F447220

General Info

Members Datasets Scaffolds Average Seq Length
453 380 906 366

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10002137|Ga0307516_100021376
Length 406
Sequence MAGVTLHQLGKSYEGQPEVVRNVSLDIADGEFCVFVGPSGCGKSTLLRMVAGLEDITRGDLHIGGQRVNELAPSERNVAMVFQNYALYPHLDVARNISFGLRLAGLSRTAIRERVLRIARMLEIEPLLGRKPKALSGGQRQRVAIGRALVRDPGVFLFDEPLSNLDAALRTQMRVEIARMHREYGRASTIYVTHDQVEAMTLADKIVLLHTGADVQAHGSVAQVGAPLDLYEHPRSLFVAGFMGSPRMNLLPARVYTMQEHGVTVSLPDGSLVQAAVRPHAGVEIGSAVTLGVRAEHLKPAADDTAFSTVACRVQWVEHLGDTTYAYLDTAAAQALVLRLHGTSPVAIGQALRVLVPAAQAHVFDTQGLALARLDLPHQPAVAELPPRTVRGTDGVTEPTFSGDNT

Samples

Sample ID Description Type Environment
1 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
10 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
11 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
15 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
18 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
19 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
20 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
21 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
22 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
23 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
26 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
27 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
28 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
29 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
30 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
31 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
32 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
33 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
34 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
35 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
36 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
39 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
40 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
41 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
42 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
44 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
45 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
49 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
50 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
53 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
54 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
55 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
56 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
57 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
58 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
59 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
60 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
61 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
62 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
63 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
64 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
65 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
66 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
67 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
68 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
69 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
70 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
71 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
72 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
73 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
74 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
75 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
76 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
77 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
78 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
79 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
80 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
81 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
82 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
83 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
84 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
85 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
86 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
87 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
88 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
89 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
90 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
91 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
92 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
93 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
94 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
95 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
96 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
97 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
98 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
99 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
100 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
101 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
102 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
103 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
104 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
105 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
106 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
107 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
108 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
109 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
110 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
111 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
112 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
113 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
114 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
115 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
116 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
117 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
118 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
119 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
120 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
121 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
122 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
123 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
124 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
125 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
126 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
127 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
128 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
129 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
130 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
131 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
132 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
133 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
134 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
135 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
136 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
137 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
138 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
139 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
140 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
141 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
142 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
143 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
144 2516143018 Ensifer sp. BR816 Isolate Nodule
145 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
146 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
147 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
148 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
149 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
150 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
151 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
152 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
153 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
154 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
155 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
156 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
157 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
158 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
159 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
160 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
161 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
162 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
163 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
164 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
165 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
166 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
167 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
168 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
169 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
170 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
171 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
172 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
173 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
174 2643221629 Devosia sp. Root105 Isolate Unclassified
175 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
176 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
177 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
178 2643221662 Devosia sp. Root413D1 Isolate Unclassified
179 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
180 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
181 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
182 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
183 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
184 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
185 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
186 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
187 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
188 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
189 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
190 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
191 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
192 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
193 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
194 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
195 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
196 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
197 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
198 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
199 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
200 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
201 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
202 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
203 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
204 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
205 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
206 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
207 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
208 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
209 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
210 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
211 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
212 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
213 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
214 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
215 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
216 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
217 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
218 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
219 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
220 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
221 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
222 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
223 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
224 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
225 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
226 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
227 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
228 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
229 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
230 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
231 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
232 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
233 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
234 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
235 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
236 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
237 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
238 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
239 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
240 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
241 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
242 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
243 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
244 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
245 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
246 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
247 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
248 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
249 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
250 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
251 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
252 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
253 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
254 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
255 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
256 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
257 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
258 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
259 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
260 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
261 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
262 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
263 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
264 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
265 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
266 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
267 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
268 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
269 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
270 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
271 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
272 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
273 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
274 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
275 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
276 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
277 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
278 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
279 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
280 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
281 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
282 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
283 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
284 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
285 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
286 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
287 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
288 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
289 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
290 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
291 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
292 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
293 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
294 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
295 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
296 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
297 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
298 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
299 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
300 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
301 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
302 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
303 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
304 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
305 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
306 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
307 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
308 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
309 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
310 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
311 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
312 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
313 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
314 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
315 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
316 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
317 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
318 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
319 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
320 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
321 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
322 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
323 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
324 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
325 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
326 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
327 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
328 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
329 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
330 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
331 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
332 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
333 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
334 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
335 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
336 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
337 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
338 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
339 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
340 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
341 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
342 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
343 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
344 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
345 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
346 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
347 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
348 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
349 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
350 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
351 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
352 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
353 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
354 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
355 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
356 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
357 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
358 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
359 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
360 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
361 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
362 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
363 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
364 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
365 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
366 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
367 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
368 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
369 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
370 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
371 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
372 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
373 2996887358 Rhizobium sp. R711 Isolate Nodule
374 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
375 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
376 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
377 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
378 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
379 8005258706 Rhizobium sp. R693 Isolate Nodule
380 8005321885 Rhizobium sp. R72 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 41.72
Metatranscriptomes 0
Isolates 58.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.91
Nodule 49.67
Rhizoplane 0.66
Rhizosphere 21.63
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307516_10002137 3300031730 Bacteria 26777
2 JGI25152J39213_1000633 3300002773 Bacteria 18606
3 JGI25150J39212_1005348 3300002774 Bacteria 2750
4 JGI25159J45721_1004959 3300002987 Bacteria 4266
5 JGI25153J46596_10000365 3300003215 Bacteria 31062
6 JGI25153J46596_10005488 3300003215 Bacteria 6642
7 Ga0055535_1000125 3300003761 Bacteria 81678
8 Ga0055535_1000978 3300003761 Bacteria 18662
9 Ga0055529_1000610 3300003763 Bacteria 27246
10 Ga0055526_1016808 3300003771 Bacteria 2836
11 Ga0055536_1001232 3300003781 Bacteria 15793
12 Ga0055540_1004313 3300003792 Bacteria 6475
13 Ga0055531_10003994 3300003794 Bacteria 9149
14 Ga0065165_1004158 3300005262 Bacteria 9268
15 Ga0070662_100029400 3300005457 Bacteria 3835
16 Ga0070665_100001940 3300005548 Bacteria 23325
17 Ga0070665_100010064 3300005548 Bacteria 9570
18 Ga0068852_100338998 3300005616 Bacteria 1465
19 Ga0068862_100028477 3300005844 Bacteria 4705
20 Ga0075366_10009137 3300006195 Bacteria 5527
21 Ga0075366_10083483 3300006195 Bacteria 1909
22 Ga0075370_10008127 3300006353 Bacteria 5387
23 Ga0105242_10051367 3300009176 Bacteria 3359
24 Ga0105237_10000793 3300009545 Bacteria 43237
25 Ga0123340_1057264 3300009763 Bacteria 1221
26 Ga0123341_1083617 3300009765 Bacteria 1221
27 Ga0123341_1083618 3300009765 Bacteria 1221
28 Ga0123342_1005378 3300009766 Bacteria 18606
29 Ga0105239_10002685 3300010375 Bacteria 22396
30 Ga0105239_10382422 3300010375 Bacteria 1591
31 Ga0182008_10001236 3300014497 Bacteria 17537
32 Ga0157379_10035906 3300014968 Bacteria 4420
33 Ga0163161_10107761 3300017792 Bacteria 2080
34 Ga0213872_10003368 3300021361 Bacteria 8893
35 Ga0228711_1000045 3300022739 Bacteria 85435
36 Ga0228710_1000036 3300022740 Bacteria 91904
37 Ga0207427_100518 3300025231 Bacteria 20380
38 Ga0209258_100071 3300025242 Bacteria 278319
39 Ga0207425_1000686 3300025245 Bacteria 18501
40 Ga0209759_1002194 3300025256 Bacteria 8939
41 Ga0209129_1000035 3300025258 Bacteria 329303
42 Ga0209129_1016927 3300025258 Bacteria 1447
43 Ga0209455_1000030 3300025272 Bacteria 533479
44 Ga0209673_1029884 3300025273 Bacteria 1727
45 Ga0209676_1002041 3300025292 Bacteria 15794
46 Ga0209025_1000062 3300025294 Bacteria 304236
47 Ga0209025_1011931 3300025294 Bacteria 5650
48 Ga0209564_1000024 3300025295 Bacteria 535041
49 Ga0209758_1000066 3300025297 Bacteria 298620
50 Ga0209758_1000213 3300025297 Bacteria 126745
51 Ga0209758_1001509 3300025297 Bacteria 27022
52 Ga0209758_1019086 3300025297 Bacteria 3328
53 Ga0209050_1000178 3300025298 Bacteria 145314
54 Ga0209050_1001316 3300025298 Bacteria 27798
55 Ga0209050_1004617 3300025298 Bacteria 9197
56 Ga0209256_1000024 3300025299 Bacteria 448909
57 Ga0209051_1002362 3300025303 Bacteria 13655
58 Ga0209051_1012610 3300025303 Bacteria 4078
59 Ga0209257_1003554 3300025304 Bacteria 13243
60 Ga0207671_10000398 3300025914 Bacteria 60659
61 Ga0207698_10218538 3300026142 Bacteria 1720
62 Ga0209281_1000178 3300027111 Bacteria 148152
63 Ga0209281_1001139 3300027111 Bacteria 18837
64 Ga0209282_1000023 3300027666 Bacteria 173309
65 Ga0209974_10005968 3300027876 Bacteria 4267
66 Ga0268266_10000254 3300028379 Bacteria 90104
67 Ga0268266_10105489 3300028379 Bacteria 2490
68 Ga0265336_10000061 3300028666 Bacteria 102829
69 Ga0307515_10000041 3300028794 Bacteria 319110
70 Ga0307515_10000109 3300028794 Bacteria 195895
71 Ga0307515_10000130 3300028794 Bacteria 179263
72 Ga0307515_10000184 3300028794 Bacteria 153952
73 Ga0307515_10004774 3300028794 Bacteria 27760
74 Ga0307515_10015462 3300028794 Bacteria 14055
75 Ga0307515_10027861 3300028794 Bacteria 9633
76 Ga0307515_10034836 3300028794 Bacteria 8220
77 Ga0307515_10036350 3300028794 Bacteria 7970
78 Ga0307515_10040058 3300028794 Bacteria 7421
79 Ga0307515_10132860 3300028794 Bacteria 2727
80 Ga0265324_10009133 3300029957 Bacteria 3890
81 Ga0307512_10010755 3300030522 Bacteria 8700
82 Ga0307513_10012239 3300031456 Bacteria 10607
83 Ga0307513_10018043 3300031456 Bacteria 8448
84 Ga0307513_10068528 3300031456 Bacteria 3716
85 Ga0307513_10108464 3300031456 Bacteria 2777
86 Ga0307509_10003968 3300031507 Bacteria 21826
87 Ga0307509_10053237 3300031507 Bacteria 4317
88 Ga0307508_10000237 3300031616 Bacteria 67014
89 Ga0307508_10026066 3300031616 Bacteria 5300
90 Ga0307514_10002227 3300031649 Bacteria 20686
91 Ga0307514_10002692 3300031649 Bacteria 17987
92 Ga0307514_10087458 3300031649 Bacteria 2283
93 Ga0307514_10199879 3300031649 Bacteria 1258
94 Ga0307516_10000054 3300031730 Bacteria 126288
95 Ga0307516_10023063 3300031730 Bacteria 6386
96 Ga0307516_10043683 3300031730 Bacteria 4439
97 Ga0307410_10121661 3300031852 Bacteria 1904
98 Ga0315914_1000016 3300031967 Bacteria 126814
99 Ga0315913_1000027 3300033430 Bacteria 83484
100 Ga0315915_1000007 3300033464 Bacteria 319225
101 Ga0316582_0197080 3300036647 Bacteria 1373
102 Ga0373925_0076781 3300037068 Bacteria 2534
103 Ga0395905_0000663 3300037471 Bacteria 45751
104 Ga0395905_0001510 3300037471 Bacteria 27815
105 Ga0436361_0786816 3300039447 Bacteria 8345
106 Ga0436361_1074237 3300039447 Bacteria 1310
107 Ga0439436_0042386 3300041404 Bacteria 1301
108 Ga0450918_000309 3300042531 Bacteria 10941
109 Ga0466969_0000005 3300044656 Bacteria 167170
110 Ga0466969_0000748 3300044656 Bacteria 17589
111 Ga0466965_0059997 3300044683 Bacteria 1899
112 Ga0466966_0001778 3300044684 Bacteria 14000
113 Ga0466966_0065510 3300044684 Bacteria 2284
114 Ga0466961_0016191 3300044693 Bacteria 4787
115 Ga0466970_0009300 3300044765 Bacteria 4963
116 Ga0466970_0056553 3300044765 Bacteria 2096
117 Ga0466959_0015415 3300045049 Bacteria 5566
118 Ga0495617_034782 3300046452 Bacteria 1692
119 Ga0495590_0075252 3300046457 Bacteria 1188
120 Ga0495638_0000141 3300046460 Bacteria 114543
121 Ga0495639_0004866 3300046475 Bacteria 5763
122 Ga0495639_0006549 3300046475 Bacteria 5008
123 Ga0495585_0014469 3300046492 Bacteria 4596
124 Ga0495607_0010684 3300046501 Bacteria 6154
125 Ga0495583_0000068 3300046506 Bacteria 188922
126 Ga0495583_0000957 3300046506 Bacteria 33535
127 Ga0495583_0009020 3300046506 Bacteria 6009
128 Ga0495606_0010595 3300046507 Bacteria 7629
129 Ga0495606_0097365 3300046507 Bacteria 1798
130 Ga0495610_0010931 3300046512 Bacteria 5596
131 Ga0495610_0022181 3300046512 Bacteria 3478
132 Ga0495620_0000282 3300046515 Bacteria 37003
133 Ga0495620_0036492 3300046515 Bacteria 2199
134 Ga0495631_0000449 3300046518 Bacteria 28140
135 Ga0495631_0008404 3300046518 Bacteria 5203
136 Ga0495631_0026390 3300046518 Bacteria 2669
137 Ga0495632_0003847 3300046519 Bacteria 10445
138 Ga0495632_0074176 3300046519 Bacteria 1630
139 Ga0495643_0002918 3300046522 Bacteria 12970
140 Ga0495643_0046845 3300046522 Bacteria 2343
141 Ga0495666_0078485 3300046526 Bacteria 1564
142 Ga0495625_0001972 3300046660 Bacteria 23159
143 Ga0495625_0023033 3300046660 Bacteria 4763
144 Ga0495625_0112141 3300046660 Bacteria 1863
145 Ga0495625_0122476 3300046660 Bacteria 1768
146 Ga0495649_0016424 3300046694 Bacteria 4194
147 Ga0495660_0039079 3300046810 Bacteria 2636
148 Ga0495672_0000222 3300047320 Bacteria 81058
149 Ga0495687_002890 3300047443 Bacteria 13118
150 Ga0495686_0020844 3300047472 Bacteria 4367
151 Ga0495686_0054983 3300047472 Bacteria 2491
152 Ga0495626_0052813 3300048091 Bacteria 1872
153 Ga0496114_0020822 3300048917 Bacteria 5325
154 Ga0496121_0106436 3300048924 Bacteria 2150
155 Ga0496121_0190320 3300048924 Bacteria 1472
156 Ga0496122_0002488 3300048925 Bacteria 26045
157 Ga0496123_0002044 3300048926 Bacteria 26045
158 Ga0496125_0002193 3300048928 Bacteria 26079
159 Ga0501068_0156194 3300049584 Bacteria 1436
160 Ga0501075_0035845 3300049591 Bacteria 3701
161 Ga0501076_0140569 3300049592 Bacteria 1961
162 Ga0501227_002817 3300049665 Bacteria 3817
163 Ga0501080_0244627 3300049742 Bacteria 1637
164 nmdc:mga0k408_46595_c1 3300050493 Bacteria 2504
165 nmdc:mga07m45_1510_c1 3300050496 Bacteria 10668
166 nmdc:mga07m45_31318_c1 3300050496 Bacteria 2948
167 Ga0500635_0000032 3300053080 Bacteria 98869
168 Ga0500578_0000182 3300053086 Bacteria 75873
169 Ga0500644_0024128 3300053088 Bacteria 1855
170 Ga0500646_0004536 3300053090 Bacteria 3514
171 Ga0500651_0018037 3300053093 Bacteria 4364
172 Ga0500569_000732 3300053109 Bacteria 5719
173 Ga0500594_0005417 3300053118 Bacteria 2831
174 Ga0500618_003507 3300053125 Bacteria 5348
175 Ga0500642_0000269 3300053130 Bacteria 19474
176 Ga0500642_0004075 3300053130 Bacteria 4514
177 Ga0500652_001572 3300053131 Bacteria 6975
178 Ga0500568_0000269 3300053139 Bacteria 44003
179 Ga0500568_0002049 3300053139 Bacteria 12238
180 Ga0500568_0014414 3300053139 Bacteria 3571
181 Ga0500577_0017473 3300053142 Bacteria 2285
182 Ga0500588_0019706 3300053146 Bacteria 1798
183 Ga0500616_0000502 3300053153 Bacteria 49980
184 Ga0500616_0000771 3300053153 Bacteria 36893
185 Ga0500616_0002046 3300053153 Bacteria 17754
186 Ga0500622_0000600 3300053156 Bacteria 32731
187 Ga0500622_0001796 3300053156 Bacteria 16361
188 Ga0500609_003332 3300053731 Bacteria 2263
189 Ga0466962_0032227 3300061719 Bacteria 2508
190 2509111122 2508501122 Bacteria 6292184
191 2510302618 2510065057 Bacteria 6649661
192 2511174556 2510917026 Bacteria 7046020
193 2511181342 2510917028 Bacteria 6185411
194 2511392167 2511231027 Bacteria 5013807
195 2511497650 2511231052 Bacteria 6974333
196 2512530086 2512047086 Bacteria 6850303
197 2512530400 2512047086 Bacteria 6850303
198 2512969674 2512875026 Bacteria 6861065
199 2513581753 2513237086 Bacteria 7265287
200 2513603171 2513237089 Bacteria 6553624
201 2513618352 2513237091 Bacteria 6900273
202 2513869805 2513237138 Bacteria 7368160
203 2513883779 2513237140 Bacteria 7076289
204 2513902116 2513237143 Bacteria 6664116
205 2513911692 2513237144 Bacteria 7530820
206 2513985242 2513237156 Bacteria 6402557
207 2514004459 2513237160 Bacteria 6650282
208 2515612753 2515154107 Bacteria 6795637
209 2516205078 2516143018 Bacteria 6951533
210 2516207980 2516143018 Bacteria 6951533
211 2516896685 2516653046 Bacteria 6989037
212 2517565448 2517487022 Bacteria 7227575
213 2523468491 2523231067 Bacteria 5230452
214 2523470204 2523231067 Bacteria 5230452
215 2524452189 2524023207 Bacteria 6813453
216 2551677152 2551306084 Bacteria 8942552
217 2551683001 2551306085 Bacteria 7347181
218 2551695415 2551306086 Bacteria 6843938
219 2551702689 2551306087 Bacteria 7351905
220 2551712970 2551306089 Bacteria 7162724
221 2551721264 2551306090 Bacteria 7953713
222 2551722782 2551306090 Bacteria 7953713
223 2551725470 2551306091 Bacteria 7086830
224 2551732290 2551306092 Bacteria 6992595
225 2551745252 2551306093 Bacteria 7064773
226 2585229474 2582581299 Bacteria 6518058
227 2585268250 2582581306 Bacteria 6450535
228 2585391146 2582581865 Bacteria 6644329
229 2585399531 2582581867 Bacteria 7184437
230 2585404422 2582581867 Bacteria 7184437
231 2585542879 2585427528 Bacteria 6842387
232 2585824740 2585427590 Bacteria 6824633
233 2585841179 2585427593 Bacteria 7141551
234 2585993763 2585427633 Bacteria 6413184
235 2586004692 2585427634 Bacteria 6455027
236 2587729117 2585428057 Bacteria 6737412
237 2587733691 2585428058 Bacteria 6853932
238 2587735623 2585428058 Bacteria 6853932
239 2587757107 2585428062 Bacteria 6842168
240 2588292598 2588253510 Bacteria 6901809
241 2600376064 2600254933 Bacteria 4750527
242 2643967177 2643221592 Bacteria 6608788
243 2644140008 2643221625 Bacteria 6512927
244 2644169662 2643221629 Bacteria 5850260
245 2644193747 2643221634 Bacteria 6705461
246 2644246415 2643221644 Bacteria 6865017
247 2644271248 2643221648 Bacteria 6521465
248 2644350298 2643221662 Bacteria 5851492
249 2671692282 2671180139 Bacteria 4196045
250 2692318003 2690316117 Bacteria 6800650
251 2692318998 2690316117 Bacteria 6800650
252 2739348293 2738543031 Bacteria 5769731
253 2753463639 2751185821 Bacteria 6189929
254 2770197633 2767802442 Bacteria 5747986
255 2792621679 2791355091 Bacteria 6135441
256 2792627636 2791355092 Bacteria 6248105
257 2792642961 2791355094 Bacteria 7011481
258 2802716100 2802428858 Bacteria 6636079
259 2802722862 2802428859 Bacteria 6667919
260 2802728993 2802428860 Bacteria 6525526
261 2802735387 2802428861 Bacteria 6534206
262 2802742037 2802428862 Bacteria 6633353
263 2802748487 2802428863 Bacteria 6410669
264 2804754310 2802429268 Bacteria 6094027
265 2819683431 2818991461 Bacteria 7026071
266 2838075755 2838074704 Bacteria 6785777
267 2842875143 2842871566 Bacteria 4827117
268 2847422501 2847417321 Bacteria 6913799
269 2847423494 2847417321 Bacteria 6913799
270 2848998090 2848992105 Bacteria 6810864
271 2854899727 2854896431 Bacteria 5869725
272 2854921048 2854916844 Bacteria 5725939
273 2855828481 2855825444 Bacteria 6785811
274 2855843595 2855839649 Bacteria 7135830
275 2855875838 2855872281 Bacteria 6964271
276 2858807143 2858800743 Bacteria 6603254
277 2896388207 2896384573 Bacteria 7700774
278 2915983797 2915980308 Bacteria 6624279
279 2915992160 2915986958 Bacteria 6739310
280 2915996581 2915993759 Bacteria 7016183
281 2916007407 2916000859 Bacteria 6865702
282 2916009920 2916007675 Bacteria 6898660
283 2916015322 2916014648 Bacteria 6946486
284 2916025525 2916021584 Bacteria 6854472
285 2916031229 2916028427 Bacteria 6748433
286 2916037828 2916035215 Bacteria 6755766
287 2916043598 2916041962 Bacteria 6820487
288 2916051745 2916048683 Bacteria 6543552
289 2916057865 2916055098 Bacteria 6758838
290 2916068402 2916061851 Bacteria 6737736
291 2916070006 2916068649 Bacteria 6943657
292 2916076860 2916076590 Bacteria 6596108
293 2919174060 2919171160 Bacteria 6499771
294 2920764318 2920760137 Bacteria 7427611
295 2921208043 2921201388 Bacteria 6926299
296 2921209106 2921208531 Bacteria 6745326
297 2921241235 2921237296 Bacteria 6876710
298 2921247311 2921244191 Bacteria 6568419
299 2921257005 2921250672 Bacteria 6677771
300 2921259793 2921257292 Bacteria 6808382
301 2921266636 2921263974 Bacteria 6864552
302 2921285092 2921282425 Bacteria 6826397
303 2921290644 2921289301 Bacteria 7316391
304 2921298569 2921296804 Bacteria 7176999
305 2923559866 2923556063 Bacteria 6793593
306 2924150210 2924144063 Bacteria 6883928
307 2924154352 2924150972 Bacteria 7169444
308 2924162255 2924158325 Bacteria 7188855
309 2924172424 2924165586 Bacteria 7260590
310 2924174756 2924172951 Bacteria 6749356
311 2924181953 2924179722 Bacteria 6843264
312 2924188037 2924186466 Bacteria 6876637
313 2924195680 2924193448 Bacteria 6955718
314 2924206116 2924200457 Bacteria 6757188
315 2924210601 2924207177 Bacteria 6917007
316 2924218576 2924214083 Bacteria 7080103
317 2924225107 2924221636 Bacteria 7113495
318 2924231136 2924228884 Bacteria 6633132
319 2928526076 2928521798 Bacteria 4960112
320 2937001626 2936996657 Bacteria 6298727
321 2937005487 2937002841 Bacteria 6934057
322 2937014199 2937009748 Bacteria 6746052
323 2937019124 2937016420 Bacteria 6782579
324 2937026208 2937023124 Bacteria 6815156
325 2937035117 2937029754 Bacteria 6424026
326 2937038224 2937036028 Bacteria 6846469
327 2937046966 2937042894 Bacteria 6741576
328 2937053530 2937049772 Bacteria 6757901
329 2937061827 2937056579 Bacteria 7107896
330 2937064948 2937063883 Bacteria 7199456
331 2937074999 2937071275 Bacteria 6984483
332 2937084226 2937078374 Bacteria 6610289
333 2937089598 2937084907 Bacteria 6618516
334 2937098326 2937091812 Bacteria 6979387
335 2937102862 2937098957 Bacteria 7249374
336 2937111408 2937106411 Bacteria 6947143
337 2937116537 2937113482 Bacteria 6505872
338 2937120630 2937119839 Bacteria 6597547
339 2937128888 2937126314 Bacteria 6771275
340 2941506768 2941499720 Bacteria 7599444
341 2954011831 2954011201 Bacteria 4762601
342 2957378522 2957375807 Bacteria 6425588
343 2957388169 2957382221 Bacteria 6737050
344 2957392703 2957388812 Bacteria 6778072
345 2957399059 2957395598 Bacteria 6822399
346 2957408220 2957402308 Bacteria 6741770
347 2957411398 2957408893 Bacteria 6558585
348 2957416052 2957415311 Bacteria 6991633
349 2957429331 2957422303 Bacteria 7172205
350 2957433198 2957430029 Bacteria 7022557
351 2957443803 2957437181 Bacteria 6568994
352 2957443997 2957443900 Bacteria 6869977
353 2957454800 2957450854 Bacteria 6765715
354 2957461294 2957457609 Bacteria 6967680
355 2957467627 2957464669 Bacteria 6568877
356 2957475812 2957471148 Bacteria 6797643
357 2957480573 2957478035 Bacteria 6756658
358 2957487142 2957484790 Bacteria 6703082
359 2957494849 2957491536 Bacteria 6695180
360 2957500462 2957498199 Bacteria 7126688
361 2957506448 2957505466 Bacteria 7253085
362 2960584981 2960584000 Bacteria 6864594
363 2960596588 2960591022 Bacteria 6622873
364 2960598354 2960597568 Bacteria 6550735
365 2960604538 2960603979 Bacteria 6898737
366 2960613567 2960610863 Bacteria 6691244
367 2960619683 2960617483 Bacteria 6727748
368 2960625005 2960624210 Bacteria 6875384
369 2960634485 2960631154 Bacteria 6732508
370 2960644051 2960637947 Bacteria 7296468
371 2960646425 2960645483 Bacteria 7211087
372 2960662683 2960660292 Bacteria 7041660
373 2960670823 2960667422 Bacteria 6763020
374 2960680429 2960674078 Bacteria 6609048
375 2960683150 2960680706 Bacteria 6624464
376 2960690697 2960687367 Bacteria 6535474
377 2960698614 2960693952 Bacteria 6749742
378 2964612116 2964607997 Bacteria 7101408
379 2964618025 2964615318 Bacteria 6809089
380 2964625154 2964621998 Bacteria 6834995
381 2964631850 2964628898 Bacteria 7083044
382 2964637245 2964636051 Bacteria 7091832
383 2964644468 2964643177 Bacteria 6820887
384 2964654107 2964649959 Bacteria 6675118
385 2964660336 2964656573 Bacteria 7100150
386 2964666635 2964663802 Bacteria 7019362
387 2964671436 2964670856 Bacteria 6851364
388 2964684427 2964678106 Bacteria 6792020
389 2964685690 2964685014 Bacteria 6839111
390 2964694882 2964691889 Bacteria 6802758
391 2964703328 2964698721 Bacteria 6765331
392 2964710345 2964705432 Bacteria 7114648
393 2964713225 2964712639 Bacteria 6695970
394 2964725071 2964719344 Bacteria 7286602
395 2967669543 2967664464 Bacteria 6948836
396 2967675483 2967671571 Bacteria 7021409
397 2967687839 2967686174 Bacteria 6678622
398 2967696858 2967693043 Bacteria 6804451
399 2967706680 2967699805 Bacteria 6854538
400 2967709397 2967706974 Bacteria 7186053
401 2967717057 2967714385 Bacteria 7000047
402 2967728907 2967728569 Bacteria 6641507
403 2967737805 2967735183 Bacteria 6827012
404 2967745355 2967742019 Bacteria 6794534
405 2967755134 2967748971 Bacteria 6733771
406 2967759079 2967755722 Bacteria 6814706
407 2967765005 2967762386 Bacteria 6923502
408 2967774928 2967769361 Bacteria 6587838
409 2967780585 2967775926 Bacteria 6738189
410 2970020320 2970019648 Bacteria 7072033
411 2970032230 2970026789 Bacteria 6785236
412 2970034182 2970033650 Bacteria 7118744
413 2970044437 2970040964 Bacteria 6731123
414 2970053837 2970047711 Bacteria 7088379
415 2970055346 2970054988 Bacteria 6611507
416 2970064241 2970061556 Bacteria 7099761
417 2970069368 2970068827 Bacteria 7123112
418 2970078325 2970076120 Bacteria 6697332
419 2970083883 2970082768 Bacteria 6183754
420 2970090253 2970088815 Bacteria 6933825
421 2970098327 2970095765 Bacteria 6936963
422 2970105574 2970102677 Bacteria 6812532
423 2970109717 2970109326 Bacteria 6863976
424 2970120039 2970116247 Bacteria 6501857
425 2970125062 2970122695 Bacteria 6625855
426 2970132996 2970129317 Bacteria 6806560
427 2970137265 2970136068 Bacteria 7207982
428 2970143847 2970143518 Bacteria 6446480
429 2970156151 2970149975 Bacteria 6779706
430 2970160523 2970156795 Bacteria 7168044
431 2970170308 2970164137 Bacteria 6861252
432 2970177820 2970170962 Bacteria 6876229
433 2970179580 2970177841 Bacteria 6768001
434 2970195608 2970191845 Bacteria 7032787
435 2977517272 2977516862 Bacteria 6940108
436 2977523943 2977523885 Bacteria 6960446
437 2977524150 2977523885 Bacteria 6960446
438 2977532758 2977530762 Bacteria 6951399
439 2977540168 2977537788 Bacteria 6929320
440 2977547872 2977544691 Bacteria 6875412
441 2977555550 2977551784 Bacteria 7125765
442 2977565440 2977558990 Bacteria 6863948
443 2977569451 2977565890 Bacteria 6901543
444 2977573028 2977572785 Bacteria 6763888
445 2977583295 2977579622 Bacteria 6772100
446 2996888521 2996887358 Bacteria 5795980
447 643823627 643692032 Bacteria 6891900
448 648740279 648276728 Bacteria 6968865
449 8002871814 8002869464 Bacteria 3588529
450 8003996172 8003992118 Bacteria 7266902
451 8004003930 8003999396 Bacteria 7063185
452 8005264538 8005258706 Bacteria 6184835
453 8005323048 8005321885 Bacteria 5795980
454 Ga0307516_10002137
455 JGI25152J39213_1000633
456 JGI25150J39212_1005348
457 JGI25159J45721_1004959
458 JGI25153J46596_10000365
459 JGI25153J46596_10005488
460 Ga0055535_1000125
461 Ga0055535_1000978
462 Ga0055529_1000610
463 Ga0055526_1016808
464 Ga0055536_1001232
465 Ga0055540_1004313
466 Ga0055531_10003994
467 Ga0065165_1004158
468 Ga0070662_100029400
469 Ga0070665_100001940
470 Ga0070665_100010064
471 Ga0068852_100338998
472 Ga0068862_100028477
473 Ga0075366_10009137
474 Ga0075366_10083483
475 Ga0075370_10008127
476 Ga0105242_10051367
477 Ga0105237_10000793
478 Ga0123340_1057264
479 Ga0123341_1083617
480 Ga0123341_1083618
481 Ga0123342_1005378
482 Ga0105239_10002685
483 Ga0105239_10382422
484 Ga0182008_10001236
485 Ga0157379_10035906
486 Ga0163161_10107761
487 Ga0213872_10003368
488 Ga0228711_1000045
489 Ga0228710_1000036
490 Ga0207427_100518
491 Ga0209258_100071
492 Ga0207425_1000686
493 Ga0209759_1002194
494 Ga0209129_1000035
495 Ga0209129_1016927
496 Ga0209455_1000030
497 Ga0209673_1029884
498 Ga0209676_1002041
499 Ga0209025_1000062
500 Ga0209025_1011931
501 Ga0209564_1000024
502 Ga0209758_1000066
503 Ga0209758_1000213
504 Ga0209758_1001509
505 Ga0209758_1019086
506 Ga0209050_1000178
507 Ga0209050_1001316
508 Ga0209050_1004617
509 Ga0209256_1000024
510 Ga0209051_1002362
511 Ga0209051_1012610
512 Ga0209257_1003554
513 Ga0207671_10000398
514 Ga0207698_10218538
515 Ga0209281_1000178
516 Ga0209281_1001139
517 Ga0209282_1000023
518 Ga0209974_10005968
519 Ga0268266_10000254
520 Ga0268266_10105489
521 Ga0265336_10000061
522 Ga0307515_10000041
523 Ga0307515_10000109
524 Ga0307515_10000130
525 Ga0307515_10000184
526 Ga0307515_10004774
527 Ga0307515_10015462
528 Ga0307515_10027861
529 Ga0307515_10034836
530 Ga0307515_10036350
531 Ga0307515_10040058
532 Ga0307515_10132860
533 Ga0265324_10009133
534 Ga0307512_10010755
535 Ga0307513_10012239
536 Ga0307513_10018043
537 Ga0307513_10068528
538 Ga0307513_10108464
539 Ga0307509_10003968
540 Ga0307509_10053237
541 Ga0307508_10000237
542 Ga0307508_10026066
543 Ga0307514_10002227
544 Ga0307514_10002692
545 Ga0307514_10087458
546 Ga0307514_10199879
547 Ga0307516_10000054
548 Ga0307516_10023063
549 Ga0307516_10043683
550 Ga0307410_10121661
551 Ga0315914_1000016
552 Ga0315913_1000027
553 Ga0315915_1000007
554 Ga0316582_0197080
555 Ga0373925_0076781
556 Ga0395905_0000663
557 Ga0395905_0001510
558 Ga0436361_0786816
559 Ga0436361_1074237
560 Ga0439436_0042386
561 Ga0450918_000309
562 Ga0466969_0000005
563 Ga0466969_0000748
564 Ga0466965_0059997
565 Ga0466966_0001778
566 Ga0466966_0065510
567 Ga0466961_0016191
568 Ga0466970_0009300
569 Ga0466970_0056553
570 Ga0466959_0015415
571 Ga0495617_034782
572 Ga0495590_0075252
573 Ga0495638_0000141
574 Ga0495639_0004866
575 Ga0495639_0006549
576 Ga0495585_0014469
577 Ga0495607_0010684
578 Ga0495583_0000068
579 Ga0495583_0000957
580 Ga0495583_0009020
581 Ga0495606_0010595
582 Ga0495606_0097365
583 Ga0495610_0010931
584 Ga0495610_0022181
585 Ga0495620_0000282
586 Ga0495620_0036492
587 Ga0495631_0000449
588 Ga0495631_0008404
589 Ga0495631_0026390
590 Ga0495632_0003847
591 Ga0495632_0074176
592 Ga0495643_0002918
593 Ga0495643_0046845
594 Ga0495666_0078485
595 Ga0495625_0001972
596 Ga0495625_0023033
597 Ga0495625_0112141
598 Ga0495625_0122476
599 Ga0495649_0016424
600 Ga0495660_0039079
601 Ga0495672_0000222
602 Ga0495687_002890
603 Ga0495686_0020844
604 Ga0495686_0054983
605 Ga0495626_0052813
606 Ga0496114_0020822
607 Ga0496121_0106436
608 Ga0496121_0190320
609 Ga0496122_0002488
610 Ga0496123_0002044
611 Ga0496125_0002193
612 Ga0501068_0156194
613 Ga0501075_0035845
614 Ga0501076_0140569
615 Ga0501227_002817
616 Ga0501080_0244627
617 nmdc:mga0k408_46595_c1
618 nmdc:mga07m45_1510_c1
619 nmdc:mga07m45_31318_c1
620 Ga0500635_0000032
621 Ga0500578_0000182
622 Ga0500644_0024128
623 Ga0500646_0004536
624 Ga0500651_0018037
625 Ga0500569_000732
626 Ga0500594_0005417
627 Ga0500618_003507
628 Ga0500642_0000269
629 Ga0500642_0004075
630 Ga0500652_001572
631 Ga0500568_0000269
632 Ga0500568_0002049
633 Ga0500568_0014414
634 Ga0500577_0017473
635 Ga0500588_0019706
636 Ga0500616_0000502
637 Ga0500616_0000771
638 Ga0500616_0002046
639 Ga0500622_0000600
640 Ga0500622_0001796
641 Ga0500609_003332
642 Ga0466962_0032227
643 2509111122
644 2510302618
645 2511174556
646 2511181342
647 2511392167
648 2511497650
649 2512530086
650 2512530400
651 2512969674
652 2513581753
653 2513603171
654 2513618352
655 2513869805
656 2513883779
657 2513902116
658 2513911692
659 2513985242
660 2514004459
661 2515612753
662 2516205078
663 2516207980
664 2516896685
665 2517565448
666 2523468491
667 2523470204
668 2524452189
669 2551677152
670 2551683001
671 2551695415
672 2551702689
673 2551712970
674 2551721264
675 2551722782
676 2551725470
677 2551732290
678 2551745252
679 2585229474
680 2585268250
681 2585391146
682 2585399531
683 2585404422
684 2585542879
685 2585824740
686 2585841179
687 2585993763
688 2586004692
689 2587729117
690 2587733691
691 2587735623
692 2587757107
693 2588292598
694 2600376064
695 2643967177
696 2644140008
697 2644169662
698 2644193747
699 2644246415
700 2644271248
701 2644350298
702 2671692282
703 2692318003
704 2692318998
705 2739348293
706 2753463639
707 2770197633
708 2792621679
709 2792627636
710 2792642961
711 2802716100
712 2802722862
713 2802728993
714 2802735387
715 2802742037
716 2802748487
717 2804754310
718 2819683431
719 2838075755
720 2842875143
721 2847422501
722 2847423494
723 2848998090
724 2854899727
725 2854921048
726 2855828481
727 2855843595
728 2855875838
729 2858807143
730 2896388207
731 2915983797
732 2915992160
733 2915996581
734 2916007407
735 2916009920
736 2916015322
737 2916025525
738 2916031229
739 2916037828
740 2916043598
741 2916051745
742 2916057865
743 2916068402
744 2916070006
745 2916076860
746 2919174060
747 2920764318
748 2921208043
749 2921209106
750 2921241235
751 2921247311
752 2921257005
753 2921259793
754 2921266636
755 2921285092
756 2921290644
757 2921298569
758 2923559866
759 2924150210
760 2924154352
761 2924162255
762 2924172424
763 2924174756
764 2924181953
765 2924188037
766 2924195680
767 2924206116
768 2924210601
769 2924218576
770 2924225107
771 2924231136
772 2928526076
773 2937001626
774 2937005487
775 2937014199
776 2937019124
777 2937026208
778 2937035117
779 2937038224
780 2937046966
781 2937053530
782 2937061827
783 2937064948
784 2937074999
785 2937084226
786 2937089598
787 2937098326
788 2937102862
789 2937111408
790 2937116537
791 2937120630
792 2937128888
793 2941506768
794 2954011831
795 2957378522
796 2957388169
797 2957392703
798 2957399059
799 2957408220
800 2957411398
801 2957416052
802 2957429331
803 2957433198
804 2957443803
805 2957443997
806 2957454800
807 2957461294
808 2957467627
809 2957475812
810 2957480573
811 2957487142
812 2957494849
813 2957500462
814 2957506448
815 2960584981
816 2960596588
817 2960598354
818 2960604538
819 2960613567
820 2960619683
821 2960625005
822 2960634485
823 2960644051
824 2960646425
825 2960662683
826 2960670823
827 2960680429
828 2960683150
829 2960690697
830 2960698614
831 2964612116
832 2964618025
833 2964625154
834 2964631850
835 2964637245
836 2964644468
837 2964654107
838 2964660336
839 2964666635
840 2964671436
841 2964684427
842 2964685690
843 2964694882
844 2964703328
845 2964710345
846 2964713225
847 2964725071
848 2967669543
849 2967675483
850 2967687839
851 2967696858
852 2967706680
853 2967709397
854 2967717057
855 2967728907
856 2967737805
857 2967745355
858 2967755134
859 2967759079
860 2967765005
861 2967774928
862 2967780585
863 2970020320
864 2970032230
865 2970034182
866 2970044437
867 2970053837
868 2970055346
869 2970064241
870 2970069368
871 2970078325
872 2970083883
873 2970090253
874 2970098327
875 2970105574
876 2970109717
877 2970120039
878 2970125062
879 2970132996
880 2970137265
881 2970143847
882 2970156151
883 2970160523
884 2970170308
885 2970177820
886 2970179580
887 2970195608
888 2977517272
889 2977523943
890 2977524150
891 2977532758
892 2977540168
893 2977547872
894 2977555550
895 2977565440
896 2977569451
897 2977573028
898 2977583295
899 2996888521
900 643823627
901 648740279
902 8002871814
903 8003996172
904 8004003930
905 8005264538
906 8005323048

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

20

163

0.97

PF17912

OB_MalK

MalK OB fold domain

244

298

0.94

PF08402

TOBE_2

TOBE domain

291

364

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.9108 4 349
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.909 2 350
2awn-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with atp-mg) 0.8888 2 350
2awo-assembly2.cif.gz_D crystal structure of the adp-mg-bound e. coli malk (crystallized with adp-mg) 0.8758 4 349
2r0g-assembly1.cif.gz_A chromopyrrolic acid-soaked rebc with bound 7-carboxy-k252c 0.8722 286 315
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9833 4 204 3.40.50.300
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9628 4 204 3.40.50.300
4xtcT03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.9212 284 331 2.40.50.140
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9129 4 74 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9071 2 68 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7R9M168-F1-model_v4 ABC transporter domain-containing protein 0.8462 2 209 GO:0005524
GO:0016020
GO:0016887
GO:0140359
AF-A0A6P5D628-F1-model_v4 Multidrug resistance-associated protein 9-like 0.7572 2 213 GO:0005524
GO:0016020
GO:0016887
GO:0042626
AF-U1N8M6-F1-model_v4 Thiol reductant ABC exporter subunit CydD 0.7468 2 194 GO:0005524
GO:0005886
GO:0016887
GO:0140359
AF-A0A4R9AIB0-F1-model_v4 ABC transporter ATP-binding protein 0.7315 4 209 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A6J4TYY2-F1-model_v4 Branched-chain amino acid transport ATP-binding protein LivG 0.7306 2 213 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806

Map