F447186
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 453 | 225 | 906 | 109 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_10985323|Ga0163162_109853232 |
| Length | 113 |
| Sequence | VLRVCDIWRDLCASADLLPGEMKSTFDEVTGTPIVVFNLDGELYALEDQCTHDEFELSSGTFDTAEASIECVLHGARFDIRDGRALCAPAYSPVARFPVKREHDGVWARDDRD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 6 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 8 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 10 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 11 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 14 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 16 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 17 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 36 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 37 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 38 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 39 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 40 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 45 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 46 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 51 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 52 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 53 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 54 | 3300015689 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 | Metagenome | Rhizosphere |
| 55 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 57 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 58 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 60 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 63 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 65 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 87 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 88 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 89 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 90 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 91 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 92 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 93 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 94 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 95 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 96 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 97 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 98 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 99 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 100 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 101 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 102 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 103 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 104 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 105 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 106 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 107 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 108 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 109 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 110 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 111 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 112 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 113 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 114 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 115 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 116 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 117 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 118 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 119 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 120 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 121 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 122 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 123 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 124 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 125 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 126 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 127 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 128 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 129 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 130 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 131 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 132 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 155 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 156 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 157 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 158 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 159 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 160 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 161 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 162 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 163 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 164 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 165 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 166 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 167 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 168 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 169 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 170 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 171 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 172 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 173 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 176 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 177 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 178 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 179 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 180 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 181 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 185 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 186 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 187 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 188 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 189 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 190 | 3300053734 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere | Metagenome | Endosphere |
| 191 | 2547132130 | Stenotrophomonas maltophilia RR-10 | Isolate | Unclassified |
| 192 | 2571042365 | Lysobacter oryzae DSM 21044 | Isolate | Rhizosphere |
| 193 | 2576861471 | Stenotrophomonas rhizophila DSM 14405 | Isolate | Rhizosphere |
| 194 | 2643221695 | Lysobacter sp. Root494 | Isolate | Unclassified |
| 195 | 2747842428 | Stenotrophomonas sp. WCS2014-113 | Isolate | Unclassified |
| 196 | 2765235840 | Stenotrophomonas maltophilia AA1 | Isolate | Unclassified |
| 197 | 2816332141 | Stenotrophomonas muris 1190 (v2) (version 2) | Isolate | Unclassified |
| 198 | 2842391507 | Stenotrophomonas maltophilia SEMIA 4027 | Isolate | Nodule |
| 199 | 2842757796 | Stenotrophomonas sp. R-72406 | Isolate | Unclassified |
| 200 | 2852649853 | Stenotrophomonas sp. JAI102 | Isolate | Rhizosphere |
| 201 | 2857442823 | Stenotrophomonas sp. R-74235 | Isolate | Unclassified |
| 202 | 2874220319 | Stenotrophomonas maltophilia PS5 | Isolate | Unclassified |
| 203 | 2895498888 | Pseudoxanthomonas sp. SGD-10 | Isolate | Rhizosphere |
| 204 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 205 | 2895522137 | Pseudoxanthomonas sp. SGNA-20 | Isolate | Rhizosphere |
| 206 | 2895525241 | Pseudoxanthomonas sp. SGT-18 | Isolate | Rhizosphere |
| 207 | 2919089067 | Stenotrophomonas sp. 1337 | Isolate | Rhizosphere |
| 208 | 2919134579 | Stenotrophomonas geniculata 1733 | Isolate | Rhizosphere |
| 209 | 2928496128 | Stenotrophomonas indicatrix 1163 | Isolate | Unclassified |
| 210 | 2931380184 | Stenotrophomonas sp. DR822 | Isolate | Rhizosphere |
| 211 | 2937610967 | Stenotrophomonas maltophilia EP20 | Isolate | Unclassified |
| 212 | 2939589442 | Stenotrophomonas rhizophila 716 | Isolate | Rhizosphere |
| 213 | 2939622612 | Stenotrophomonas sp. 2619 | Isolate | Rhizosphere |
| 214 | 2939626828 | Stenotrophomonas sp. 2694 | Isolate | Rhizosphere |
| 215 | 2941475908 | Stenotrophomonas rhizophila 2680 | Isolate | Rhizosphere |
| 216 | 2958084443 | Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 | Isolate | Nodule |
| 217 | 2961047084 | Stenotrophomonas maltophilia EP5 | Isolate | Unclassified |
| 218 | 2961064222 | Stenotrophomonas maltophilia EP13 | Isolate | Unclassified |
| 219 | 2974307012 | Stenotrophomonas sp. SORGH_AS_0282 | Isolate | Unclassified |
| 220 | 2977247770 | Stenotrophomonas rhizophila SORGH_AS 457 | Isolate | Unclassified |
| 221 | 2984514374 | Stenotrophomonas sp. SORGH_AS282 | Isolate | Aerial Root |
| 222 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 223 | 2995948881 | Lysobacter enzymogenes B25 | Isolate | Unclassified |
| 224 | 8002869464 | Pseudoxanthomonas helianthi 110414 | Isolate | Unclassified |
| 225 | 8003014200 | Lysobacter changpingensis Cm-3-T8 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 92.05 |
| Metatranscriptomes | 0.22 |
| Isolates | 7.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.22 |
| Bulb | 0 |
| Endosphere | 17.44 |
| Nodule | 0.44 |
| Rhizoplane | 4.86 |
| Rhizosphere | 50.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0163162_10985323 | 3300013306 | Bacteria | 953 |
| 2 | SwRhRL2b_contig_401154 | 2162886007 | Bacteria | 2805 |
| 3 | JGI25151J46595_10111130 | 3300003187 | Bacteria | 716 |
| 4 | rootH2_10039162 | 3300003320 | Bacteria | 2157 |
| 5 | rootH1_10199012 | 3300003323 | Bacteria | 2854 |
| 6 | Ga0055526_1000355 | 3300003771 | Bacteria | 37199 |
| 7 | Ga0055526_1002703 | 3300003771 | Bacteria | 11790 |
| 8 | Ga0055526_1064230 | 3300003771 | Bacteria | 769 |
| 9 | Ga0055537_1000017 | 3300003773 | Bacteria | 123856 |
| 10 | Ga0055537_1000272 | 3300003773 | Bacteria | 37332 |
| 11 | Ga0055524_1000398 | 3300003775 | Bacteria | 37199 |
| 12 | Ga0055524_1005005 | 3300003775 | Bacteria | 6001 |
| 13 | Ga0055524_1055592 | 3300003775 | Bacteria | 859 |
| 14 | Ga0055536_1002484 | 3300003781 | Bacteria | 10344 |
| 15 | Ga0055536_1003225 | 3300003781 | Bacteria | 8842 |
| 16 | Ga0055536_1008755 | 3300003781 | Bacteria | 4293 |
| 17 | Ga0055536_1043849 | 3300003781 | Bacteria | 1036 |
| 18 | Ga0055536_1082513 | 3300003781 | Bacteria | 607 |
| 19 | Ga0055534_1000253 | 3300003784 | Bacteria | 37199 |
| 20 | Ga0055534_1000882 | 3300003784 | Bacteria | 13654 |
| 21 | Ga0055534_1040892 | 3300003784 | Bacteria | 683 |
| 22 | Ga0055528_1000356 | 3300003790 | Bacteria | 37199 |
| 23 | Ga0055528_1000365 | 3300003790 | Bacteria | 36744 |
| 24 | Ga0055530_10001130 | 3300003791 | Bacteria | 20812 |
| 25 | Ga0055530_10001990 | 3300003791 | Bacteria | 13865 |
| 26 | Ga0055540_1062465 | 3300003792 | Bacteria | 742 |
| 27 | Ga0055531_10002556 | 3300003794 | Bacteria | 12105 |
| 28 | Ga0055531_10011290 | 3300003794 | Bacteria | 4328 |
| 29 | Ga0055531_10011390 | 3300003794 | Bacteria | 4293 |
| 30 | Ga0055531_10027498 | 3300003794 | Bacteria | 1994 |
| 31 | Ga0058692_1000022 | 3300003856 | Bacteria | 237321 |
| 32 | Ga0065165_1054725 | 3300005262 | Bacteria | 1117 |
| 33 | Ga0065704_10071078 | 3300005289 | Bacteria | 13339 |
| 34 | Ga0065704_10086819 | 3300005289 | Bacteria | 3082 |
| 35 | Ga0065704_10328650 | 3300005289 | Bacteria | 841 |
| 36 | Ga0065704_10401792 | 3300005289 | Bacteria | 751 |
| 37 | Ga0070670_100091667 | 3300005331 | Bacteria | 2613 |
| 38 | Ga0070677_10291712 | 3300005333 | Bacteria | 825 |
| 39 | Ga0070682_100675268 | 3300005337 | Bacteria | 825 |
| 40 | Ga0070692_10583296 | 3300005345 | Bacteria | 737 |
| 41 | Ga0070668_100028380 | 3300005347 | Bacteria | 4249 |
| 42 | Ga0070669_100128405 | 3300005353 | Bacteria | 1942 |
| 43 | Ga0070669_100251524 | 3300005353 | Bacteria | 1407 |
| 44 | Ga0070675_100242847 | 3300005354 | Bacteria | 1574 |
| 45 | Ga0070671_100086795 | 3300005355 | Bacteria | 2618 |
| 46 | Ga0070674_100027348 | 3300005356 | Bacteria | 3737 |
| 47 | Ga0070667_100471075 | 3300005367 | Bacteria | 1149 |
| 48 | Ga0070667_101032832 | 3300005367 | Bacteria | 767 |
| 49 | Ga0070667_101606334 | 3300005367 | Bacteria | 611 |
| 50 | Ga0070714_101568078 | 3300005435 | Bacteria | 643 |
| 51 | Ga0070700_101226769 | 3300005441 | Bacteria | 627 |
| 52 | Ga0070678_100037148 | 3300005456 | Bacteria | 3417 |
| 53 | Ga0068867_100071979 | 3300005459 | Bacteria | 2587 |
| 54 | Ga0070672_100128859 | 3300005543 | Bacteria | 2078 |
| 55 | Ga0070665_100149365 | 3300005548 | Bacteria | 2340 |
| 56 | Ga0070664_100578866 | 3300005564 | Bacteria | 1040 |
| 57 | Ga0068854_101314769 | 3300005578 | Bacteria | 651 |
| 58 | Ga0081539_10035968 | 3300005985 | Bacteria | 2969 |
| 59 | Ga0075365_10304869 | 3300006038 | Bacteria | 1121 |
| 60 | Ga0075363_100313635 | 3300006048 | Bacteria | 912 |
| 61 | Ga0075364_10193558 | 3300006051 | Bacteria | 1377 |
| 62 | Ga0075364_10237616 | 3300006051 | Bacteria | 1237 |
| 63 | Ga0075364_10361678 | 3300006051 | Bacteria | 989 |
| 64 | Ga0075364_10718526 | 3300006051 | Bacteria | 682 |
| 65 | Ga0075364_10782509 | 3300006051 | Bacteria | 651 |
| 66 | Ga0105251_10002625 | 3300009011 | Bacteria | 13873 |
| 67 | Ga0105244_10031991 | 3300009036 | Bacteria | 2789 |
| 68 | Ga0105244_10053403 | 3300009036 | Bacteria | 2053 |
| 69 | Ga0105243_10705195 | 3300009148 | Bacteria | 984 |
| 70 | Ga0105242_10175500 | 3300009176 | Bacteria | 1886 |
| 71 | Ga0157373_10081331 | 3300013100 | Bacteria | 2284 |
| 72 | Ga0157373_10161381 | 3300013100 | Bacteria | 1577 |
| 73 | Ga0157373_10170259 | 3300013100 | Bacteria | 1532 |
| 74 | Ga0157373_10704500 | 3300013100 | Bacteria | 740 |
| 75 | Ga0157371_10000786 | 3300013102 | Bacteria | 36566 |
| 76 | Ga0157371_10108444 | 3300013102 | Bacteria | 1970 |
| 77 | Ga0157371_10325939 | 3300013102 | Bacteria | 1115 |
| 78 | Ga0157370_10080284 | 3300013104 | Bacteria | 3071 |
| 79 | Ga0157370_10327833 | 3300013104 | Bacteria | 1412 |
| 80 | Ga0157370_10514388 | 3300013104 | Bacteria | 1099 |
| 81 | Ga0157370_11353354 | 3300013104 | Bacteria | 641 |
| 82 | Ga0157369_10131951 | 3300013105 | Bacteria | 2646 |
| 83 | Ga0163162_10358133 | 3300013306 | Bacteria | 1592 |
| 84 | Ga0157372_12603112 | 3300013307 | Bacteria | 581 |
| 85 | Ga0157380_10073036 | 3300014326 | Bacteria | 2780 |
| 86 | Ga0182008_10000772 | 3300014497 | Bacteria | 22439 |
| 87 | Ga0182008_10036699 | 3300014497 | Bacteria | 2452 |
| 88 | Ga0182008_10860104 | 3300014497 | Bacteria | 531 |
| 89 | Ga0182006_1006592 | 3300015261 | Bacteria | 5379 |
| 90 | Ga0182006_1033403 | 3300015261 | Bacteria | 2063 |
| 91 | Ga0182006_1035517 | 3300015261 | Bacteria | 1986 |
| 92 | Ga0182006_1037447 | 3300015261 | Bacteria | 1922 |
| 93 | Ga0182007_10000574 | 3300015262 | Bacteria | 21633 |
| 94 | Ga0182005_1000770 | 3300015265 | Bacteria | 14604 |
| 95 | Ga0183360_10001 | 3300015689 | Bacteria | 3943671 |
| 96 | Ga0163161_10014416 | 3300017792 | Bacteria | 5503 |
| 97 | Ga0163161_10015718 | 3300017792 | Bacteria | 5277 |
| 98 | Ga0163161_10018163 | 3300017792 | Bacteria | 4930 |
| 99 | Ga0163161_10021321 | 3300017792 | Bacteria | 4555 |
| 100 | Ga0163161_10367051 | 3300017792 | Bacteria | 1148 |
| 101 | Ga0163161_10380992 | 3300017792 | Bacteria | 1127 |
| 102 | Ga0209565_1000005 | 3300025263 | Bacteria | 947317 |
| 103 | Ga0209565_1000031 | 3300025263 | Bacteria | 320341 |
| 104 | Ga0209673_1000011 | 3300025273 | Bacteria | 586604 |
| 105 | Ga0209673_1000164 | 3300025273 | Bacteria | 138082 |
| 106 | Ga0209673_1105701 | 3300025273 | Bacteria | 598 |
| 107 | Ga0209130_1003328 | 3300025284 | Bacteria | 6924 |
| 108 | Ga0209675_1000004 | 3300025291 | Bacteria | 947166 |
| 109 | Ga0209675_1000015 | 3300025291 | Bacteria | 403517 |
| 110 | Ga0209675_1061144 | 3300025291 | Bacteria | 744 |
| 111 | Ga0209676_1000110 | 3300025292 | Bacteria | 214083 |
| 112 | Ga0209676_1000517 | 3300025292 | Bacteria | 60583 |
| 113 | Ga0209676_1001548 | 3300025292 | Bacteria | 20683 |
| 114 | Ga0209676_1004276 | 3300025292 | Bacteria | 8051 |
| 115 | Ga0209676_1010322 | 3300025292 | Bacteria | 3910 |
| 116 | Ga0209676_1058078 | 3300025292 | Bacteria | 978 |
| 117 | Ga0209025_1007487 | 3300025294 | Bacteria | 8118 |
| 118 | Ga0209025_1073238 | 3300025294 | Bacteria | 1203 |
| 119 | Ga0209025_1185614 | 3300025294 | Bacteria | 528 |
| 120 | Ga0209564_1000018 | 3300025295 | Bacteria | 586913 |
| 121 | Ga0209564_1000037 | 3300025295 | Bacteria | 414794 |
| 122 | Ga0209050_1000674 | 3300025298 | Bacteria | 51506 |
| 123 | Ga0209050_1000726 | 3300025298 | Bacteria | 48194 |
| 124 | Ga0209050_1019959 | 3300025298 | Bacteria | 2517 |
| 125 | Ga0209050_1037968 | 3300025298 | Bacteria | 1380 |
| 126 | Ga0209256_1000021 | 3300025299 | Bacteria | 537097 |
| 127 | Ga0209256_1002261 | 3300025299 | Bacteria | 16322 |
| 128 | Ga0209256_1003595 | 3300025299 | Bacteria | 10672 |
| 129 | Ga0209256_1007172 | 3300025299 | Bacteria | 5598 |
| 130 | Ga0209256_1011569 | 3300025299 | Bacteria | 3509 |
| 131 | Ga0209051_1002655 | 3300025303 | Bacteria | 12505 |
| 132 | Ga0209257_1000129 | 3300025304 | Bacteria | 214155 |
| 133 | Ga0209257_1000670 | 3300025304 | Bacteria | 53641 |
| 134 | Ga0209257_1001774 | 3300025304 | Bacteria | 23862 |
| 135 | Ga0209257_1002916 | 3300025304 | Bacteria | 15775 |
| 136 | Ga0209257_1002951 | 3300025304 | Bacteria | 15605 |
| 137 | Ga0207713_1075031 | 3300025735 | Bacteria | 1235 |
| 138 | Ga0207681_10010090 | 3300025923 | Bacteria | 5780 |
| 139 | Ga0207681_10319733 | 3300025923 | Bacteria | 1234 |
| 140 | Ga0207650_10086796 | 3300025925 | Bacteria | 2383 |
| 141 | Ga0207659_10254474 | 3300025926 | Bacteria | 1426 |
| 142 | Ga0207664_10942739 | 3300025929 | Bacteria | 774 |
| 143 | Ga0207644_10075713 | 3300025931 | Bacteria | 2474 |
| 144 | Ga0207709_10004442 | 3300025935 | Bacteria | 8105 |
| 145 | Ga0207679_10884902 | 3300025945 | Bacteria | 816 |
| 146 | Ga0207668_10017831 | 3300025972 | Bacteria | 4456 |
| 147 | Ga0207658_10372261 | 3300025986 | Bacteria | 1249 |
| 148 | Ga0207658_10722058 | 3300025986 | Bacteria | 901 |
| 149 | Ga0207648_10356744 | 3300026089 | Bacteria | 1319 |
| 150 | Ga0207676_11422489 | 3300026095 | Bacteria | 690 |
| 151 | Ga0207683_10029946 | 3300026121 | Bacteria | 4715 |
| 152 | Ga0209371_1000004 | 3300027312 | Bacteria | 1098197 |
| 153 | Ga0209969_1013695 | 3300027360 | Bacteria | 1176 |
| 154 | Ga0209983_1000493 | 3300027665 | Bacteria | 8493 |
| 155 | Ga0209971_1005324 | 3300027682 | Bacteria | 3059 |
| 156 | Ga0209974_10008676 | 3300027876 | Bacteria | 3464 |
| 157 | Ga0268266_10147439 | 3300028379 | Bacteria | 2117 |
| 158 | Ga0268256_1000005 | 3300030500 | Bacteria | 1082342 |
| 159 | Ga0316176_1084937 | 3300030732 | Bacteria | 2211 |
| 160 | Ga0316176_1165439 | 3300030732 | Bacteria | 2421 |
| 161 | Ga0316183_1008117 | 3300030742 | Bacteria | 7888 |
| 162 | Ga0316181_1284613 | 3300030744 | Bacteria | 2792 |
| 163 | Ga0316182_1034774 | 3300030745 | Bacteria | 2861 |
| 164 | Ga0316182_1319342 | 3300030745 | Bacteria | 1893 |
| 165 | Ga0307513_10012001 | 3300031456 | Bacteria | 10728 |
| 166 | Ga0307513_10062298 | 3300031456 | Bacteria | 3943 |
| 167 | Ga0307408_100401226 | 3300031548 | Bacteria | 1177 |
| 168 | Ga0307408_102231387 | 3300031548 | Bacteria | 529 |
| 169 | Ga0307405_10609425 | 3300031731 | Bacteria | 892 |
| 170 | Ga0307413_10101245 | 3300031824 | Bacteria | 1904 |
| 171 | Ga0307413_10391729 | 3300031824 | Bacteria | 1086 |
| 172 | Ga0307413_11021951 | 3300031824 | Bacteria | 710 |
| 173 | Ga0307413_11906977 | 3300031824 | Bacteria | 534 |
| 174 | Ga0307413_12130221 | 3300031824 | Bacteria | 507 |
| 175 | Ga0307410_10623136 | 3300031852 | Bacteria | 902 |
| 176 | Ga0307410_10966535 | 3300031852 | Bacteria | 733 |
| 177 | Ga0307406_10630728 | 3300031901 | Bacteria | 887 |
| 178 | Ga0307406_11295778 | 3300031901 | Bacteria | 636 |
| 179 | Ga0307407_10745081 | 3300031903 | Bacteria | 741 |
| 180 | Ga0307412_10001236 | 3300031911 | Bacteria | 14465 |
| 181 | Ga0307412_10111866 | 3300031911 | Bacteria | 1951 |
| 182 | Ga0307412_10750250 | 3300031911 | Bacteria | 842 |
| 183 | Ga0307412_10919044 | 3300031911 | Bacteria | 768 |
| 184 | Ga0307409_100260955 | 3300031995 | Bacteria | 1590 |
| 185 | Ga0307416_101727301 | 3300032002 | Bacteria | 730 |
| 186 | Ga0307416_102840242 | 3300032002 | Bacteria | 579 |
| 187 | Ga0307414_10001111 | 3300032004 | Bacteria | 13729 |
| 188 | Ga0307414_10019813 | 3300032004 | Bacteria | 4178 |
| 189 | Ga0307414_10036314 | 3300032004 | Bacteria | 3289 |
| 190 | Ga0307414_10226794 | 3300032004 | Bacteria | 1537 |
| 191 | Ga0307414_10380456 | 3300032004 | Bacteria | 1220 |
| 192 | Ga0307414_10388677 | 3300032004 | Bacteria | 1208 |
| 193 | Ga0307414_11303130 | 3300032004 | Bacteria | 674 |
| 194 | Ga0307414_11468349 | 3300032004 | Bacteria | 634 |
| 195 | Ga0307414_11917642 | 3300032004 | Bacteria | 553 |
| 196 | Ga0307411_10067462 | 3300032005 | Bacteria | 2407 |
| 197 | Ga0307411_11176925 | 3300032005 | Unclassified | 694 |
| 198 | Ga0307411_11258382 | 3300032005 | Bacteria | 673 |
| 199 | Ga0237819_14026 | 3300038705 | Bacteria | 952 |
| 200 | Ga0237819_14090 | 3300038705 | Bacteria | 948 |
| 201 | Ga0439436_0006351 | 3300041404 | Bacteria | 3628 |
| 202 | Ga0439436_0015544 | 3300041404 | Bacteria | 2289 |
| 203 | Ga0439436_0085379 | 3300041404 | Bacteria | 879 |
| 204 | Ga0439439_0016225 | 3300041406 | Bacteria | 1823 |
| 205 | Ga0439439_0118406 | 3300041406 | Bacteria | 737 |
| 206 | Ga0439439_0217094 | 3300041406 | Bacteria | 560 |
| 207 | Ga0439447_005494 | 3300041407 | Bacteria | 4208 |
| 208 | Ga0439465_0008603 | 3300041413 | Bacteria | 3221 |
| 209 | Ga0439465_0113684 | 3300041413 | Bacteria | 944 |
| 210 | Ga0439465_0400830 | 3300041413 | Bacteria | 522 |
| 211 | Ga0451787_228229 | 3300041441 | Bacteria | 553 |
| 212 | Ga0451789_1245730 | 3300041443 | Bacteria | 1381 |
| 213 | Ga0451791_1002058 | 3300041451 | Bacteria | 597 |
| 214 | Ga0451791_1524172 | 3300041451 | Bacteria | 1007 |
| 215 | Ga0451793_0472877 | 3300041452 | Bacteria | 1272 |
| 216 | Ga0451793_0626574 | 3300041452 | Bacteria | 557 |
| 217 | Ga0451797_0521423 | 3300041453 | Bacteria | 2395 |
| 218 | Ga0451797_1374922 | 3300041453 | Bacteria | 1307 |
| 219 | Ga0451797_1499209 | 3300041453 | Bacteria | 1438 |
| 220 | Ga0451802_0326626 | 3300041460 | Bacteria | 828 |
| 221 | Ga0451802_0981814 | 3300041460 | Bacteria | 2360 |
| 222 | Ga0451804_0481179 | 3300041463 | Bacteria | 881 |
| 223 | Ga0451807_1463995 | 3300041486 | Bacteria | 5771 |
| 224 | Ga0451807_2178382 | 3300041486 | Bacteria | 1319 |
| 225 | Ga0451833_1179997 | 3300041491 | Bacteria | 943 |
| 226 | Ga0451837_0154038 | 3300041494 | Bacteria | 1075 |
| 227 | Ga0451837_0222902 | 3300041494 | Bacteria | 701 |
| 228 | Ga0451837_0614663 | 3300041494 | Bacteria | 3340 |
| 229 | Ga0451837_0617909 | 3300041494 | Bacteria | 735 |
| 230 | Ga0451837_1020844 | 3300041494 | Bacteria | 950 |
| 231 | Ga0451837_1653668 | 3300041494 | Bacteria | 3597 |
| 232 | Ga0451837_1868982 | 3300041494 | Bacteria | 638 |
| 233 | Ga0451845_0288626 | 3300041501 | Bacteria | 532 |
| 234 | Ga0451843_0653801 | 3300041509 | Bacteria | 2671 |
| 235 | Ga0451843_0972197 | 3300041509 | Bacteria | 897 |
| 236 | Ga0451843_1322650 | 3300041509 | Bacteria | 3148 |
| 237 | Ga0451843_1777697 | 3300041509 | Bacteria | 1488 |
| 238 | Ga0451853_0450837 | 3300041512 | Bacteria | 811 |
| 239 | Ga0451853_0878463 | 3300041512 | Bacteria | 1210 |
| 240 | Ga0439431_0132239 | 3300041997 | Bacteria | 701 |
| 241 | Ga0439433_0060506 | 3300041999 | Bacteria | 903 |
| 242 | Ga0439433_0069050 | 3300041999 | Bacteria | 850 |
| 243 | Ga0439432_004241 | 3300042006 | Bacteria | 5242 |
| 244 | Ga0439432_020257 | 3300042006 | Bacteria | 2213 |
| 245 | Ga0439432_058394 | 3300042006 | Bacteria | 1193 |
| 246 | Ga0439432_065360 | 3300042006 | Bacteria | 1115 |
| 247 | Ga0439432_094475 | 3300042006 | Bacteria | 898 |
| 248 | Ga0439432_128849 | 3300042006 | Bacteria | 747 |
| 249 | Ga0439449_0002178 | 3300042007 | Bacteria | 7692 |
| 250 | Ga0439449_0021120 | 3300042007 | Bacteria | 2438 |
| 251 | Ga0439449_0076817 | 3300042007 | Bacteria | 1231 |
| 252 | Ga0439449_0158148 | 3300042007 | Bacteria | 846 |
| 253 | Ga0439449_0184421 | 3300042007 | Bacteria | 780 |
| 254 | Ga0439452_038350 | 3300042010 | Bacteria | 1138 |
| 255 | Ga0439452_061949 | 3300042010 | Bacteria | 836 |
| 256 | Ga0439462_0017844 | 3300042015 | Bacteria | 1840 |
| 257 | Ga0439462_0126874 | 3300042015 | Bacteria | 711 |
| 258 | Ga0450911_001479 | 3300042115 | Bacteria | 5365 |
| 259 | Ga0450899_057259 | 3300042135 | Bacteria | 503 |
| 260 | Ga0439434_0024909 | 3300042435 | Bacteria | 1806 |
| 261 | Ga0451577_0016879 | 3300042876 | Bacteria | 6752 |
| 262 | Ga0453684_1306437 | 3300044712 | Bacteria | 756 |
| 263 | Ga0495591_026328 | 3300046458 | Bacteria | 1809 |
| 264 | Ga0495638_0004310 | 3300046460 | Bacteria | 10797 |
| 265 | Ga0495638_0012437 | 3300046460 | Bacteria | 5835 |
| 266 | Ga0495638_0153272 | 3300046460 | Bacteria | 1335 |
| 267 | Ga0495610_0003117 | 3300046512 | Bacteria | 13205 |
| 268 | Ga0495610_0035665 | 3300046512 | Bacteria | 2551 |
| 269 | Ga0495631_0001236 | 3300046518 | Bacteria | 15780 |
| 270 | Ga0495643_0001711 | 3300046522 | Bacteria | 19004 |
| 271 | Ga0495648_0146643 | 3300046524 | Bacteria | 1236 |
| 272 | Ga0495663_0001189 | 3300046525 | Bacteria | 8395 |
| 273 | Ga0495663_0002181 | 3300046525 | Bacteria | 5963 |
| 274 | Ga0495663_0004858 | 3300046525 | Bacteria | 3755 |
| 275 | Ga0495663_0020056 | 3300046525 | Bacteria | 1917 |
| 276 | Ga0495663_0381904 | 3300046525 | Bacteria | 516 |
| 277 | Ga0495654_0144734 | 3300046530 | Bacteria | 1056 |
| 278 | Ga0495598_0000565 | 3300046537 | Bacteria | 6959 |
| 279 | Ga0495621_0000629 | 3300046539 | Bacteria | 8876 |
| 280 | Ga0495621_0023453 | 3300046539 | Bacteria | 2052 |
| 281 | Ga0495621_0052101 | 3300046539 | Bacteria | 1466 |
| 282 | Ga0495633_0003321 | 3300046558 | Bacteria | 10806 |
| 283 | Ga0495633_0009632 | 3300046558 | Bacteria | 5316 |
| 284 | Ga0495633_0092405 | 3300046558 | Bacteria | 1406 |
| 285 | Ga0495656_0010654 | 3300046615 | Bacteria | 3349 |
| 286 | Ga0495656_0044476 | 3300046615 | Bacteria | 1870 |
| 287 | Ga0495668_0002797 | 3300046616 | Bacteria | 13892 |
| 288 | Ga0495625_0006186 | 3300046660 | Bacteria | 10722 |
| 289 | Ga0495625_0070164 | 3300046660 | Bacteria | 2460 |
| 290 | Ga0495625_0270358 | 3300046660 | Bacteria | 1097 |
| 291 | Ga0495659_0182922 | 3300046664 | Bacteria | 854 |
| 292 | Ga0495659_0278001 | 3300046664 | Bacteria | 703 |
| 293 | Ga0495659_0488667 | 3300046664 | Bacteria | 539 |
| 294 | Ga0495670_0130149 | 3300046691 | Bacteria | 1311 |
| 295 | Ga0495671_0006087 | 3300046692 | Bacteria | 7005 |
| 296 | Ga0495660_0039604 | 3300046810 | Bacteria | 2617 |
| 297 | Ga0495636_0000303 | 3300047318 | Bacteria | 19375 |
| 298 | Ga0495636_0001314 | 3300047318 | Bacteria | 9428 |
| 299 | Ga0495636_0006211 | 3300047318 | Bacteria | 4691 |
| 300 | Ga0495672_0000090 | 3300047320 | Bacteria | 148367 |
| 301 | Ga0495672_0049581 | 3300047320 | Bacteria | 2484 |
| 302 | Ga0495681_0057627 | 3300047470 | Bacteria | 1803 |
| 303 | Ga0495686_0002785 | 3300047472 | Bacteria | 15937 |
| 304 | Ga0496104_0297092 | 3300048907 | Bacteria | 1527 |
| 305 | Ga0496105_0019511 | 3300048908 | Bacteria | 5469 |
| 306 | Ga0496107_0277092 | 3300048910 | Bacteria | 1249 |
| 307 | Ga0496111_0566409 | 3300048914 | Bacteria | 833 |
| 308 | Ga0496111_1057043 | 3300048914 | Bacteria | 580 |
| 309 | Ga0496113_0198272 | 3300048916 | Bacteria | 1595 |
| 310 | Ga0496113_0257894 | 3300048916 | Bacteria | 1393 |
| 311 | Ga0496114_0584594 | 3300048917 | Bacteria | 985 |
| 312 | Ga0496116_0007757 | 3300048919 | Bacteria | 9438 |
| 313 | Ga0496116_0018588 | 3300048919 | Bacteria | 5349 |
| 314 | Ga0496116_0060132 | 3300048919 | Bacteria | 2466 |
| 315 | Ga0496116_0134688 | 3300048919 | Bacteria | 1401 |
| 316 | Ga0496116_0140329 | 3300048919 | Bacteria | 1360 |
| 317 | Ga0496116_0262538 | 3300048919 | Bacteria | 850 |
| 318 | Ga0496116_0295978 | 3300048919 | Bacteria | 773 |
| 319 | Ga0496117_0003801 | 3300048920 | Bacteria | 17210 |
| 320 | Ga0496117_0005493 | 3300048920 | Bacteria | 13286 |
| 321 | Ga0496117_0007604 | 3300048920 | Bacteria | 10529 |
| 322 | Ga0496117_0020828 | 3300048920 | Bacteria | 5334 |
| 323 | Ga0496117_0036173 | 3300048920 | Bacteria | 3698 |
| 324 | Ga0496117_0252211 | 3300048920 | Bacteria | 962 |
| 325 | Ga0496117_0264489 | 3300048920 | Bacteria | 930 |
| 326 | Ga0496117_0524297 | 3300048920 | Bacteria | 569 |
| 327 | Ga0496118_0000814 | 3300048921 | Bacteria | 49769 |
| 328 | Ga0496118_0005456 | 3300048921 | Bacteria | 14457 |
| 329 | Ga0496118_0006164 | 3300048921 | Bacteria | 13296 |
| 330 | Ga0496118_0012809 | 3300048921 | Bacteria | 8004 |
| 331 | Ga0496118_0024611 | 3300048921 | Bacteria | 5191 |
| 332 | Ga0496118_0026179 | 3300048921 | Bacteria | 4976 |
| 333 | Ga0496118_0034893 | 3300048921 | Bacteria | 4095 |
| 334 | Ga0496118_0071627 | 3300048921 | Bacteria | 2494 |
| 335 | Ga0496118_0169098 | 3300048921 | Bacteria | 1338 |
| 336 | Ga0496118_0290298 | 3300048921 | Bacteria | 904 |
| 337 | Ga0496119_0000329 | 3300048922 | Bacteria | 66425 |
| 338 | Ga0496119_0007363 | 3300048922 | Bacteria | 9942 |
| 339 | Ga0496120_0000147 | 3300048923 | Bacteria | 117881 |
| 340 | Ga0496120_0142071 | 3300048923 | Bacteria | 1217 |
| 341 | Ga0496121_0003503 | 3300048924 | Bacteria | 22323 |
| 342 | Ga0496121_0003940 | 3300048924 | Bacteria | 20555 |
| 343 | Ga0496121_0027581 | 3300048924 | Bacteria | 5311 |
| 344 | Ga0496121_0032554 | 3300048924 | Bacteria | 4736 |
| 345 | Ga0496121_0043919 | 3300048924 | Bacteria | 3863 |
| 346 | Ga0496121_0058406 | 3300048924 | Bacteria | 3189 |
| 347 | Ga0496121_0222012 | 3300048924 | Bacteria | 1330 |
| 348 | Ga0496121_0243128 | 3300048924 | Bacteria | 1253 |
| 349 | Ga0496122_0001478 | 3300048925 | Bacteria | 37832 |
| 350 | Ga0496122_0010237 | 3300048925 | Bacteria | 9714 |
| 351 | Ga0496122_0022485 | 3300048925 | Bacteria | 5602 |
| 352 | Ga0496122_0068602 | 3300048925 | Bacteria | 2544 |
| 353 | Ga0496122_0075645 | 3300048925 | Bacteria | 2373 |
| 354 | Ga0496122_0102219 | 3300048925 | Bacteria | 1911 |
| 355 | Ga0496122_0186734 | 3300048925 | Bacteria | 1229 |
| 356 | Ga0496122_0243577 | 3300048925 | Bacteria | 1011 |
| 357 | Ga0496123_0000150 | 3300048926 | Bacteria | 142879 |
| 358 | Ga0496123_0006489 | 3300048926 | Bacteria | 11321 |
| 359 | Ga0496123_0013671 | 3300048926 | Bacteria | 6789 |
| 360 | Ga0496123_0016100 | 3300048926 | Bacteria | 6092 |
| 361 | Ga0496123_0017075 | 3300048926 | Bacteria | 5859 |
| 362 | Ga0496123_0107593 | 3300048926 | Bacteria | 1603 |
| 363 | Ga0496123_0182724 | 3300048926 | Bacteria | 1093 |
| 364 | Ga0496123_0309992 | 3300048926 | Bacteria | 749 |
| 365 | Ga0496123_0312162 | 3300048926 | Bacteria | 746 |
| 366 | Ga0496123_0508409 | 3300048926 | Bacteria | 525 |
| 367 | Ga0496124_0002052 | 3300048927 | Bacteria | 27366 |
| 368 | Ga0496124_0004642 | 3300048927 | Bacteria | 15908 |
| 369 | Ga0496124_0005358 | 3300048927 | Bacteria | 14482 |
| 370 | Ga0496124_0012397 | 3300048927 | Bacteria | 8416 |
| 371 | Ga0496124_0015747 | 3300048927 | Bacteria | 7229 |
| 372 | Ga0496124_0018043 | 3300048927 | Bacteria | 6625 |
| 373 | Ga0496124_0020240 | 3300048927 | Bacteria | 6157 |
| 374 | Ga0496124_0035315 | 3300048927 | Bacteria | 4374 |
| 375 | Ga0496124_0073857 | 3300048927 | Bacteria | 2820 |
| 376 | Ga0496124_0085682 | 3300048927 | Bacteria | 2581 |
| 377 | Ga0496124_0210712 | 3300048927 | Bacteria | 1470 |
| 378 | Ga0496124_0251893 | 3300048927 | Bacteria | 1305 |
| 379 | Ga0496124_0328247 | 3300048927 | Bacteria | 1092 |
| 380 | Ga0496125_0004145 | 3300048928 | Bacteria | 16912 |
| 381 | Ga0496125_0005265 | 3300048928 | Bacteria | 14483 |
| 382 | Ga0496125_0008042 | 3300048928 | Bacteria | 11132 |
| 383 | Ga0496125_0018599 | 3300048928 | Bacteria | 6596 |
| 384 | Ga0496125_0019666 | 3300048928 | Bacteria | 6359 |
| 385 | Ga0496125_0141097 | 3300048928 | Bacteria | 1675 |
| 386 | Ga0496125_0550174 | 3300048928 | Bacteria | 640 |
| 387 | Ga0496126_0001694 | 3300048929 | Bacteria | 32787 |
| 388 | Ga0496126_0008286 | 3300048929 | Bacteria | 11225 |
| 389 | Ga0496126_0064903 | 3300048929 | Bacteria | 3269 |
| 390 | Ga0496126_0096540 | 3300048929 | Bacteria | 2591 |
| 391 | Ga0496126_0130159 | 3300048929 | Bacteria | 2175 |
| 392 | Ga0496126_0598986 | 3300048929 | Bacteria | 868 |
| 393 | Ga0496126_1321769 | 3300048929 | Bacteria | 524 |
| 394 | Ga0501306_002493 | 3300049127 | Bacteria | 1893 |
| 395 | Ga0501031_0926803 | 3300049568 | Bacteria | 557 |
| 396 | Ga0501033_0006447 | 3300049570 | Bacteria | 9183 |
| 397 | Ga0501033_0939546 | 3300049570 | Bacteria | 580 |
| 398 | Ga0501034_0192118 | 3300049571 | Bacteria | 2003 |
| 399 | Ga0501034_0256499 | 3300049571 | Bacteria | 1692 |
| 400 | Ga0501038_0055219 | 3300049574 | Bacteria | 3413 |
| 401 | Ga0501202_007004 | 3300049652 | Bacteria | 2032 |
| 402 | Ga0501217_058203 | 3300049661 | Bacteria | 1026 |
| 403 | Ga0501223_037867 | 3300049663 | Bacteria | 936 |
| 404 | Ga0501225_0204386 | 3300049705 | Bacteria | 628 |
| 405 | Ga0501268_058744 | 3300049765 | Bacteria | 758 |
| 406 | Ga0501035_1159627 | 3300049822 | Bacteria | 601 |
| 407 | Ga0501044_0069591 | 3300049823 | Bacteria | 3582 |
| 408 | Ga0501045_1325415 | 3300049824 | Bacteria | 524 |
| 409 | nmdc:mga00v17_180311_c1 | 3300050491 | Bacteria | 1363 |
| 410 | nmdc:mga00v17_18924_c1 | 3300050491 | Bacteria | 3921 |
| 411 | nmdc:mga00v17_20595_c1 | 3300050491 | Bacteria | 3781 |
| 412 | nmdc:mga00v17_655312_c1 | 3300050491 | Bacteria | 675 |
| 413 | nmdc:mga0yw44_149766_c1 | 3300050492 | Bacteria | 1521 |
| 414 | Ga0500626_026650 | 3300053128 | Bacteria | 2601 |
| 415 | Ga0500658_0070545 | 3300053134 | Bacteria | 1473 |
| 416 | Ga0500622_0439515 | 3300053156 | Bacteria | 521 |
| 417 | Ga0500609_023936 | 3300053731 | Bacteria | 836 |
| 418 | Ga0500565_027396 | 3300053734 | Bacteria | 728 |
| 419 | 2547499771 | 2547132130 | Bacteria | 4660562 |
| 420 | 2572254592 | 2571042365 | Bacteria | 3289345 |
| 421 | 2578459298 | 2576861471 | Bacteria | 4648976 |
| 422 | 2644529748 | 2643221695 | Bacteria | 3441323 |
| 423 | 2747950545 | 2747842428 | Bacteria | 4689383 |
| 424 | 2765578016 | 2765235840 | Bacteria | 4663337 |
| 425 | 2816516086 | 2816332141 | Bacteria | 4436036 |
| 426 | 2842393724 | 2842391507 | Bacteria | 4486072 |
| 427 | 2842759265 | 2842757796 | Bacteria | 3981385 |
| 428 | 2852653304 | 2852649853 | Bacteria | 4036942 |
| 429 | 2857442872 | 2857442823 | Bacteria | 4562550 |
| 430 | 2874220668 | 2874220319 | Bacteria | 4594709 |
| 431 | 2895499056 | 2895498888 | Bacteria | 5283788 |
| 432 | 2895512075 | 2895511927 | Bacteria | 6802080 |
| 433 | 2895523269 | 2895522137 | Bacteria | 3284416 |
| 434 | 2895528022 | 2895525241 | Bacteria | 3388457 |
| 435 | 2919090683 | 2919089067 | Bacteria | 4560942 |
| 436 | 2919134672 | 2919134579 | Bacteria | 4480386 |
| 437 | 2928496679 | 2928496128 | Bacteria | 4631123 |
| 438 | 2931381696 | 2931380184 | Bacteria | 4455911 |
| 439 | 2937611503 | 2937610967 | Bacteria | 4618818 |
| 440 | 2939592091 | 2939589442 | Bacteria | 4214238 |
| 441 | 2939625208 | 2939622612 | Bacteria | 4698046 |
| 442 | 2939627430 | 2939626828 | Bacteria | 4695272 |
| 443 | 2941477061 | 2941475908 | Bacteria | 4145589 |
| 444 | 2958089654 | 2958084443 | Bacteria | 7312792 |
| 445 | 2961047433 | 2961047084 | Bacteria | 4594415 |
| 446 | 2961068225 | 2961064222 | Bacteria | 4749990 |
| 447 | 2974309735 | 2974307012 | Bacteria | 4172388 |
| 448 | 2977250482 | 2977247770 | Bacteria | 4160543 |
| 449 | 2984515051 | 2984514374 | Bacteria | 4172479 |
| 450 | 2987607763 | 2987605356 | Bacteria | 4187822 |
| 451 | 2995952883 | 2995948881 | Bacteria | 6358104 |
| 452 | 8002869669 | 8002869464 | Bacteria | 3588529 |
| 453 | 8003016697 | 8003014200 | Bacteria | 4059994 |
| 454 | Ga0163162_10985323 | |||
| 455 | SwRhRL2b_contig_401154 | |||
| 456 | JGI25151J46595_10111130 | |||
| 457 | rootH2_10039162 | |||
| 458 | rootH1_10199012 | |||
| 459 | Ga0055526_1000355 | |||
| 460 | Ga0055526_1002703 | |||
| 461 | Ga0055526_1064230 | |||
| 462 | Ga0055537_1000017 | |||
| 463 | Ga0055537_1000272 | |||
| 464 | Ga0055524_1000398 | |||
| 465 | Ga0055524_1005005 | |||
| 466 | Ga0055524_1055592 | |||
| 467 | Ga0055536_1002484 | |||
| 468 | Ga0055536_1003225 | |||
| 469 | Ga0055536_1008755 | |||
| 470 | Ga0055536_1043849 | |||
| 471 | Ga0055536_1082513 | |||
| 472 | Ga0055534_1000253 | |||
| 473 | Ga0055534_1000882 | |||
| 474 | Ga0055534_1040892 | |||
| 475 | Ga0055528_1000356 | |||
| 476 | Ga0055528_1000365 | |||
| 477 | Ga0055530_10001130 | |||
| 478 | Ga0055530_10001990 | |||
| 479 | Ga0055540_1062465 | |||
| 480 | Ga0055531_10002556 | |||
| 481 | Ga0055531_10011290 | |||
| 482 | Ga0055531_10011390 | |||
| 483 | Ga0055531_10027498 | |||
| 484 | Ga0058692_1000022 | |||
| 485 | Ga0065165_1054725 | |||
| 486 | Ga0065704_10071078 | |||
| 487 | Ga0065704_10086819 | |||
| 488 | Ga0065704_10328650 | |||
| 489 | Ga0065704_10401792 | |||
| 490 | Ga0070670_100091667 | |||
| 491 | Ga0070677_10291712 | |||
| 492 | Ga0070682_100675268 | |||
| 493 | Ga0070692_10583296 | |||
| 494 | Ga0070668_100028380 | |||
| 495 | Ga0070669_100128405 | |||
| 496 | Ga0070669_100251524 | |||
| 497 | Ga0070675_100242847 | |||
| 498 | Ga0070671_100086795 | |||
| 499 | Ga0070674_100027348 | |||
| 500 | Ga0070667_100471075 | |||
| 501 | Ga0070667_101032832 | |||
| 502 | Ga0070667_101606334 | |||
| 503 | Ga0070714_101568078 | |||
| 504 | Ga0070700_101226769 | |||
| 505 | Ga0070678_100037148 | |||
| 506 | Ga0068867_100071979 | |||
| 507 | Ga0070672_100128859 | |||
| 508 | Ga0070665_100149365 | |||
| 509 | Ga0070664_100578866 | |||
| 510 | Ga0068854_101314769 | |||
| 511 | Ga0081539_10035968 | |||
| 512 | Ga0075365_10304869 | |||
| 513 | Ga0075363_100313635 | |||
| 514 | Ga0075364_10193558 | |||
| 515 | Ga0075364_10237616 | |||
| 516 | Ga0075364_10361678 | |||
| 517 | Ga0075364_10718526 | |||
| 518 | Ga0075364_10782509 | |||
| 519 | Ga0105251_10002625 | |||
| 520 | Ga0105244_10031991 | |||
| 521 | Ga0105244_10053403 | |||
| 522 | Ga0105243_10705195 | |||
| 523 | Ga0105242_10175500 | |||
| 524 | Ga0157373_10081331 | |||
| 525 | Ga0157373_10161381 | |||
| 526 | Ga0157373_10170259 | |||
| 527 | Ga0157373_10704500 | |||
| 528 | Ga0157371_10000786 | |||
| 529 | Ga0157371_10108444 | |||
| 530 | Ga0157371_10325939 | |||
| 531 | Ga0157370_10080284 | |||
| 532 | Ga0157370_10327833 | |||
| 533 | Ga0157370_10514388 | |||
| 534 | Ga0157370_11353354 | |||
| 535 | Ga0157369_10131951 | |||
| 536 | Ga0163162_10358133 | |||
| 537 | Ga0157372_12603112 | |||
| 538 | Ga0157380_10073036 | |||
| 539 | Ga0182008_10000772 | |||
| 540 | Ga0182008_10036699 | |||
| 541 | Ga0182008_10860104 | |||
| 542 | Ga0182006_1006592 | |||
| 543 | Ga0182006_1033403 | |||
| 544 | Ga0182006_1035517 | |||
| 545 | Ga0182006_1037447 | |||
| 546 | Ga0182007_10000574 | |||
| 547 | Ga0182005_1000770 | |||
| 548 | Ga0183360_10001 | |||
| 549 | Ga0163161_10014416 | |||
| 550 | Ga0163161_10015718 | |||
| 551 | Ga0163161_10018163 | |||
| 552 | Ga0163161_10021321 | |||
| 553 | Ga0163161_10367051 | |||
| 554 | Ga0163161_10380992 | |||
| 555 | Ga0209565_1000005 | |||
| 556 | Ga0209565_1000031 | |||
| 557 | Ga0209673_1000011 | |||
| 558 | Ga0209673_1000164 | |||
| 559 | Ga0209673_1105701 | |||
| 560 | Ga0209130_1003328 | |||
| 561 | Ga0209675_1000004 | |||
| 562 | Ga0209675_1000015 | |||
| 563 | Ga0209675_1061144 | |||
| 564 | Ga0209676_1000110 | |||
| 565 | Ga0209676_1000517 | |||
| 566 | Ga0209676_1001548 | |||
| 567 | Ga0209676_1004276 | |||
| 568 | Ga0209676_1010322 | |||
| 569 | Ga0209676_1058078 | |||
| 570 | Ga0209025_1007487 | |||
| 571 | Ga0209025_1073238 | |||
| 572 | Ga0209025_1185614 | |||
| 573 | Ga0209564_1000018 | |||
| 574 | Ga0209564_1000037 | |||
| 575 | Ga0209050_1000674 | |||
| 576 | Ga0209050_1000726 | |||
| 577 | Ga0209050_1019959 | |||
| 578 | Ga0209050_1037968 | |||
| 579 | Ga0209256_1000021 | |||
| 580 | Ga0209256_1002261 | |||
| 581 | Ga0209256_1003595 | |||
| 582 | Ga0209256_1007172 | |||
| 583 | Ga0209256_1011569 | |||
| 584 | Ga0209051_1002655 | |||
| 585 | Ga0209257_1000129 | |||
| 586 | Ga0209257_1000670 | |||
| 587 | Ga0209257_1001774 | |||
| 588 | Ga0209257_1002916 | |||
| 589 | Ga0209257_1002951 | |||
| 590 | Ga0207713_1075031 | |||
| 591 | Ga0207681_10010090 | |||
| 592 | Ga0207681_10319733 | |||
| 593 | Ga0207650_10086796 | |||
| 594 | Ga0207659_10254474 | |||
| 595 | Ga0207664_10942739 | |||
| 596 | Ga0207644_10075713 | |||
| 597 | Ga0207709_10004442 | |||
| 598 | Ga0207679_10884902 | |||
| 599 | Ga0207668_10017831 | |||
| 600 | Ga0207658_10372261 | |||
| 601 | Ga0207658_10722058 | |||
| 602 | Ga0207648_10356744 | |||
| 603 | Ga0207676_11422489 | |||
| 604 | Ga0207683_10029946 | |||
| 605 | Ga0209371_1000004 | |||
| 606 | Ga0209969_1013695 | |||
| 607 | Ga0209983_1000493 | |||
| 608 | Ga0209971_1005324 | |||
| 609 | Ga0209974_10008676 | |||
| 610 | Ga0268266_10147439 | |||
| 611 | Ga0268256_1000005 | |||
| 612 | Ga0316176_1084937 | |||
| 613 | Ga0316176_1165439 | |||
| 614 | Ga0316183_1008117 | |||
| 615 | Ga0316181_1284613 | |||
| 616 | Ga0316182_1034774 | |||
| 617 | Ga0316182_1319342 | |||
| 618 | Ga0307513_10012001 | |||
| 619 | Ga0307513_10062298 | |||
| 620 | Ga0307408_100401226 | |||
| 621 | Ga0307408_102231387 | |||
| 622 | Ga0307405_10609425 | |||
| 623 | Ga0307413_10101245 | |||
| 624 | Ga0307413_10391729 | |||
| 625 | Ga0307413_11021951 | |||
| 626 | Ga0307413_11906977 | |||
| 627 | Ga0307413_12130221 | |||
| 628 | Ga0307410_10623136 | |||
| 629 | Ga0307410_10966535 | |||
| 630 | Ga0307406_10630728 | |||
| 631 | Ga0307406_11295778 | |||
| 632 | Ga0307407_10745081 | |||
| 633 | Ga0307412_10001236 | |||
| 634 | Ga0307412_10111866 | |||
| 635 | Ga0307412_10750250 | |||
| 636 | Ga0307412_10919044 | |||
| 637 | Ga0307409_100260955 | |||
| 638 | Ga0307416_101727301 | |||
| 639 | Ga0307416_102840242 | |||
| 640 | Ga0307414_10001111 | |||
| 641 | Ga0307414_10019813 | |||
| 642 | Ga0307414_10036314 | |||
| 643 | Ga0307414_10226794 | |||
| 644 | Ga0307414_10380456 | |||
| 645 | Ga0307414_10388677 | |||
| 646 | Ga0307414_11303130 | |||
| 647 | Ga0307414_11468349 | |||
| 648 | Ga0307414_11917642 | |||
| 649 | Ga0307411_10067462 | |||
| 650 | Ga0307411_11176925 | |||
| 651 | Ga0307411_11258382 | |||
| 652 | Ga0237819_14026 | |||
| 653 | Ga0237819_14090 | |||
| 654 | Ga0439436_0006351 | |||
| 655 | Ga0439436_0015544 | |||
| 656 | Ga0439436_0085379 | |||
| 657 | Ga0439439_0016225 | |||
| 658 | Ga0439439_0118406 | |||
| 659 | Ga0439439_0217094 | |||
| 660 | Ga0439447_005494 | |||
| 661 | Ga0439465_0008603 | |||
| 662 | Ga0439465_0113684 | |||
| 663 | Ga0439465_0400830 | |||
| 664 | Ga0451787_228229 | |||
| 665 | Ga0451789_1245730 | |||
| 666 | Ga0451791_1002058 | |||
| 667 | Ga0451791_1524172 | |||
| 668 | Ga0451793_0472877 | |||
| 669 | Ga0451793_0626574 | |||
| 670 | Ga0451797_0521423 | |||
| 671 | Ga0451797_1374922 | |||
| 672 | Ga0451797_1499209 | |||
| 673 | Ga0451802_0326626 | |||
| 674 | Ga0451802_0981814 | |||
| 675 | Ga0451804_0481179 | |||
| 676 | Ga0451807_1463995 | |||
| 677 | Ga0451807_2178382 | |||
| 678 | Ga0451833_1179997 | |||
| 679 | Ga0451837_0154038 | |||
| 680 | Ga0451837_0222902 | |||
| 681 | Ga0451837_0614663 | |||
| 682 | Ga0451837_0617909 | |||
| 683 | Ga0451837_1020844 | |||
| 684 | Ga0451837_1653668 | |||
| 685 | Ga0451837_1868982 | |||
| 686 | Ga0451845_0288626 | |||
| 687 | Ga0451843_0653801 | |||
| 688 | Ga0451843_0972197 | |||
| 689 | Ga0451843_1322650 | |||
| 690 | Ga0451843_1777697 | |||
| 691 | Ga0451853_0450837 | |||
| 692 | Ga0451853_0878463 | |||
| 693 | Ga0439431_0132239 | |||
| 694 | Ga0439433_0060506 | |||
| 695 | Ga0439433_0069050 | |||
| 696 | Ga0439432_004241 | |||
| 697 | Ga0439432_020257 | |||
| 698 | Ga0439432_058394 | |||
| 699 | Ga0439432_065360 | |||
| 700 | Ga0439432_094475 | |||
| 701 | Ga0439432_128849 | |||
| 702 | Ga0439449_0002178 | |||
| 703 | Ga0439449_0021120 | |||
| 704 | Ga0439449_0076817 | |||
| 705 | Ga0439449_0158148 | |||
| 706 | Ga0439449_0184421 | |||
| 707 | Ga0439452_038350 | |||
| 708 | Ga0439452_061949 | |||
| 709 | Ga0439462_0017844 | |||
| 710 | Ga0439462_0126874 | |||
| 711 | Ga0450911_001479 | |||
| 712 | Ga0450899_057259 | |||
| 713 | Ga0439434_0024909 | |||
| 714 | Ga0451577_0016879 | |||
| 715 | Ga0453684_1306437 | |||
| 716 | Ga0495591_026328 | |||
| 717 | Ga0495638_0004310 | |||
| 718 | Ga0495638_0012437 | |||
| 719 | Ga0495638_0153272 | |||
| 720 | Ga0495610_0003117 | |||
| 721 | Ga0495610_0035665 | |||
| 722 | Ga0495631_0001236 | |||
| 723 | Ga0495643_0001711 | |||
| 724 | Ga0495648_0146643 | |||
| 725 | Ga0495663_0001189 | |||
| 726 | Ga0495663_0002181 | |||
| 727 | Ga0495663_0004858 | |||
| 728 | Ga0495663_0020056 | |||
| 729 | Ga0495663_0381904 | |||
| 730 | Ga0495654_0144734 | |||
| 731 | Ga0495598_0000565 | |||
| 732 | Ga0495621_0000629 | |||
| 733 | Ga0495621_0023453 | |||
| 734 | Ga0495621_0052101 | |||
| 735 | Ga0495633_0003321 | |||
| 736 | Ga0495633_0009632 | |||
| 737 | Ga0495633_0092405 | |||
| 738 | Ga0495656_0010654 | |||
| 739 | Ga0495656_0044476 | |||
| 740 | Ga0495668_0002797 | |||
| 741 | Ga0495625_0006186 | |||
| 742 | Ga0495625_0070164 | |||
| 743 | Ga0495625_0270358 | |||
| 744 | Ga0495659_0182922 | |||
| 745 | Ga0495659_0278001 | |||
| 746 | Ga0495659_0488667 | |||
| 747 | Ga0495670_0130149 | |||
| 748 | Ga0495671_0006087 | |||
| 749 | Ga0495660_0039604 | |||
| 750 | Ga0495636_0000303 | |||
| 751 | Ga0495636_0001314 | |||
| 752 | Ga0495636_0006211 | |||
| 753 | Ga0495672_0000090 | |||
| 754 | Ga0495672_0049581 | |||
| 755 | Ga0495681_0057627 | |||
| 756 | Ga0495686_0002785 | |||
| 757 | Ga0496104_0297092 | |||
| 758 | Ga0496105_0019511 | |||
| 759 | Ga0496107_0277092 | |||
| 760 | Ga0496111_0566409 | |||
| 761 | Ga0496111_1057043 | |||
| 762 | Ga0496113_0198272 | |||
| 763 | Ga0496113_0257894 | |||
| 764 | Ga0496114_0584594 | |||
| 765 | Ga0496116_0007757 | |||
| 766 | Ga0496116_0018588 | |||
| 767 | Ga0496116_0060132 | |||
| 768 | Ga0496116_0134688 | |||
| 769 | Ga0496116_0140329 | |||
| 770 | Ga0496116_0262538 | |||
| 771 | Ga0496116_0295978 | |||
| 772 | Ga0496117_0003801 | |||
| 773 | Ga0496117_0005493 | |||
| 774 | Ga0496117_0007604 | |||
| 775 | Ga0496117_0020828 | |||
| 776 | Ga0496117_0036173 | |||
| 777 | Ga0496117_0252211 | |||
| 778 | Ga0496117_0264489 | |||
| 779 | Ga0496117_0524297 | |||
| 780 | Ga0496118_0000814 | |||
| 781 | Ga0496118_0005456 | |||
| 782 | Ga0496118_0006164 | |||
| 783 | Ga0496118_0012809 | |||
| 784 | Ga0496118_0024611 | |||
| 785 | Ga0496118_0026179 | |||
| 786 | Ga0496118_0034893 | |||
| 787 | Ga0496118_0071627 | |||
| 788 | Ga0496118_0169098 | |||
| 789 | Ga0496118_0290298 | |||
| 790 | Ga0496119_0000329 | |||
| 791 | Ga0496119_0007363 | |||
| 792 | Ga0496120_0000147 | |||
| 793 | Ga0496120_0142071 | |||
| 794 | Ga0496121_0003503 | |||
| 795 | Ga0496121_0003940 | |||
| 796 | Ga0496121_0027581 | |||
| 797 | Ga0496121_0032554 | |||
| 798 | Ga0496121_0043919 | |||
| 799 | Ga0496121_0058406 | |||
| 800 | Ga0496121_0222012 | |||
| 801 | Ga0496121_0243128 | |||
| 802 | Ga0496122_0001478 | |||
| 803 | Ga0496122_0010237 | |||
| 804 | Ga0496122_0022485 | |||
| 805 | Ga0496122_0068602 | |||
| 806 | Ga0496122_0075645 | |||
| 807 | Ga0496122_0102219 | |||
| 808 | Ga0496122_0186734 | |||
| 809 | Ga0496122_0243577 | |||
| 810 | Ga0496123_0000150 | |||
| 811 | Ga0496123_0006489 | |||
| 812 | Ga0496123_0013671 | |||
| 813 | Ga0496123_0016100 | |||
| 814 | Ga0496123_0017075 | |||
| 815 | Ga0496123_0107593 | |||
| 816 | Ga0496123_0182724 | |||
| 817 | Ga0496123_0309992 | |||
| 818 | Ga0496123_0312162 | |||
| 819 | Ga0496123_0508409 | |||
| 820 | Ga0496124_0002052 | |||
| 821 | Ga0496124_0004642 | |||
| 822 | Ga0496124_0005358 | |||
| 823 | Ga0496124_0012397 | |||
| 824 | Ga0496124_0015747 | |||
| 825 | Ga0496124_0018043 | |||
| 826 | Ga0496124_0020240 | |||
| 827 | Ga0496124_0035315 | |||
| 828 | Ga0496124_0073857 | |||
| 829 | Ga0496124_0085682 | |||
| 830 | Ga0496124_0210712 | |||
| 831 | Ga0496124_0251893 | |||
| 832 | Ga0496124_0328247 | |||
| 833 | Ga0496125_0004145 | |||
| 834 | Ga0496125_0005265 | |||
| 835 | Ga0496125_0008042 | |||
| 836 | Ga0496125_0018599 | |||
| 837 | Ga0496125_0019666 | |||
| 838 | Ga0496125_0141097 | |||
| 839 | Ga0496125_0550174 | |||
| 840 | Ga0496126_0001694 | |||
| 841 | Ga0496126_0008286 | |||
| 842 | Ga0496126_0064903 | |||
| 843 | Ga0496126_0096540 | |||
| 844 | Ga0496126_0130159 | |||
| 845 | Ga0496126_0598986 | |||
| 846 | Ga0496126_1321769 | |||
| 847 | Ga0501306_002493 | |||
| 848 | Ga0501031_0926803 | |||
| 849 | Ga0501033_0006447 | |||
| 850 | Ga0501033_0939546 | |||
| 851 | Ga0501034_0192118 | |||
| 852 | Ga0501034_0256499 | |||
| 853 | Ga0501038_0055219 | |||
| 854 | Ga0501202_007004 | |||
| 855 | Ga0501217_058203 | |||
| 856 | Ga0501223_037867 | |||
| 857 | Ga0501225_0204386 | |||
| 858 | Ga0501268_058744 | |||
| 859 | Ga0501035_1159627 | |||
| 860 | Ga0501044_0069591 | |||
| 861 | Ga0501045_1325415 | |||
| 862 | nmdc:mga00v17_180311_c1 | |||
| 863 | nmdc:mga00v17_18924_c1 | |||
| 864 | nmdc:mga00v17_20595_c1 | |||
| 865 | nmdc:mga00v17_655312_c1 | |||
| 866 | nmdc:mga0yw44_149766_c1 | |||
| 867 | Ga0500626_026650 | |||
| 868 | Ga0500658_0070545 | |||
| 869 | Ga0500622_0439515 | |||
| 870 | Ga0500609_023936 | |||
| 871 | Ga0500565_027396 | |||
| 872 | 2547499771 | |||
| 873 | 2572254592 | |||
| 874 | 2578459298 | |||
| 875 | 2644529748 | |||
| 876 | 2747950545 | |||
| 877 | 2765578016 | |||
| 878 | 2816516086 | |||
| 879 | 2842393724 | |||
| 880 | 2842759265 | |||
| 881 | 2852653304 | |||
| 882 | 2857442872 | |||
| 883 | 2874220668 | |||
| 884 | 2895499056 | |||
| 885 | 2895512075 | |||
| 886 | 2895523269 | |||
| 887 | 2895528022 | |||
| 888 | 2919090683 | |||
| 889 | 2919134672 | |||
| 890 | 2928496679 | |||
| 891 | 2931381696 | |||
| 892 | 2937611503 | |||
| 893 | 2939592091 | |||
| 894 | 2939625208 | |||
| 895 | 2939627430 | |||
| 896 | 2941477061 | |||
| 897 | 2958089654 | |||
| 898 | 2961047433 | |||
| 899 | 2961068225 | |||
| 900 | 2974309735 | |||
| 901 | 2977250482 | |||
| 902 | 2984515051 | |||
| 903 | 2987607763 | |||
| 904 | 2995952883 | |||
| 905 | 8002869669 | |||
| 906 | 8003016697 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7bui-assembly1.cif.gz_E | complex of reduced oxygenase and oxidized ferredoxin in carbazole 1,9a- dioxygenase | 0.9372 | 5 | 106 |
| 2qpz-assembly1.cif.gz_A | naphthalene 1,2-dioxygenase rieske ferredoxin | 0.9351 | 4 | 106 |
| 7bui-assembly1.cif.gz_D | complex of reduced oxygenase and oxidized ferredoxin in carbazole 1,9a- dioxygenase | 0.9327 | 6 | 105 |
| 4emj-assembly1.cif.gz_B | complex between the reductase and ferredoxin components of toluene dioxygenase | 0.9313 | 4 | 109 |
| 3gce-assembly1.cif.gz_A | ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 | 0.9311 | 3 | 106 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_E7F3F1_17_122_2.102.10.10 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.9522 | 5 | 109 | 2.102.10.10 |
| 3dqyA00 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.9345 | 4 | 109 | 2.102.10.10 |
| 3gceA00 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.9311 | 3 | 106 | 2.102.10.10 |
| 4nbbE00 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.9288 | 5 | 110 | 2.102.10.10 |
| 2i7fB00 | Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain | 0.9123 | 4 | 107 | 2.102.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2W5H428-F1-model_v4 | deleted | 0.9967 | 1 | 69 |
|
| AF-A0A7H1RJ23-F1-model_v4 | Non-heme iron oxygenase ferredoxin subunit | 0.995 | 1 | 109 |
GO:0046872
GO:0051537 |
| AF-A0A2S7ER31-F1-model_v4 | Benzene 1,2-dioxygenase | 0.9865 | 1 | 108 |
GO:0046872
GO:0051213 GO:0051537 |
| AF-A0A7H1RJ23-F1-model_v4 | Non-heme iron oxygenase ferredoxin subunit | 0.986 | 1 | 109 |
GO:0046872
GO:0051537 |
| AF-A0A2W5H428-F1-model_v4 | deleted | 0.9826 | 1 | 69 |
|