ga0451793_0472877 3300041452 Bacteria 1272
216 Ga0451793_0626574 3300041452 Bacteria 557
217 Ga0451797_0521423 3300041453 Bacteria 2395
218 Ga0451797_1374922 3300041453 Bacteria 1307
219 Ga0451797_1499209 3300041453 Bacteria 1438
220 Ga0451802_0326626 3300041460 Bacteria 828
221 Ga0451802_0981814 3300041460 Bacteria 2360
222 Ga0451804_0481179 3300041463 Bacteria 881
223 Ga0451807_1463995 3300041486 Bacteria 5771
224 Ga0451807_2178382 3300041486 Bacteria 1319
225 Ga0451833_1179997 3300041491 Bacteria 943
226 Ga0451837_0154038 3300041494 Bacteria 1075
227 Ga0451837_0222902 3300041494 Bacteria 701
228 Ga0451837_0614663 3300041494 Bacteria 3340
229 Ga0451837_0617909 3300041494 Bacteria 735
230 Ga0451837_1020844 3300041494 Bacteria 950
231 Ga0451837_1653668 3300041494 Bacteria 3597
232 Ga0451837_1868982 3300041494 Bacteria 638
233 Ga0451845_0288626 3300041501 Bacteria 532
234 Ga0451843_0653801 3300041509 Bacteria 2671
235 Ga0451843_0972197 3300041509 Bacteria 897
236 Ga0451843_1322650 3300041509 Bacteria 3148
237 Ga0451843_1777697 3300041509 Bacteria 1488
238 Ga0451853_0450837 3300041512 Bacteria 811
239 Ga0451853_0878463 3300041512 Bacteria 1210
240 Ga0439431_0132239 3300041997 Bacteria 701
241 Ga0439433_0060506 3300041999 Bacteria 903
242 Ga0439433_0069050 3300041999 Bacteria 850
243 Ga0439432_004241 3300042006 Bacteria 5242
244 Ga0439432_020257 3300042006 Bacteria 2213
245 Ga0439432_058394 3300042006 Bacteria 1193
246 Ga0439432_065360 3300042006 Bacteria 1115
247 Ga0439432_094475 3300042006 Bacteria 898
248 Ga0439432_128849 3300042006 Bacteria 747
249 Ga0439449_0002178 3300042007 Bacteria 7692
250 Ga0439449_0021120 3300042007 Bacteria 2438
251 Ga0439449_0076817 3300042007 Bacteria 1231
252 Ga0439449_0158148 3300042007 Bacteria 846
253 Ga0439449_0184421 3300042007 Bacteria 780
254 Ga0439452_038350 3300042010 Bacteria 1138
255 Ga0439452_061949 3300042010 Bacteria 836
256 Ga0439462_0017844 3300042015 Bacteria 1840
257 Ga0439462_0126874 3300042015 Bacteria 711
258 Ga0450911_001479 3300042115 Bacteria 5365
259 Ga0450899_057259 3300042135 Bacteria 503
260 Ga0439434_0024909 3300042435 Bacteria 1806
261 Ga0451577_0016879 3300042876 Bacteria 6752
262 Ga0453684_1306437 3300044712 Bacteria 756
263 Ga0495591_026328 3300046458 Bacteria 1809
264 Ga0495638_0004310 3300046460 Bacteria 10797
265 Ga0495638_0012437 3300046460 Bacteria 5835
266 Ga0495638_0153272 3300046460 Bacteria 1335
267 Ga0495610_0003117 3300046512 Bacteria 13205
268 Ga0495610_0035665 3300046512 Bacteria 2551
269 Ga0495631_0001236 3300046518 Bacteria 15780
270 Ga0495643_0001711 3300046522 Bacteria 19004
271 Ga0495648_0146643 3300046524 Bacteria 1236
272 Ga0495663_0001189 3300046525 Bacteria 8395
273 Ga0495663_0002181 3300046525 Bacteria 5963
274 Ga0495663_0004858 3300046525 Bacteria 3755
275 Ga0495663_0020056 3300046525 Bacteria 1917
276 Ga0495663_0381904 3300046525 Bacteria 516
277 Ga0495654_0144734 3300046530 Bacteria 1056
278 Ga0495598_0000565 3300046537 Bacteria 6959
279 Ga0495621_0000629 3300046539 Bacteria 8876
280 Ga0495621_0023453 3300046539 Bacteria 2052
281 Ga0495621_0052101 3300046539 Bacteria 1466
282 Ga0495633_0003321 3300046558 Bacteria 10806
283 Ga0495633_0009632 3300046558 Bacteria 5316
284 Ga0495633_0092405 3300046558 Bacteria 1406
285 Ga0495656_0010654 3300046615 Bacteria 3349
286 Ga0495656_0044476 3300046615 Bacteria 1870
287 Ga0495668_0002797 3300046616 Bacteria 13892
288 Ga0495625_0006186 3300046660 Bacteria 10722
289 Ga0495625_0070164 3300046660 Bacteria 2460
290 Ga0495625_0270358 3300046660 Bacteria 1097
291 Ga0495659_0182922 3300046664 Bacteria 854
292 Ga0495659_0278001 3300046664 Bacteria 703
293 Ga0495659_0488667 3300046664 Bacteria 539
294 Ga0495670_0130149 3300046691 Bacteria 1311
295 Ga0495671_0006087 3300046692 Bacteria 7005
296 Ga0495660_0039604 3300046810 Bacteria 2617
297 Ga0495636_0000303 3300047318 Bacteria 19375
298 Ga0495636_0001314 3300047318 Bacteria 9428
299 Ga0495636_0006211 3300047318 Bacteria 4691
300 Ga0495672_0000090 3300047320 Bacteria 148367
301 Ga0495672_0049581 3300047320 Bacteria 2484
302 Ga0495681_0057627 3300047470 Bacteria 1803
303 Ga0495686_0002785 3300047472 Bacteria 15937
304 Ga0496104_0297092 3300048907 Bacteria 1527
305 Ga0496105_0019511 3300048908 Bacteria 5469
306 Ga0496107_0277092 3300048910 Bacteria 1249
307 Ga0496111_0566409 3300048914 Bacteria 833
308 Ga0496111_1057043 3300048914 Bacteria 580
309 Ga0496113_0198272 3300048916 Bacteria 1595
310 Ga0496113_0257894 3300048916 Bacteria 1393
311 Ga0496114_0584594 3300048917 Bacteria 985
312 Ga0496116_0007757 3300048919 Bacteria 9438
313 Ga0496116_0018588 3300048919 Bacteria 5349
314 Ga0496116_0060132 3300048919 Bacteria 2466
315 Ga0496116_0134688 3300048919 Bacteria 1401
316 Ga0496116_0140329 3300048919 Bacteria 1360
317 Ga0496116_0262538 3300048919 Bacteria 850
318 Ga0496116_0295978 3300048919 Bacteria 773
319 Ga0496117_0003801 3300048920 Bacteria 17210
320 Ga0496117_0005493 3300048920 Bacteria 13286
321 Ga0496117_0007604 3300048920 Bacteria 10529
322 Ga0496117_0020828 3300048920 Bacteria 5334
323 Ga0496117_0036173 3300048920 Bacteria 3698
324 Ga0496117_0252211 3300048920 Bacteria 962
325 Ga0496117_0264489 3300048920 Bacteria 930
326 Ga0496117_0524297 3300048920 Bacteria 569
327 Ga0496118_0000814 3300048921 Bacteria 49769
328 Ga0496118_0005456 3300048921 Bacteria 14457
329 Ga0496118_0006164 3300048921 Bacteria 13296
330 Ga0496118_0012809 3300048921 Bacteria 8004
331 Ga0496118_0024611 3300048921 Bacteria 5191
332 Ga0496118_0026179 3300048921 Bacteria 4976
333 Ga0496118_0034893 3300048921 Bacteria 4095
334 Ga0496118_0071627 3300048921 Bacteria 2494
335 Ga0496118_0169098 3300048921 Bacteria 1338
336 Ga0496118_0290298 3300048921 Bacteria 904
337 Ga0496119_0000329 3300048922 Bacteria 66425
338 Ga0496119_0007363 3300048922 Bacteria 9942
339 Ga0496120_0000147 3300048923 Bacteria 117881
340 Ga0496120_0142071 3300048923 Bacteria 1217
341 Ga0496121_0003503 3300048924 Bacteria 22323
342 Ga0496121_0003940 3300048924 Bacteria 20555
343 Ga0496121_0027581 3300048924 Bacteria 5311
344 Ga0496121_0032554 3300048924 Bacteria 4736
345 Ga0496121_0043919 3300048924 Bacteria 3863
346 Ga0496121_0058406 3300048924 Bacteria 3189
347 Ga0496121_0222012 3300048924 Bacteria 1330
348 Ga0496121_0243128 3300048924 Bacteria 1253
349 Ga0496122_0001478 3300048925 Bacteria 37832
350 Ga0496122_0010237 3300048925 Bacteria 9714
351 Ga0496122_0022485 3300048925 Bacteria 5602
352 Ga0496122_0068602 3300048925 Bacteria 2544
353 Ga0496122_0075645 3300048925 Bacteria 2373
354 Ga0496122_0102219 3300048925 Bacteria 1911
355 Ga0496122_0186734 3300048925 Bacteria 1229
356 Ga0496122_0243577 3300048925 Bacteria 1011
357 Ga0496123_0000150 3300048926 Bacteria 142879
358 Ga0496123_0006489 3300048926 Bacteria 11321
359 Ga0496123_0013671 3300048926 Bacteria 6789
360 Ga0496123_0016100 3300048926 Bacteria 6092
361 Ga0496123_0017075 3300048926 Bacteria 5859
362 Ga0496123_0107593 3300048926 Bacteria 1603
363 Ga0496123_0182724 3300048926 Bacteria 1093
364 Ga0496123_0309992 3300048926 Bacteria 749
365 Ga0496123_0312162 3300048926 Bacteria 746
366 Ga0496123_0508409 3300048926 Bacteria 525
367 Ga0496124_0002052 3300048927 Bacteria 27366
368 Ga0496124_0004642 3300048927 Bacteria 15908
369 Ga0496124_0005358 3300048927 Bacteria 14482
370 Ga0496124_0012397 3300048927 Bacteria 8416
371 Ga0496124_0015747 3300048927 Bacteria 7229
372 Ga0496124_0018043 3300048927 Bacteria 6625
373 Ga0496124_0020240 3300048927 Bacteria 6157
374 Ga0496124_0035315 3300048927 Bacteria 4374
375 Ga0496124_0073857 3300048927 Bacteria 2820
376 Ga0496124_0085682 3300048927 Bacteria 2581
377 Ga0496124_0210712 3300048927 Bacteria 1470
378 Ga0496124_0251893 3300048927 Bacteria 1305
379 Ga0496124_0328247 3300048927 Bacteria 1092
380 Ga0496125_0004145 3300048928 Bacteria 16912
381 Ga0496125_0005265 3300048928 Bacteria 14483
382 Ga0496125_0008042 3300048928 Bacteria 11132
383 Ga0496125_0018599 3300048928 Bacteria 6596
384 Ga0496125_0019666 3300048928 Bacteria 6359
385 Ga0496125_0141097 3300048928 Bacteria 1675
386 Ga0496125_0550174 3300048928 Bacteria 640
387 Ga0496126_0001694 3300048929 Bacteria 32787
388 Ga0496126_0008286 3300048929 Bacteria 11225
389 Ga0496126_0064903 3300048929 Bacteria 3269
390 Ga0496126_0096540 3300048929 Bacteria 2591
391 Ga0496126_0130159 3300048929 Bacteria 2175
392 Ga0496126_0598986 3300048929 Bacteria 868
393 Ga0496126_1321769 3300048929 Bacteria 524
394 Ga0501306_002493 3300049127 Bacteria 1893
395 Ga0501031_0926803 3300049568 Bacteria 557
396 Ga0501033_0006447 3300049570 Bacteria 9183
397 Ga0501033_0939546 3300049570 Bacteria 580
398 Ga0501034_0192118 3300049571 Bacteria 2003
399 Ga0501034_0256499 3300049571 Bacteria 1692
400 Ga0501038_0055219 3300049574 Bacteria 3413
401 Ga0501202_007004 3300049652 Bacteria 2032
402 Ga0501217_058203 3300049661 Bacteria 1026
403 Ga0501223_037867 3300049663 Bacteria 936
404 Ga0501225_0204386 3300049705 Bacteria 628
405 Ga0501268_058744 3300049765 Bacteria 758
406 Ga0501035_1159627 3300049822 Bacteria 601
407 Ga0501044_0069591 3300049823 Bacteria 3582
408 Ga0501045_1325415 3300049824 Bacteria 524
409 nmdc:mga00v17_180311_c1 3300050491 Bacteria 1363
410 nmdc:mga00v17_18924_c1 3300050491 Bacteria 3921
411 nmdc:mga00v17_20595_c1 3300050491 Bacteria 3781
412 nmdc:mga00v17_655312_c1 3300050491 Bacteria 675
413 nmdc:mga0yw44_149766_c1 3300050492 Bacteria 1521
414 Ga0500626_026650 3300053128 Bacteria 2601
415 Ga0500658_0070545 3300053134 Bacteria 1473
416 Ga0500622_0439515 3300053156 Bacteria 521
417 Ga0500609_023936 3300053731 Bacteria 836
418 Ga0500565_027396 3300053734 Bacteria 728
419 2547499771 2547132130 Bacteria 4660562
420 2572254592 2571042365 Bacteria 3289345
421 2578459298 2576861471 Bacteria 4648976
422 2644529748 2643221695 Bacteria 3441323
423 2747950545 2747842428 Bacteria 4689383
424 2765578016 2765235840 Bacteria 4663337
425 2816516086 2816332141 Bacteria 4436036
426 2842393724 2842391507 Bacteria 4486072
427 2842759265 2842757796 Bacteria 3981385
428 2852653304 2852649853 Bacteria 4036942
429 2857442872 2857442823 Bacteria 4562550
430 2874220668 2874220319 Bacteria 4594709
431 2895499056 2895498888 Bacteria 5283788
432 2895512075 2895511927 Bacteria 6802080
433 2895523269 2895522137 Bacteria 3284416
434 2895528022 2895525241 Bacteria 3388457
435 2919090683 2919089067 Bacteria 4560942
436 2919134672 2919134579 Bacteria 4480386
437 2928496679 2928496128 Bacteria 4631123
438 2931381696 2931380184 Bacteria 4455911
439 2937611503 2937610967 Bacteria 4618818
440 2939592091 2939589442 Bacteria 4214238
441 2939625208 2939622612 Bacteria 4698046
442 2939627430 2939626828 Bacteria 4695272
443 2941477061 2941475908 Bacteria 4145589
444 2958089654 2958084443 Bacteria 7312792
445 2961047433 2961047084 Bacteria 4594415
446 2961068225 2961064222 Bacteria 4749990
447 2974309735 2974307012 Bacteria 4172388
448 2977250482 2977247770 Bacteria 4160543
449 2984515051 2984514374 Bacteria 4172479
450 2987607763 2987605356 Bacteria 4187822
451 2995952883 2995948881 Bacteria 6358104
452 8002869669 8002869464 Bacteria 3588529
453 8003016697 8003014200 Bacteria 4059994
454 Ga0163162_10985323
455 SwRhRL2b_contig_401154
456 JGI25151J46595_10111130
457 rootH2_10039162
458 rootH1_10199012
459 Ga0055526_1000355
460 Ga0055526_1002703
461 Ga0055526_1064230
462 Ga0055537_1000017
463 Ga0055537_1000272
464 Ga0055524_1000398
465 Ga0055524_1005005
466 Ga0055524_1055592
467 Ga0055536_1002484
468 Ga0055536_1003225
469 Ga0055536_1008755
470 Ga0055536_1043849
471 Ga0055536_1082513
472 Ga0055534_1000253
473 Ga0055534_1000882
474 Ga0055534_1040892
475 Ga0055528_1000356
476 Ga0055528_1000365
477 Ga0055530_10001130
478 Ga0055530_10001990
479 Ga0055540_1062465
480 Ga0055531_10002556
481 Ga0055531_10011290
482 Ga0055531_10011390
483 Ga0055531_10027498
484 Ga0058692_1000022
485 Ga0065165_1054725
486 Ga0065704_10071078
487 Ga0065704_10086819
488 Ga0065704_10328650
489 Ga0065704_10401792
490 Ga0070670_100091667
491 Ga0070677_10291712
492 Ga0070682_100675268
493 Ga0070692_10583296
494 Ga0070668_100028380
495 Ga0070669_100128405
496 Ga0070669_100251524
497 Ga0070675_100242847
498 Ga0070671_100086795
499 Ga0070674_100027348
500 Ga0070667_100471075
501 Ga0070667_101032832
502 Ga0070667_101606334
503 Ga0070714_101568078
504 Ga0070700_101226769
505 Ga0070678_100037148
506 Ga0068867_100071979
507 Ga0070672_100128859
508 Ga0070665_100149365
509 Ga0070664_100578866
510 Ga0068854_101314769
511 Ga0081539_10035968
512 Ga0075365_10304869
513 Ga0075363_100313635
514 Ga0075364_10193558
515 Ga0075364_10237616
516 Ga0075364_10361678
517 Ga0075364_10718526
518 Ga0075364_10782509
519 Ga0105251_10002625
520 Ga0105244_10031991
521 Ga0105244_10053403
522 Ga0105243_10705195
523 Ga0105242_10175500
524 Ga0157373_10081331
525 Ga0157373_10161381
526 Ga0157373_10170259
527 Ga0157373_10704500
528 Ga0157371_10000786
529 Ga0157371_10108444
530 Ga0157371_10325939
531 Ga0157370_10080284
532 Ga0157370_10327833
533 Ga0157370_10514388
534 Ga0157370_11353354
535 Ga0157369_10131951
536 Ga0163162_10358133
537 Ga0157372_12603112
538 Ga0157380_10073036
539 Ga0182008_10000772
540 Ga0182008_10036699
541 Ga0182008_10860104
542 Ga0182006_1006592
543 Ga0182006_1033403
544 Ga0182006_1035517
545 Ga0182006_1037447
546 Ga0182007_10000574
547 Ga0182005_1000770
548 Ga0183360_10001
549 Ga0163161_10014416
550 Ga0163161_10015718
551 Ga0163161_10018163
552 Ga0163161_10021321
553 Ga0163161_10367051
554 Ga0163161_10380992
555 Ga0209565_1000005
556 Ga0209565_1000031
557 Ga0209673_1000011
558 Ga0209673_1000164
559 Ga0209673_1105701
560 Ga0209130_1003328
561 Ga0209675_1000004
562 Ga0209675_1000015
563 Ga0209675_1061144
564 Ga0209676_1000110
565 Ga0209676_1000517
566 Ga0209676_1001548
567 Ga0209676_1004276
568 Ga0209676_1010322
569 Ga0209676_1058078
570 Ga0209025_1007487
571 Ga0209025_1073238
572 Ga0209025_1185614
573 Ga0209564_1000018
574 Ga0209564_1000037
575 Ga0209050_1000674
576 Ga0209050_1000726
577 Ga0209050_1019959
578 Ga0209050_1037968
579 Ga0209256_1000021
580 Ga0209256_1002261
581 Ga0209256_1003595
582 Ga0209256_1007172
583 Ga0209256_1011569
584 Ga0209051_1002655
585 Ga0209257_1000129
586 Ga0209257_1000670
587 Ga0209257_1001774
588 Ga0209257_1002916
589 Ga0209257_1002951
590 Ga0207713_1075031
591 Ga0207681_10010090
592 Ga0207681_10319733
593 Ga0207650_10086796
594 Ga0207659_10254474
595 Ga0207664_10942739
596 Ga0207644_10075713
597 Ga0207709_10004442
598 Ga0207679_10884902
599 Ga0207668_10017831
600 Ga0207658_10372261
601 Ga0207658_10722058
602 Ga0207648_10356744
603 Ga0207676_11422489
604 Ga0207683_10029946
605 Ga0209371_1000004
606 Ga0209969_1013695
607 Ga0209983_1000493
608 Ga0209971_1005324
609 Ga0209974_10008676
610 Ga0268266_10147439
611 Ga0268256_1000005
612 Ga0316176_1084937
613 Ga0316176_1165439
614 Ga0316183_1008117
615 Ga0316181_1284613
616 Ga0316182_1034774
617 Ga0316182_1319342
618 Ga0307513_10012001
619 Ga0307513_10062298
620 Ga0307408_100401226
621 Ga0307408_102231387
622 Ga0307405_10609425
623 Ga0307413_10101245
624 Ga0307413_10391729
625 Ga0307413_11021951
626 Ga0307413_11906977
627 Ga0307413_12130221
628 Ga0307410_10623136
629 Ga0307410_10966535
630 Ga0307406_10630728
631 Ga0307406_11295778
632 Ga0307407_10745081
633 Ga0307412_10001236
634 Ga0307412_10111866
635 Ga0307412_10750250
636 Ga0307412_10919044
637 Ga0307409_100260955
638 Ga0307416_101727301
639 Ga0307416_102840242
640 Ga0307414_10001111
641 Ga0307414_10019813
642 Ga0307414_10036314
643 Ga0307414_10226794
644 Ga0307414_10380456
645 Ga0307414_10388677
646 Ga0307414_11303130
647 Ga0307414_11468349
648 Ga0307414_11917642
649 Ga0307411_10067462
650 Ga0307411_11176925
651 Ga0307411_11258382
652 Ga0237819_14026
653 Ga0237819_14090
654 Ga0439436_0006351
655 Ga0439436_0015544
656 Ga0439436_0085379
657 Ga0439439_0016225
658 Ga0439439_0118406
659 Ga0439439_0217094
660 Ga0439447_005494
661 Ga0439465_0008603
662 Ga0439465_0113684
663 Ga0439465_0400830
664 Ga0451787_228229
665 Ga0451789_1245730
666 Ga0451791_1002058
667 Ga0451791_1524172
668 Ga0451793_0472877
669 Ga0451793_0626574
670 Ga0451797_0521423
671 Ga0451797_1374922
672 Ga0451797_1499209
673 Ga0451802_0326626
674 Ga0451802_0981814
675 Ga0451804_0481179
676 Ga0451807_1463995
677 Ga0451807_2178382
678 Ga0451833_1179997
679 Ga0451837_0154038
680 Ga0451837_0222902
681 Ga0451837_0614663
682 Ga0451837_0617909
683 Ga0451837_1020844
684 Ga0451837_1653668
685 Ga0451837_1868982
686 Ga0451845_0288626
687 Ga0451843_0653801
688 Ga0451843_0972197
689 Ga0451843_1322650
690 Ga0451843_1777697
691 Ga0451853_0450837
692 Ga0451853_0878463
693 Ga0439431_0132239
694 Ga0439433_0060506
695 Ga0439433_0069050
696 Ga0439432_004241
697 Ga0439432_020257
698 Ga0439432_058394
699 Ga0439432_065360
700 Ga0439432_094475
701 Ga0439432_128849
702 Ga0439449_0002178
703 Ga0439449_0021120
704 Ga0439449_0076817
705 Ga0439449_0158148
706 Ga0439449_0184421
707 Ga0439452_038350
708 Ga0439452_061949
709 Ga0439462_0017844
710 Ga0439462_0126874
711 Ga0450911_001479
712 Ga0450899_057259
713 Ga0439434_0024909
714 Ga0451577_0016879
715 Ga0453684_1306437
716 Ga0495591_026328
717 Ga0495638_0004310
718 Ga0495638_0012437
719 Ga0495638_0153272
720 Ga0495610_0003117
721 Ga0495610_0035665
722 Ga0495631_0001236
723 Ga0495643_0001711
724 Ga0495648_0146643
725 Ga0495663_0001189
726 Ga0495663_0002181
727 Ga0495663_0004858
728 Ga0495663_0020056
729 Ga0495663_0381904
730 Ga0495654_0144734
731 Ga0495598_0000565
732 Ga0495621_0000629
733 Ga0495621_0023453
734 Ga0495621_0052101
735 Ga0495633_0003321
736 Ga0495633_0009632
737 Ga0495633_0092405
738 Ga0495656_0010654
739 Ga0495656_0044476
740 Ga0495668_0002797
741 Ga0495625_0006186
742 Ga0495625_0070164
743 Ga0495625_0270358
744 Ga0495659_0182922
745 Ga0495659_0278001
746 Ga0495659_0488667
747 Ga0495670_0130149
748 Ga0495671_0006087
749 Ga0495660_0039604
750 Ga0495636_0000303
751 Ga0495636_0001314
752 Ga0495636_0006211
753 Ga0495672_0000090
754 Ga0495672_0049581
755 Ga0495681_0057627
756 Ga0495686_0002785
757 Ga0496104_0297092
758 Ga0496105_0019511
759 Ga0496107_0277092
760 Ga0496111_0566409
761 Ga0496111_1057043
762 Ga0496113_0198272
763 Ga0496113_0257894
764 Ga0496114_0584594
765 Ga0496116_0007757
766 Ga0496116_0018588
767 Ga0496116_0060132
768 Ga0496116_0134688
769 Ga0496116_0140329
770 Ga0496116_0262538
771 Ga0496116_0295978
772 Ga0496117_0003801
773 Ga0496117_0005493
774 Ga0496117_0007604
775 Ga0496117_0020828
776 Ga0496117_0036173
777 Ga0496117_0252211
778 Ga0496117_0264489
779 Ga0496117_0524297
780 Ga0496118_0000814
781 Ga0496118_0005456
782 Ga0496118_0006164
783 Ga0496118_0012809
784 Ga0496118_0024611
785 Ga0496118_0026179
786 Ga0496118_0034893
787 Ga0496118_0071627
788 Ga0496118_0169098
789 Ga0496118_0290298
790 Ga0496119_0000329
791 Ga0496119_0007363
792 Ga0496120_0000147
793 Ga0496120_0142071
794 Ga0496121_0003503
795 Ga0496121_0003940
796 Ga0496121_0027581
797 Ga0496121_0032554
798 Ga0496121_0043919
799 Ga0496121_0058406
800 Ga0496121_0222012
801 Ga0496121_0243128
802 Ga0496122_0001478
803 Ga0496122_0010237
804 Ga0496122_0022485
805 Ga0496122_0068602
806 Ga0496122_0075645
807 Ga0496122_0102219
808 Ga0496122_0186734
809 Ga0496122_0243577
810 Ga0496123_0000150
811 Ga0496123_0006489
812 Ga0496123_0013671
813 Ga0496123_0016100
814 Ga0496123_0017075
815 Ga0496123_0107593
816 Ga0496123_0182724
817 Ga0496123_0309992
818 Ga0496123_0312162
819 Ga0496123_0508409
820 Ga0496124_0002052
821 Ga0496124_0004642
822 Ga0496124_0005358
823 Ga0496124_0012397
824 Ga0496124_0015747
825 Ga0496124_0018043
826 Ga0496124_0020240
827 Ga0496124_0035315
828 Ga0496124_0073857
829 Ga0496124_0085682
830 Ga0496124_0210712
831 Ga0496124_0251893
832 Ga0496124_0328247
833 Ga0496125_0004145
834 Ga0496125_0005265
835 Ga0496125_0008042
836 Ga0496125_0018599
837 Ga0496125_0019666
838 Ga0496125_0141097
839 Ga0496125_0550174
840 Ga0496126_0001694
841 Ga0496126_0008286
842 Ga0496126_0064903
843 Ga0496126_0096540
844 Ga0496126_0130159
845 Ga0496126_0598986
846 Ga0496126_1321769
847 Ga0501306_002493
848 Ga0501031_0926803
849 Ga0501033_0006447
850 Ga0501033_0939546
851 Ga0501034_0192118
852 Ga0501034_0256499
853 Ga0501038_0055219
854 Ga0501202_007004
855 Ga0501217_058203
856 Ga0501223_037867
857 Ga0501225_0204386
858 Ga0501268_058744
859 Ga0501035_1159627
860 Ga0501044_0069591
861 Ga0501045_1325415
862 nmdc:mga00v17_180311_c1
863 nmdc:mga00v17_18924_c1
864 nmdc:mga00v17_20595_c1
865 nmdc:mga00v17_655312_c1
866 nmdc:mga0yw44_149766_c1
867 Ga0500626_026650
868 Ga0500658_0070545
869 Ga0500622_0439515
870 Ga0500609_023936
871 Ga0500565_027396
872 2547499771
873 2572254592
874 2578459298
875 2644529748
876 2747950545
877 2765578016
878 2816516086
879 2842393724
880 2842759265
881 2852653304
882 2857442872
883 2874220668
884 2895499056
885 2895512075
886 2895523269
887 2895528022
888 2919090683
889 2919134672
890 2928496679
891 2931381696
892 2937611503
893 2939592091
894 2939625208
895 2939627430
896 2941477061
897 2958089654
898 2961047433
899 2961068225
900 2974309735
901 2977250482
902 2984515051
903 2987607763
904 2995952883
905 8002869669
906 8003016697

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00355

Rieske

Rieske [2Fe-2S] domain

7

98

0.9

PF13806

Rieske_2

Rieske-like [2Fe-2S] domain

7

109

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bui-assembly1.cif.gz_E complex of reduced oxygenase and oxidized ferredoxin in carbazole 1,9a- dioxygenase 0.9372 5 106
2qpz-assembly1.cif.gz_A naphthalene 1,2-dioxygenase rieske ferredoxin 0.9351 4 106
7bui-assembly1.cif.gz_D complex of reduced oxygenase and oxidized ferredoxin in carbazole 1,9a- dioxygenase 0.9327 6 105
4emj-assembly1.cif.gz_B complex between the reductase and ferredoxin components of toluene dioxygenase 0.9313 4 109
3gce-assembly1.cif.gz_A ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 0.9311 3 106
ID Description Score Start End Superfamily
af_E7F3F1_17_122_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9522 5 109 2.102.10.10
3dqyA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9345 4 109 2.102.10.10
3gceA00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9311 3 106 2.102.10.10
4nbbE00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9288 5 110 2.102.10.10
2i7fB00 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.9123 4 107 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A2W5H428-F1-model_v4 deleted 0.9967 1 69
AF-A0A7H1RJ23-F1-model_v4 Non-heme iron oxygenase ferredoxin subunit 0.995 1 109 GO:0046872
GO:0051537
AF-A0A2S7ER31-F1-model_v4 Benzene 1,2-dioxygenase 0.9865 1 108 GO:0046872
GO:0051213
GO:0051537
AF-A0A7H1RJ23-F1-model_v4 Non-heme iron oxygenase ferredoxin subunit 0.986 1 109 GO:0046872
GO:0051537
AF-A0A2W5H428-F1-model_v4 deleted 0.9826 1 69

Map