F447240

General Info

Members Datasets Scaffolds Average Seq Length
453 346 906 357

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0000103|Ga0466972_0000103_50596_51681
Length 361
Sequence MSADKISRRGFAGGIAALALARRAGAQGYAGLGETAEGFAKVTPGKTFVFPGDHGPHPDFRIEWWYLTANLLDPNGAACGLQWTLFRQAARPGPQEEGWANQQLWMGHAAVTRADTHRFNELFSRGGVGQAGVTAKPFAAWIDNWELKATEHTDDRSLAPLTLKASATDFSYALTLEADHPVVLQGDRGYSRKSERGQASYYYSQPFYRARGTLTIDDKSSVDVSGQAWMDREWSSQPLDADQTGWDWLSLHLSSGDKLMLYRLRQKDGQDYPFGNWISAGGDRQMIPGNDIRMTPGPTVDVQGHMLPVEWEIAISSRSLAIRCKPLNPRAWMGTGFSYWEGPISFAGTHEGVGYLELTGY

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
38 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
48 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
62 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
63 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
64 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
65 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
71 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
103 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
104 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
105 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
109 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
110 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
111 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
112 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
113 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
114 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
126 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
127 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
130 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
131 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
132 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
135 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
136 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
139 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
140 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
141 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
142 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
143 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
148 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
149 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
150 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
151 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
152 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
159 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
160 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
161 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
165 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
171 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
186 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
187 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
188 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
189 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
190 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
191 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
201 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
202 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
203 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
204 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
205 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
206 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
207 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
208 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
209 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
210 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
211 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
212 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
213 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
214 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
215 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
216 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
217 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
218 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
219 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
220 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
221 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
222 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
223 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
224 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
225 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
226 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
227 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
228 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
229 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
230 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
231 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
232 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
233 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
234 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
235 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
236 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
237 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
238 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
239 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
240 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
241 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
242 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
243 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
244 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
245 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
246 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
247 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
248 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
249 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
250 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
251 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
252 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
253 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
254 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
255 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
256 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
257 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
258 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
259 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
260 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
261 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
262 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
263 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
264 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
265 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
266 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
267 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
268 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
269 2922368715
270 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
271 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
272 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
273 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
274 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
275 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
276 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
277 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
278 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
279 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
280 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
281 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
282 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
283 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
284 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
285 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
286 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
287 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
288 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
289 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
290 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
291 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
292 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
293 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
294 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
295 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
296 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
297 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
298 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
299 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
300 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
301 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
302 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
303 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
304 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
305 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
306 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
307 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
308 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
309 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
310 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
311 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
312 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
313 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
314 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
315 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
316 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
317 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
318 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
319 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
320 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
321 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
322 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
323 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
324 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
325 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
326 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
327 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
328 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
329 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
330 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
331 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
332 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
333 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
334 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
335 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
336 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
337 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
338 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
339 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
340 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
341 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
342 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
343 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
344 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
345 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
346 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 71.02
Metatranscriptomes 0
Isolates 28.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.35
Nodule 23.84
Rhizoplane 4.64
Rhizosphere 43.93
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0000103 3300044658 Bacteria 75095
2 JGI25153J46596_10001319 3300003215 Bacteria 14870
3 JGI25153J46596_10001767 3300003215 Bacteria 12822
4 JGI25153J46596_10015578 3300003215 Bacteria 3087
5 JGI25153J46596_10028931 3300003215 Bacteria 1911
6 JGI25153J46596_10048573 3300003215 Bacteria 1238
7 rootL2_10091344 3300003322 Bacteria 1836
8 Ga0055543_1005639 3300004625 Bacteria 3164
9 Ga0065165_1001210 3300005262 Bacteria 29773
10 Ga0065165_1002230 3300005262 Bacteria 17253
11 Ga0065165_1006520 3300005262 Bacteria 6089
12 Ga0070658_10038528 3300005327 Bacteria 3854
13 Ga0070658_10072816 3300005327 Bacteria 2817
14 Ga0070676_10060610 3300005328 Bacteria 2248
15 Ga0070676_10248677 3300005328 Bacteria 1185
16 Ga0068868_100057359 3300005338 Bacteria 3076
17 Ga0068868_100259197 3300005338 Bacteria 1466
18 Ga0070687_100077162 3300005343 Bacteria 1807
19 Ga0070668_100065238 3300005347 Bacteria 2824
20 Ga0070671_100316354 3300005355 Bacteria 1330
21 Ga0070674_100159473 3300005356 Bacteria 1710
22 Ga0070688_100161556 3300005365 Bacteria 1539
23 Ga0070667_100019101 3300005367 Bacteria 5684
24 Ga0070663_100037645 3300005455 Bacteria 3369
25 Ga0070678_100034636 3300005456 Bacteria 3518
26 Ga0070678_100057029 3300005456 Bacteria 2859
27 Ga0070662_100188927 3300005457 Bacteria 1628
28 Ga0070662_100194869 3300005457 Bacteria 1604
29 Ga0070662_100224596 3300005457 Bacteria 1500
30 Ga0068867_100087817 3300005459 Bacteria 2355
31 Ga0070699_100089151 3300005518 Bacteria 2695
32 Ga0070679_100004053 3300005530 Bacteria 13492
33 Ga0068853_100084598 3300005539 Bacteria 2779
34 Ga0068853_100290261 3300005539 Bacteria 1510
35 Ga0070665_100005869 3300005548 Bacteria 12586
36 Ga0070665_100013449 3300005548 Bacteria 8233
37 Ga0070665_100109442 3300005548 Bacteria 2765
38 Ga0070665_100127299 3300005548 Bacteria 2549
39 Ga0070665_100232047 3300005548 Bacteria 1845
40 Ga0068855_100013741 3300005563 Bacteria 9760
41 Ga0068857_100099726 3300005577 Bacteria 2605
42 Ga0068856_100196999 3300005614 Bacteria 2028
43 Ga0070702_100160322 3300005615 Bacteria 1453
44 Ga0068852_100003441 3300005616 Bacteria 11061
45 Ga0068852_100069477 3300005616 Bacteria 3087
46 Ga0068859_100058484 3300005617 Bacteria 3883
47 Ga0068864_100056339 3300005618 Bacteria 3396
48 Ga0068864_100178538 3300005618 Bacteria 1940
49 Ga0068861_100088295 3300005719 Bacteria 2441
50 Ga0068858_100090628 3300005842 Bacteria 2845
51 Ga0068858_100156899 3300005842 Bacteria 2141
52 Ga0068858_100217346 3300005842 Bacteria 1809
53 Ga0068860_100302329 3300005843 Bacteria 1567
54 Ga0068862_100013687 3300005844 Bacteria 6719
55 Ga0068862_100131569 3300005844 Bacteria 2213
56 Ga0081455_10115775 3300005937 Bacteria 2121
57 Ga0081538_10055845 3300005981 Bacteria 2320
58 Ga0081540_1006692 3300005983 Bacteria 8337
59 Ga0081540_1019272 3300005983 Bacteria 4154
60 Ga0081539_10000048 3300005985 Bacteria 272906
61 Ga0070717_10081102 3300006028 Bacteria 2724
62 Ga0075365_10023501 3300006038 Bacteria 3878
63 Ga0075365_10162465 3300006038 Bacteria 1557
64 Ga0075363_100011335 3300006048 Bacteria 4265
65 Ga0075363_100017911 3300006048 Bacteria 3521
66 Ga0075364_10034630 3300006051 Bacteria 3259
67 Ga0075364_10040192 3300006051 Bacteria 3033
68 Ga0070712_100063514 3300006175 Bacteria 2615
69 Ga0075367_10006585 3300006178 Bacteria 5882
70 Ga0075367_10013606 3300006178 Bacteria 4380
71 Ga0075370_10049015 3300006353 Bacteria 2394
72 Ga0075370_10063849 3300006353 Bacteria 2100
73 Ga0068865_100056278 3300006881 Bacteria 2739
74 Ga0097620_100058483 3300006931 Bacteria 3883
75 Ga0099824_1033879 3300006942 Bacteria 1688
76 Ga0099794_10022272 3300007265 Bacteria 2887
77 Ga0105240_10008466 3300009093 Bacteria 14712
78 Ga0105240_10011824 3300009093 Bacteria 12121
79 Ga0105245_10053438 3300009098 Bacteria 3626
80 Ga0105247_10195270 3300009101 Bacteria 1357
81 Ga0105243_10195536 3300009148 Bacteria 1770
82 Ga0105241_10080460 3300009174 Bacteria 2550
83 Ga0105248_10012317 3300009177 Bacteria 9433
84 Ga0105237_10003797 3300009545 Bacteria 17750
85 Ga0105237_10088932 3300009545 Bacteria 3078
86 Ga0105237_10136974 3300009545 Bacteria 2443
87 Ga0105237_10228490 3300009545 Bacteria 1861
88 Ga0105238_10108953 3300009551 Bacteria 2751
89 Ga0105238_10344248 3300009551 Bacteria 1479
90 Ga0105239_10621767 3300010375 Bacteria 1233
91 Ga0157370_10007832 3300013104 Bacteria 11577
92 Ga0157378_10057670 3300013297 Bacteria 3462
93 Ga0157375_10115076 3300013308 Bacteria 2792
94 Ga0214544_1000087 3300021320 Bacteria 119600
95 Ga0214542_1000018 3300021321 Bacteria 202226
96 Ga0214545_1000009 3300021324 Bacteria 202915
97 Ga0214543_1000037 3300021327 Bacteria 182113
98 Ga0209677_100335 3300025253 Bacteria 30124
99 Ga0209148_1000568 3300025254 Bacteria 34536
100 Ga0209233_1013386 3300025261 Bacteria 2344
101 Ga0209455_1018834 3300025272 Bacteria 1408
102 Ga0209564_1003394 3300025295 Bacteria 10967
103 Ga0209758_1000015 3300025297 Bacteria 851943
104 Ga0209758_1000224 3300025297 Bacteria 121530
105 Ga0209758_1000972 3300025297 Bacteria 38579
106 Ga0209758_1001077 3300025297 Bacteria 35497
107 Ga0209758_1012847 3300025297 Bacteria 4637
108 Ga0209758_1022921 3300025297 Bacteria 2842
109 Ga0209758_1060099 3300025297 Bacteria 1260
110 Ga0209758_1060131 3300025297 Bacteria 1260
111 Ga0209256_1004987 3300025299 Bacteria 7945
112 Ga0207426_1000617 3300025302 Bacteria 45527
113 Ga0207426_1035858 3300025302 Bacteria 1580
114 Ga0209257_1000440 3300025304 Bacteria 79182
115 Ga0207710_10032278 3300025900 Bacteria 2293
116 Ga0207647_10003185 3300025904 Bacteria 12307
117 Ga0207654_10033356 3300025911 Bacteria 2853
118 Ga0207695_10000065 3300025913 Bacteria 336949
119 Ga0207695_10059286 3300025913 Bacteria 3970
120 Ga0207671_10001858 3300025914 Bacteria 23570
121 Ga0207671_10047285 3300025914 Bacteria 3184
122 Ga0207671_10073977 3300025914 Bacteria 2546
123 Ga0207693_10050165 3300025915 Bacteria 3277
124 Ga0207660_10083528 3300025917 Bacteria 2352
125 Ga0207657_10164025 3300025919 Bacteria 1803
126 Ga0207652_10174011 3300025921 Bacteria 1932
127 Ga0207700_10101353 3300025928 Bacteria 2297
128 Ga0207690_10191150 3300025932 Bacteria 1548
129 Ga0207706_10122454 3300025933 Bacteria 2288
130 Ga0207709_10036299 3300025935 Bacteria 2920
131 Ga0207709_10215884 3300025935 Bacteria 1380
132 Ga0207711_10042019 3300025941 Bacteria 3894
133 Ga0207711_10142711 3300025941 Bacteria 2156
134 Ga0207679_10028842 3300025945 Bacteria 3858
135 Ga0207667_10172639 3300025949 Bacteria 2222
136 Ga0207712_10113237 3300025961 Bacteria 2039
137 Ga0207658_10172392 3300025986 Bacteria 1784
138 Ga0207677_10317434 3300026023 Bacteria 1293
139 Ga0207703_10017200 3300026035 Bacteria 5642
140 Ga0207639_10022142 3300026041 Bacteria 4575
141 Ga0207639_10075722 3300026041 Bacteria 2647
142 Ga0207678_10022496 3300026067 Bacteria 5521
143 Ga0207678_10038945 3300026067 Bacteria 4127
144 Ga0207678_10046574 3300026067 Bacteria 3750
145 Ga0207678_10055149 3300026067 Bacteria 3423
146 Ga0207648_10024967 3300026089 Bacteria 5328
147 Ga0207676_10198733 3300026095 Bacteria 1770
148 Ga0207676_10338545 3300026095 Bacteria 1387
149 Ga0207674_10116009 3300026116 Bacteria 2649
150 Ga0207675_100270001 3300026118 Bacteria 1650
151 Ga0207675_100302087 3300026118 Bacteria 1559
152 Ga0207683_10035265 3300026121 Bacteria 4350
153 Ga0207683_10035408 3300026121 Bacteria 4342
154 Ga0207683_10171489 3300026121 Bacteria 1965
155 Ga0207698_10251437 3300026142 Bacteria 1618
156 Ga0209389_1000029 3300027296 Bacteria 140337
157 Ga0209589_1000012 3300027357 Bacteria 229451
158 Ga0209589_1000013 3300027357 Bacteria 229273
159 Ga0209489_100013 3300027361 Bacteria 229831
160 Ga0209588_1034065 3300027671 Bacteria 1634
161 Ga0268266_10007480 3300028379 Bacteria 9845
162 Ga0268266_10051108 3300028379 Bacteria 3547
163 Ga0268266_10081454 3300028379 Bacteria 2822
164 Ga0268266_10116242 3300028379 Bacteria 2375
165 Ga0268266_10155418 3300028379 Bacteria 2065
166 Ga0268265_10098171 3300028380 Bacteria 2358
167 Ga0265340_10008455 3300031247 Bacteria 5558
168 Ga0265339_10004288 3300031249 Bacteria 9747
169 Ga0307513_10241272 3300031456 Bacteria 1612
170 Ga0307509_10063065 3300031507 Bacteria 3904
171 Ga0307416_100252269 3300032002 Bacteria 1718
172 Ga0307510_10020522 3300033180 Bacteria 7720
173 Ga0307510_10050284 3300033180 Bacteria 4424
174 Ga0307510_10155629 3300033180 Bacteria 1893
175 Ga0373946_0028289 3300035171 Bacteria 2223
176 Ga0373947_0001708 3300035725 Bacteria 13470
177 Ga0373925_0015901 3300037068 Bacteria 5445
178 Ga0395898_0016827 3300037466 Bacteria 7470
179 Ga0395905_0001674 3300037471 Bacteria 26140
180 Ga0451853_3662531 3300041512 Bacteria 1467
181 Ga0466969_0008067 3300044656 Bacteria 5593
182 Ga0466972_0079197 3300044658 Bacteria 1565
183 Ga0466966_0000378 3300044684 Bacteria 29054
184 Ga0466961_0000129 3300044693 Bacteria 50353
185 Ga0466960_0012700 3300044901 Bacteria 3560
186 Ga0466959_0002230 3300045049 Bacteria 12347
187 Ga0466967_0306304 3300045976 Bacteria 1529
188 Ga0495617_004269 3300046452 Bacteria 5219
189 Ga0495603_0019937 3300046455 Bacteria 4062
190 Ga0495603_0021193 3300046455 Bacteria 3935
191 Ga0495629_0082974 3300046459 Bacteria 2237
192 Ga0495629_0128603 3300046459 Bacteria 1764
193 Ga0495638_0014881 3300046460 Bacteria 5242
194 Ga0495638_0021307 3300046460 Bacteria 4273
195 Ga0495641_0067142 3300046461 Bacteria 1613
196 Ga0495651_0005758 3300046462 Bacteria 9452
197 Ga0495651_0013486 3300046462 Bacteria 6321
198 Ga0495605_0041649 3300046474 Bacteria 2287
199 Ga0495605_0073586 3300046474 Bacteria 1609
200 Ga0495639_0024021 3300046475 Bacteria 2681
201 Ga0495639_0066201 3300046475 Bacteria 1663
202 Ga0495664_0044957 3300046477 Bacteria 2618
203 Ga0495584_0189085 3300046491 Bacteria 1046
204 Ga0495585_0050461 3300046492 Bacteria 2308
205 Ga0495606_0000265 3300046507 Bacteria 92526
206 Ga0495608_0007229 3300046511 Bacteria 7854
207 Ga0495610_0052849 3300046512 Bacteria 1971
208 Ga0495610_0081053 3300046512 Bacteria 1491
209 Ga0495628_0037699 3300046516 Bacteria 3875
210 Ga0495643_0007059 3300046522 Bacteria 7293
211 Ga0495648_0005171 3300046524 Bacteria 10917
212 Ga0495648_0019783 3300046524 Bacteria 4717
213 Ga0495652_0044058 3300046529 Bacteria 3843
214 Ga0495652_0089017 3300046529 Bacteria 2528
215 Ga0495640_0055780 3300046533 Bacteria 2702
216 Ga0495587_0007955 3300046536 Bacteria 6850
217 Ga0495645_0004845 3300046543 Bacteria 9197
218 Ga0495622_0036050 3300046557 Bacteria 2307
219 Ga0495656_0038926 3300046615 Bacteria 1972
220 Ga0495668_0012203 3300046616 Bacteria 5106
221 Ga0495634_0028263 3300046642 Bacteria 3894
222 Ga0495611_0050220 3300046648 Bacteria 1878
223 Ga0495625_0047433 3300046660 Bacteria 3097
224 Ga0495635_0005971 3300046663 Bacteria 8496
225 Ga0495657_0005754 3300046675 Bacteria 9763
226 Ga0495657_0090619 3300046675 Bacteria 1962
227 Ga0495599_0042136 3300046678 Bacteria 2865
228 Ga0495623_0063602 3300046679 Bacteria 2310
229 Ga0495669_0002792 3300046684 Bacteria 7157
230 Ga0495669_0063273 3300046684 Bacteria 1678
231 Ga0495613_0185640 3300046689 Bacteria 1471
232 Ga0495624_0009621 3300046690 Bacteria 6691
233 Ga0495671_0078894 3300046692 Bacteria 1614
234 Ga0495671_0121168 3300046692 Bacteria 1276
235 Ga0495649_0016239 3300046694 Bacteria 4222
236 Ga0495589_0079164 3300046794 Bacteria 1599
237 Ga0495589_0088477 3300046794 Bacteria 1504
238 Ga0495600_0029494 3300046809 Bacteria 3552
239 Ga0495581_0042491 3300047315 Bacteria 2631
240 Ga0495581_0042564 3300047315 Bacteria 2628
241 Ga0495604_0002997 3300047317 Bacteria 13512
242 Ga0495674_0033487 3300047319 Bacteria 4653
243 Ga0495676_0040304 3300047321 Bacteria 3856
244 Ga0495683_0038119 3300047323 Bacteria 2434
245 Ga0495675_0005212 3300047444 Bacteria 7913
246 Ga0495681_0112136 3300047470 Bacteria 1180
247 Ga0495686_0059024 3300047472 Bacteria 2390
248 Ga0495593_0035073 3300047673 Bacteria 2725
249 Ga0496100_0030288 3300048903 Bacteria 3356
250 Ga0496100_0093116 3300048903 Bacteria 2061
251 Ga0496101_0070673 3300048904 Bacteria 2557
252 Ga0496102_0048625 3300048905 Bacteria 3856
253 Ga0496103_0081713 3300048906 Bacteria 2033
254 Ga0496103_0112045 3300048906 Bacteria 1734
255 Ga0496103_0170664 3300048906 Bacteria 1397
256 Ga0496104_0006609 3300048907 Bacteria 10198
257 Ga0496104_0123056 3300048907 Bacteria 2490
258 Ga0496105_0018629 3300048908 Bacteria 5587
259 Ga0496106_0075534 3300048909 Bacteria 2581
260 Ga0496106_0147332 3300048909 Bacteria 1855
261 Ga0496108_0183514 3300048911 Bacteria 1812
262 Ga0496110_0060899 3300048913 Bacteria 3330
263 Ga0496110_0131081 3300048913 Bacteria 2264
264 Ga0496112_0059783 3300048915 Bacteria 3755
265 Ga0496112_0085054 3300048915 Bacteria 3129
266 Ga0496112_0100426 3300048915 Bacteria 2863
267 Ga0496112_0153128 3300048915 Bacteria 2273
268 Ga0496113_0064264 3300048916 Bacteria 2774
269 Ga0496115_0031410 3300048918 Bacteria 4186
270 Ga0496116_0018888 3300048919 Bacteria 5294
271 Ga0496117_0116389 3300048920 Bacteria 1652
272 Ga0496118_0016791 3300048921 Bacteria 6693
273 Ga0496118_0021316 3300048921 Bacteria 5709
274 Ga0496120_0034401 3300048923 Bacteria 3035
275 Ga0496120_0056340 3300048923 Bacteria 2219
276 Ga0496121_0000091 3300048924 Bacteria 216685
277 Ga0496121_0019174 3300048924 Bacteria 6854
278 Ga0496121_0065683 3300048924 Bacteria 2950
279 Ga0496121_0144540 3300048924 Bacteria 1759
280 Ga0496121_0219743 3300048924 Bacteria 1339
281 Ga0496124_0080549 3300048927 Bacteria 2679
282 Ga0496124_0115575 3300048927 Bacteria 2153
283 Ga0496124_0125620 3300048927 Bacteria 2044
284 Ga0496124_0210665 3300048927 Bacteria 1471
285 Ga0496125_0045717 3300048928 Bacteria 3680
286 Ga0496125_0183387 3300048928 Bacteria 1391
287 Ga0496126_0004591 3300048929 Bacteria 16376
288 Ga0496126_0006097 3300048929 Bacteria 13518
289 Ga0496126_0007610 3300048929 Bacteria 11831
290 Ga0496126_0256610 3300048929 Bacteria 1455
291 Ga0495682_0002432 3300049460 Bacteria 8812
292 Ga0501067_0130763 3300049583 Bacteria 1397
293 nmdc:mga03n38_19457_c1 3300050490 Bacteria 2699
294 nmdc:mga00v17_80653_c1 3300050491 Bacteria 2031
295 nmdc:mga0yw44_111088_c1 3300050492 Bacteria 1756
296 nmdc:mga0yw44_29470_c1 3300050492 Bacteria 3169
297 nmdc:mga0yw44_7769_c2 3300050492 Bacteria 3579
298 nmdc:mga06z11_59018_c1 3300050494 Bacteria 1993
299 nmdc:mga07m45_17820_c1 3300050496 Bacteria 2700
300 nmdc:mga07m45_26977_c1 3300050496 Bacteria 3160
301 nmdc:mga0sz30_10180_c1 3300050516 Bacteria 1174
302 Ga0500583_0083482 3300053092 Bacteria 1546
303 Ga0500566_0007379 3300053094 Bacteria 6512
304 Ga0500557_000212 3300053105 Bacteria 9403
305 Ga0500595_005914 3300053119 Bacteria 5266
306 Ga0500595_009501 3300053119 Bacteria 3921
307 Ga0500595_011821 3300053119 Bacteria 3399
308 Ga0500595_041726 3300053119 Bacteria 1473
309 Ga0500595_042729 3300053119 Bacteria 1448
310 Ga0500642_0000193 3300053130 Bacteria 24969
311 Ga0500559_0012617 3300053136 Bacteria 3588
312 Ga0500568_0017163 3300053139 Bacteria 3202
313 Ga0500568_0045220 3300053139 Bacteria 1753
314 Ga0500589_062494 3300053147 Bacteria 1703
315 Ga0500619_072101 3300053154 Bacteria 1150
316 Ga0500627_0036437 3300053158 Bacteria 2095
317 Ga0500636_0000075 3300053177 Bacteria 48415
318 Ga0500625_013822 3300053729 Bacteria 3718
319 Ga0500645_011392 3300053730 Bacteria 2905
320 Ga0500645_016161 3300053730 Bacteria 2355
321 Ga0500601_000231 3300053737 Bacteria 11058
322 2508546208 2508501009 Bacteria 7784016
323 2511397269 2511231028 Bacteria 8046582
324 2513628879 2513237092 Bacteria 8341956
325 2513639564 2513237094 Bacteria 8789602
326 2513703363 2513237102 Bacteria 7703324
327 2513873902 2513237139 Bacteria 8737671
328 2514012873 2513237161 Bacteria 8871253
329 2515625854 2515154112 Bacteria 8294334
330 2517102375 2517093001 Bacteria 9002274
331 2528851597 2528768022 Bacteria 10457665
332 2617351713 2617270735 Bacteria 9163226
333 2793063107 2791355196 Bacteria 7323613
334 2805915985 2802429603 Bacteria 8777136
335 2818237291 2816332527 Bacteria 8933356
336 2824602586 2824600985 Bacteria 8488197
337 2824612634 2824609381 Bacteria 8672835
338 2824621096 2824617872 Bacteria 8814715
339 2824630103 2824626560 Bacteria 8813858
340 2824637881 2824635225 Bacteria 8785348
341 2824650039 2824644064 Bacteria 8743947
342 2824664740 2824661429 Bacteria 9877870
343 2824674246 2824671348 Bacteria 8369588
344 2824683547 2824679649 Bacteria 8248951
345 2824690841 2824687955 Bacteria 8360029
346 2824697640 2824696289 Bacteria 8335049
347 2824709674 2824704595 Bacteria 9667483
348 2824719890 2824714736 Bacteria 8717648
349 2824730276 2824723954 Bacteria 8758240
350 2824757102 2824753945 Bacteria 9787441
351 2824768438 2824763712 Bacteria 9792355
352 2838124126 2838122688 Bacteria 8803140
353 2841951613 2841949485 Bacteria 8680857
354 2841964602 2841957949 Bacteria 8652217
355 2841969249 2841966195 Bacteria 8673214
356 2841985604 2841983080 Bacteria 8395090
357 2842043872 2842038055 Bacteria 8002051
358 2842052138 2842045827 Bacteria 8006841
359 2844321834 2844315083 Bacteria 8138177
360 2847941764 2847939898 Bacteria 8606328
361 2849082686 2849076700 Bacteria 7039503
362 2874617748 2874612657 Bacteria 8252029
363 2874636719 2874628541 Bacteria 8630250
364 2879107236 2879099564 Bacteria 10442239
365 2879111702 2879110137 Bacteria 8907982
366 2879127672 2879127579 Bacteria 8294491
367 2879146055 2879142872 Bacteria 8267021
368 2881370991 2881364244 Bacteria 7710352
369 2881665707 2881665667 Bacteria 8175609
370 2885371389 2885366525 Bacteria 8326213
371 2888379952 2888378607 Bacteria 9652610
372 2888391031 2888388044 Bacteria 7304136
373 2903727616 2903727486 Bacteria 8281579
374 2904716195 2904711408 Bacteria 9771557
375 2906602894 2906602504 Bacteria 8295279
376 2922378338
377 2922388632 2922386360 Bacteria 7017218
378 2922400787 2922393267 Bacteria 8285685
379 2932786357 2932784394 Bacteria 9704911
380 2932805513 2932801729 Bacteria 7987968
381 2932812568 2932809354 Bacteria 9135765
382 2932822930 2932818245 Bacteria 9955613
383 2932829595 2932828146 Bacteria 9745859
384 2935614948 2935608549 Bacteria 8203142
385 2935618113 2935616580 Bacteria 9032984
386 2935641489 2935638405 Bacteria 10015038
387 2935652975 2935648319 Bacteria 8801166
388 2935661558 2935656913 Bacteria 8965014
389 2935669453 2935665750 Bacteria 9571747
390 2935677949 2935675223 Bacteria 9928132
391 2935689600 2935684952 Bacteria 9590419
392 2935701813 2935694250 Bacteria 9291695
393 2935707278 2935703347 Bacteria 10242284
394 2935717119 2935713505 Bacteria 9608509
395 2935730047 2935722832 Bacteria 9608746
396 2935738534 2935732158 Bacteria 9706831
397 2935749218 2935741537 Bacteria 9707219
398 2935756953 2935750917 Bacteria 9590372
399 2935764433 2935760218 Bacteria 9817913
400 2935772760 2935769743 Bacteria 7878163
401 2935778103 2935777560 Bacteria 8077691
402 2935787331 2935785616 Bacteria 7962367
403 2935795881 2935793552 Bacteria 8012592
404 2935804343 2935801545 Bacteria 9301974
405 2935817201 2935810662 Bacteria 9401221
406 2935826013 2935819856 Bacteria 8261050
407 2935831220 2935827899 Bacteria 10038562
408 2935841829 2935837841 Bacteria 9454360
409 2935851632 2935847175 Bacteria 8228321
410 2935856388 2935855204 Bacteria 9035059
411 2935871089 2935864058 Bacteria 9784707
412 2935874586 2935873716 Bacteria 9632195
413 2935888890 2935883170 Bacteria 7964738
414 2935977896 2935975950 Bacteria 8347125
415 2935994047 2935992306 Bacteria 9802711
416 2936004942 2936002035 Bacteria 9362176
417 2936015713 2936011229 Bacteria 8801034
418 2936024347 2936019824 Bacteria 8804134
419 2936031766 2936028420 Bacteria 8965941
420 2936043997 2936037263 Bacteria 9446081
421 2936051588 2936046547 Bacteria 8903709
422 2940562867 2940556831 Bacteria 9590747
423 2941532365 2941531003 Bacteria 7653939
424 2941543902 2941538514 Bacteria 9402094
425 3005486408 3005483717 Bacteria 7877331
426 3005509535 3005506211 Bacteria 6943378
427 3005589031 3005587118 Bacteria 7794411
428 3005602182 3005594810 Bacteria 8716512
429 3005724972 3005718088 Bacteria 8283608
430 8006931369 8006926726 Bacteria 6749210
431 8006968292 8006964411 Bacteria 8966052
432 8016518615 8016511872 Bacteria 9921665
433 8016526585 8016522445 Bacteria 8156687
434 8016544869 8016539877 Bacteria 8155419
435 8016565561 8016557553 Bacteria 8154380
436 8016582518 8016575299 Bacteria 8154085
437 8016586800 8016583857 Bacteria 10421953
438 8016603177 8016595262 Bacteria 8149947
439 8016606098 8016603502 Bacteria 8731218
440 8016617980 8016613128 Bacteria 8794220
441 8017058055 8017057580 Bacteria 10023680
442 8019531492 8019530166 Bacteria 8155624
443 8019540039 8019538911 Bacteria 7872763
444 8019550614 8019547302 Bacteria 7996444
445 8019605983 8019597564 Bacteria 10041141
446 8019612550 8019608314 Bacteria 10042931
447 8019622567 8019619141 Bacteria 9218857
448 8019630544 8019629233 Bacteria 8687553
449 8019640069 8019638758 Bacteria 9062356
450 8019667370 8019659431 Bacteria 8577854
451 8019677146 8019668869 Bacteria 8791617
452 8019678840 8019678201 Bacteria 8863603
453 8056676204 8056673599 Bacteria 7871253
454 Ga0466972_0000103
455 JGI25153J46596_10001319
456 JGI25153J46596_10001767
457 JGI25153J46596_10015578
458 JGI25153J46596_10028931
459 JGI25153J46596_10048573
460 rootL2_10091344
461 Ga0055543_1005639
462 Ga0065165_1001210
463 Ga0065165_1002230
464 Ga0065165_1006520
465 Ga0070658_10038528
466 Ga0070658_10072816
467 Ga0070676_10060610
468 Ga0070676_10248677
469 Ga0068868_100057359
470 Ga0068868_100259197
471 Ga0070687_100077162
472 Ga0070668_100065238
473 Ga0070671_100316354
474 Ga0070674_100159473
475 Ga0070688_100161556
476 Ga0070667_100019101
477 Ga0070663_100037645
478 Ga0070678_100034636
479 Ga0070678_100057029
480 Ga0070662_100188927
481 Ga0070662_100194869
482 Ga0070662_100224596
483 Ga0068867_100087817
484 Ga0070699_100089151
485 Ga0070679_100004053
486 Ga0068853_100084598
487 Ga0068853_100290261
488 Ga0070665_100005869
489 Ga0070665_100013449
490 Ga0070665_100109442
491 Ga0070665_100127299
492 Ga0070665_100232047
493 Ga0068855_100013741
494 Ga0068857_100099726
495 Ga0068856_100196999
496 Ga0070702_100160322
497 Ga0068852_100003441
498 Ga0068852_100069477
499 Ga0068859_100058484
500 Ga0068864_100056339
501 Ga0068864_100178538
502 Ga0068861_100088295
503 Ga0068858_100090628
504 Ga0068858_100156899
505 Ga0068858_100217346
506 Ga0068860_100302329
507 Ga0068862_100013687
508 Ga0068862_100131569
509 Ga0081455_10115775
510 Ga0081538_10055845
511 Ga0081540_1006692
512 Ga0081540_1019272
513 Ga0081539_10000048
514 Ga0070717_10081102
515 Ga0075365_10023501
516 Ga0075365_10162465
517 Ga0075363_100011335
518 Ga0075363_100017911
519 Ga0075364_10034630
520 Ga0075364_10040192
521 Ga0070712_100063514
522 Ga0075367_10006585
523 Ga0075367_10013606
524 Ga0075370_10049015
525 Ga0075370_10063849
526 Ga0068865_100056278
527 Ga0097620_100058483
528 Ga0099824_1033879
529 Ga0099794_10022272
530 Ga0105240_10008466
531 Ga0105240_10011824
532 Ga0105245_10053438
533 Ga0105247_10195270
534 Ga0105243_10195536
535 Ga0105241_10080460
536 Ga0105248_10012317
537 Ga0105237_10003797
538 Ga0105237_10088932
539 Ga0105237_10136974
540 Ga0105237_10228490
541 Ga0105238_10108953
542 Ga0105238_10344248
543 Ga0105239_10621767
544 Ga0157370_10007832
545 Ga0157378_10057670
546 Ga0157375_10115076
547 Ga0214544_1000087
548 Ga0214542_1000018
549 Ga0214545_1000009
550 Ga0214543_1000037
551 Ga0209677_100335
552 Ga0209148_1000568
553 Ga0209233_1013386
554 Ga0209455_1018834
555 Ga0209564_1003394
556 Ga0209758_1000015
557 Ga0209758_1000224
558 Ga0209758_1000972
559 Ga0209758_1001077
560 Ga0209758_1012847
561 Ga0209758_1022921
562 Ga0209758_1060099
563 Ga0209758_1060131
564 Ga0209256_1004987
565 Ga0207426_1000617
566 Ga0207426_1035858
567 Ga0209257_1000440
568 Ga0207710_10032278
569 Ga0207647_10003185
570 Ga0207654_10033356
571 Ga0207695_10000065
572 Ga0207695_10059286
573 Ga0207671_10001858
574 Ga0207671_10047285
575 Ga0207671_10073977
576 Ga0207693_10050165
577 Ga0207660_10083528
578 Ga0207657_10164025
579 Ga0207652_10174011
580 Ga0207700_10101353
581 Ga0207690_10191150
582 Ga0207706_10122454
583 Ga0207709_10036299
584 Ga0207709_10215884
585 Ga0207711_10042019
586 Ga0207711_10142711
587 Ga0207679_10028842
588 Ga0207667_10172639
589 Ga0207712_10113237
590 Ga0207658_10172392
591 Ga0207677_10317434
592 Ga0207703_10017200
593 Ga0207639_10022142
594 Ga0207639_10075722
595 Ga0207678_10022496
596 Ga0207678_10038945
597 Ga0207678_10046574
598 Ga0207678_10055149
599 Ga0207648_10024967
600 Ga0207676_10198733
601 Ga0207676_10338545
602 Ga0207674_10116009
603 Ga0207675_100270001
604 Ga0207675_100302087
605 Ga0207683_10035265
606 Ga0207683_10035408
607 Ga0207683_10171489
608 Ga0207698_10251437
609 Ga0209389_1000029
610 Ga0209589_1000012
611 Ga0209589_1000013
612 Ga0209489_100013
613 Ga0209588_1034065
614 Ga0268266_10007480
615 Ga0268266_10051108
616 Ga0268266_10081454
617 Ga0268266_10116242
618 Ga0268266_10155418
619 Ga0268265_10098171
620 Ga0265340_10008455
621 Ga0265339_10004288
622 Ga0307513_10241272
623 Ga0307509_10063065
624 Ga0307416_100252269
625 Ga0307510_10020522
626 Ga0307510_10050284
627 Ga0307510_10155629
628 Ga0373946_0028289
629 Ga0373947_0001708
630 Ga0373925_0015901
631 Ga0395898_0016827
632 Ga0395905_0001674
633 Ga0451853_3662531
634 Ga0466969_0008067
635 Ga0466972_0079197
636 Ga0466966_0000378
637 Ga0466961_0000129
638 Ga0466960_0012700
639 Ga0466959_0002230
640 Ga0466967_0306304
641 Ga0495617_004269
642 Ga0495603_0019937
643 Ga0495603_0021193
644 Ga0495629_0082974
645 Ga0495629_0128603
646 Ga0495638_0014881
647 Ga0495638_0021307
648 Ga0495641_0067142
649 Ga0495651_0005758
650 Ga0495651_0013486
651 Ga0495605_0041649
652 Ga0495605_0073586
653 Ga0495639_0024021
654 Ga0495639_0066201
655 Ga0495664_0044957
656 Ga0495584_0189085
657 Ga0495585_0050461
658 Ga0495606_0000265
659 Ga0495608_0007229
660 Ga0495610_0052849
661 Ga0495610_0081053
662 Ga0495628_0037699
663 Ga0495643_0007059
664 Ga0495648_0005171
665 Ga0495648_0019783
666 Ga0495652_0044058
667 Ga0495652_0089017
668 Ga0495640_0055780
669 Ga0495587_0007955
670 Ga0495645_0004845
671 Ga0495622_0036050
672 Ga0495656_0038926
673 Ga0495668_0012203
674 Ga0495634_0028263
675 Ga0495611_0050220
676 Ga0495625_0047433
677 Ga0495635_0005971
678 Ga0495657_0005754
679 Ga0495657_0090619
680 Ga0495599_0042136
681 Ga0495623_0063602
682 Ga0495669_0002792
683 Ga0495669_0063273
684 Ga0495613_0185640
685 Ga0495624_0009621
686 Ga0495671_0078894
687 Ga0495671_0121168
688 Ga0495649_0016239
689 Ga0495589_0079164
690 Ga0495589_0088477
691 Ga0495600_0029494
692 Ga0495581_0042491
693 Ga0495581_0042564
694 Ga0495604_0002997
695 Ga0495674_0033487
696 Ga0495676_0040304
697 Ga0495683_0038119
698 Ga0495675_0005212
699 Ga0495681_0112136
700 Ga0495686_0059024
701 Ga0495593_0035073
702 Ga0496100_0030288
703 Ga0496100_0093116
704 Ga0496101_0070673
705 Ga0496102_0048625
706 Ga0496103_0081713
707 Ga0496103_0112045
708 Ga0496103_0170664
709 Ga0496104_0006609
710 Ga0496104_0123056
711 Ga0496105_0018629
712 Ga0496106_0075534
713 Ga0496106_0147332
714 Ga0496108_0183514
715 Ga0496110_0060899
716 Ga0496110_0131081
717 Ga0496112_0059783
718 Ga0496112_0085054
719 Ga0496112_0100426
720 Ga0496112_0153128
721 Ga0496113_0064264
722 Ga0496115_0031410
723 Ga0496116_0018888
724 Ga0496117_0116389
725 Ga0496118_0016791
726 Ga0496118_0021316
727 Ga0496120_0034401
728 Ga0496120_0056340
729 Ga0496121_0000091
730 Ga0496121_0019174
731 Ga0496121_0065683
732 Ga0496121_0144540
733 Ga0496121_0219743
734 Ga0496124_0080549
735 Ga0496124_0115575
736 Ga0496124_0125620
737 Ga0496124_0210665
738 Ga0496125_0045717
739 Ga0496125_0183387
740 Ga0496126_0004591
741 Ga0496126_0006097
742 Ga0496126_0007610
743 Ga0496126_0256610
744 Ga0495682_0002432
745 Ga0501067_0130763
746 nmdc:mga03n38_19457_c1
747 nmdc:mga00v17_80653_c1
748 nmdc:mga0yw44_111088_c1
749 nmdc:mga0yw44_29470_c1
750 nmdc:mga0yw44_7769_c2
751 nmdc:mga06z11_59018_c1
752 nmdc:mga07m45_17820_c1
753 nmdc:mga07m45_26977_c1
754 nmdc:mga0sz30_10180_c1
755 Ga0500583_0083482
756 Ga0500566_0007379
757 Ga0500557_000212
758 Ga0500595_005914
759 Ga0500595_009501
760 Ga0500595_011821
761 Ga0500595_041726
762 Ga0500595_042729
763 Ga0500642_0000193
764 Ga0500559_0012617
765 Ga0500568_0017163
766 Ga0500568_0045220
767 Ga0500589_062494
768 Ga0500619_072101
769 Ga0500627_0036437
770 Ga0500636_0000075
771 Ga0500625_013822
772 Ga0500645_011392
773 Ga0500645_016161
774 Ga0500601_000231
775 2508546208
776 2511397269
777 2513628879
778 2513639564
779 2513703363
780 2513873902
781 2514012873
782 2515625854
783 2517102375
784 2528851597
785 2617351713
786 2793063107
787 2805915985
788 2818237291
789 2824602586
790 2824612634
791 2824621096
792 2824630103
793 2824637881
794 2824650039
795 2824664740
796 2824674246
797 2824683547
798 2824690841
799 2824697640
800 2824709674
801 2824719890
802 2824730276
803 2824757102
804 2824768438
805 2838124126
806 2841951613
807 2841964602
808 2841969249
809 2841985604
810 2842043872
811 2842052138
812 2844321834
813 2847941764
814 2849082686
815 2874617748
816 2874636719
817 2879107236
818 2879111702
819 2879127672
820 2879146055
821 2881370991
822 2881665707
823 2885371389
824 2888379952
825 2888391031
826 2903727616
827 2904716195
828 2906602894
829 2922378338
830 2922388632
831 2922400787
832 2932786357
833 2932805513
834 2932812568
835 2932822930
836 2932829595
837 2935614948
838 2935618113
839 2935641489
840 2935652975
841 2935661558
842 2935669453
843 2935677949
844 2935689600
845 2935701813
846 2935707278
847 2935717119
848 2935730047
849 2935738534
850 2935749218
851 2935756953
852 2935764433
853 2935772760
854 2935778103
855 2935787331
856 2935795881
857 2935804343
858 2935817201
859 2935826013
860 2935831220
861 2935841829
862 2935851632
863 2935856388
864 2935871089
865 2935874586
866 2935888890
867 2935977896
868 2935994047
869 2936004942
870 2936015713
871 2936024347
872 2936031766
873 2936043997
874 2936051588
875 2940562867
876 2941532365
877 2941543902
878 3005486408
879 3005509535
880 3005589031
881 3005602182
882 3005724972
883 8006931369
884 8006968292
885 8016518615
886 8016526585
887 8016544869
888 8016565561
889 8016582518
890 8016586800
891 8016603177
892 8016606098
893 8016617980
894 8017058055
895 8019531492
896 8019540039
897 8019550614
898 8019605983
899 8019612550
900 8019622567
901 8019630544
902 8019640069
903 8019667370
904 8019677146
905 8019678840
906 8056676204

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07143

CrtC

CrtC N-terminal lipocalin domain

62

236

0.97

PF17186

Lipocalin_9

Lipocalin-like domain

239

361

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4h83-assembly3.cif.gz_C crystal structure of mandelate racemase/muconate lactonizing enzyme (efi target:502127) 0.8875 242 276
2poz-assembly1.cif.gz_F crystal structure of a putative dehydratase from mesorhizobium loti 0.8696 242 275
2ich-assembly2.cif.gz_B crystal structure of a putative atth (ne1406) from nitrosomonas europaea at 2.00 a resolution 0.8331 40 361
2ich-assembly1.cif.gz_A crystal structure of a putative atth (ne1406) from nitrosomonas europaea at 2.00 a resolution 0.8299 40 361
2ich-assembly2.cif.gz_B crystal structure of a putative atth (ne1406) from nitrosomonas europaea at 2.00 a resolution 0.8259 40 361
ID Description Score Start End Superfamily
af_O86370_251_386_2.40.370.10 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.9533 240 361 2.40.370.10
2ichA02 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.8765 240 361 2.40.370.10
af_Q4DUI7_324_467_2.40.370.10 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.8698 246 361 2.40.370.10
af_A4HY44_246_377_2.40.370.10 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.8661 245 361 2.40.370.10
af_Q4DD12_254_381_2.40.370.10 Mainly Beta;Beta Barrel;AttH-like fold;AttH-like domain 0.8623 241 359 2.40.370.10
ID Description Score Start End GO Terms
AF-A0A2P5MHE5-F1-model_v4 Iron ABC transporter permease 0.9789 241 361
AF-A0A2P5MHE5-F1-model_v4 Iron ABC transporter permease 0.971 241 361
AF-A0A836ZHY3-F1-model_v4 deleted 0.9538 260 361
AF-A0A3D5PPH4-F1-model_v4 Iron ABC transporter permease 0.9537 245 361
AF-A0A8B4IA67-F1-model_v4 Putative lipoprotein 0.953 234 361

Map