F447252

General Info

Members Datasets Scaffolds Average Seq Length
453 157 902 248

Family's Representative Sequence

Representative Sequence 3300046499|Ga0495594_0207948|Ga0495594_0207948_288_1058
Length 256
Sequence VSTPASPIARKGPPKPSDALDKIATNAEPHEMRDPYDIGEALAMLAETGEPVTIYPTGSRDTLVARIDSVDPELPHFVIDVAGGEKVPAGAATLVASLGGNAKLQFELDQDWRGQPGAPHLVNATFPASCLVLNRRAAQRLDTPVGVNYTASFTSLGRSYQLQLRDFSMGGVGLHATPDQATGLRVGKKLEGVRLELGPALVVTADLEIRLMRPFRTFLLGEQLQIGCRFLNLSPQVEQTLSRLVGTAGGSRRPPA

Samples

Sample ID Description Type Environment
1 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
4 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
9 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
10 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
11 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
12 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
13 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
14 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
15 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
16 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
17 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
18 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
19 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
20 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
21 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
22 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
23 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
24 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
25 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
26 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
29 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
30 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
33 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
34 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
35 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
37 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
39 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
40 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
41 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
42 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
43 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
44 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
45 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
46 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
47 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
48 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
49 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
50 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
51 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
52 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
53 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
54 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
55 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
56 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
57 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
58 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
59 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
60 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
61 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
62 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
63 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
64 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
65 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
66 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
67 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
68 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
69 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
70 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
71 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
72 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
73 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
74 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
75 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
76 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
77 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
78 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
79 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
80 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
81 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
82 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
83 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
84 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
85 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
86 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
87 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
88 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
89 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
90 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
91 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
92 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
93 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
94 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
95 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
96 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
97 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
98 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
99 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
100 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
101 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
102 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
103 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
104 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
105 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
106 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
107 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
108 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
109 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
110 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
111 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
112 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
113 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
114 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
115 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
116 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
117 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
120 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
121 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
122 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
123 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
124 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
125 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
126 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
127 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
128 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
129 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
130 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
131 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
132 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
133 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
134 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
138 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
139 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
140 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
141 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
142 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
143 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
144 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
145 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
146 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
147 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
148 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
149 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
152 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
154 2643221556 Massilia sp. Root1485 Isolate Unclassified
155 2643221684 Massilia sp. Root133 Isolate Unclassified
156 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
157 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0.22
Isolates 0.88

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.1
Nodule 0
Rhizoplane 2.65
Rhizosphere 92.05
Stem 0
Stem Tuber 0
Unclassified 1.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495594_0207948 3300046499 Bacteria 1116
2 rootL2_10038554 3300003322 Bacteria 3365
3 rootL2_10213119 3300003322 Bacteria 2281
4 Ga0055542_1010392 3300003762 Bacteria 1703
5 Ga0065165_1044855 3300005262 Bacteria 1291
6 Ga0070658_10220609 3300005327 Bacteria 1603
7 Ga0070658_10381350 3300005327 Bacteria 1209
8 Ga0070658_10414589 3300005327 Bacteria 1158
9 Ga0070660_100023965 3300005339 Bacteria 4526
10 Ga0070659_100016372 3300005366 Bacteria 5566
11 Ga0070659_100056924 3300005366 Bacteria 3082
12 Ga0070662_100153941 3300005457 Bacteria 1793
13 Ga0070662_100330169 3300005457 Bacteria 1246
14 Ga0068855_100044300 3300005563 Bacteria 5266
15 Ga0070664_100025699 3300005564 Bacteria 4883
16 Ga0070664_100130935 3300005564 Bacteria 2203
17 Ga0070664_100375388 3300005564 Bacteria 1297
18 Ga0068852_100192020 3300005616 Bacteria 1927
19 Ga0105244_10073325 3300009036 Bacteria 1704
20 Ga0105240_10331692 3300009093 Bacteria 1731
21 Ga0105245_10415178 3300009098 Bacteria 1348
22 Ga0105243_10216463 3300009148 Bacteria 1690
23 Ga0105241_10042866 3300009174 Bacteria 3426
24 Ga0105242_10106528 3300009176 Bacteria 2382
25 Ga0105246_10268197 3300011119 Bacteria 1363
26 Ga0157373_10275201 3300013100 Bacteria 1192
27 Ga0157369_10597316 3300013105 Bacteria 1139
28 Ga0157374_10880064 3300013296 Bacteria 913
29 Ga0157372_10496275 3300013307 Bacteria 1423
30 Ga0157372_10557090 3300013307 Bacteria 1336
31 Ga0209563_100007 3300025230 Bacteria 1579402
32 Ga0209677_103206 3300025253 Bacteria 5476
33 Ga0209148_1000360 3300025254 Bacteria 57908
34 Ga0207705_10054445 3300025909 Bacteria 2883
35 Ga0207705_10200519 3300025909 Bacteria 1512
36 Ga0207705_10265807 3300025909 Bacteria 1311
37 Ga0207654_10065325 3300025911 Bacteria 2142
38 Ga0207695_10256060 3300025913 Bacteria 1649
39 Ga0207657_10016079 3300025919 Bacteria 7222
40 Ga0207657_10035032 3300025919 Bacteria 4506
41 Ga0207649_10038766 3300025920 Bacteria 2886
42 Ga0207687_10380565 3300025927 Bacteria 1156
43 Ga0207690_10010877 3300025932 Bacteria 5422
44 Ga0207690_10095364 3300025932 Bacteria 2113
45 Ga0207706_10073957 3300025933 Bacteria 2996
46 Ga0207706_10405224 3300025933 Bacteria 1182
47 Ga0207709_10046828 3300025935 Bacteria 2626
48 Ga0207679_10042853 3300025945 Bacteria 3255
49 Ga0207679_10806378 3300025945 Bacteria 856
50 Ga0207667_10027566 3300025949 Bacteria 6180
51 Ga0207648_10378577 3300026089 Bacteria 1279
52 Ga0207698_10284585 3300026142 Bacteria 1531
53 Ga0307408_100546255 3300031548 Bacteria 1022
54 Ga0395899_0013241 3300037312 Bacteria 6311
55 Ga0395899_0013423 3300037312 Bacteria 6267
56 Ga0395899_0048779 3300037312 Bacteria 3149
57 Ga0395899_0082816 3300037312 Bacteria 2333
58 Ga0395899_0092186 3300037312 Bacteria 2194
59 Ga0395900_0000393 3300037418 Bacteria 63296
60 Ga0395900_0004592 3300037418 Bacteria 14575
61 Ga0395900_0025364 3300037418 Bacteria 6069
62 Ga0395900_0046773 3300037418 Bacteria 4455
63 Ga0395900_0069281 3300037418 Bacteria 3625
64 Ga0395900_0087176 3300037418 Bacteria 3208
65 Ga0395900_0156231 3300037418 Bacteria 2329
66 Ga0395900_0264253 3300037418 Bacteria 1717
67 Ga0395900_0511531 3300037418 Bacteria 1150
68 Ga0395900_0641466 3300037418 Bacteria 999
69 Ga0395900_0660560 3300037418 Bacteria 981
70 Ga0395898_0056910 3300037466 Bacteria 3810
71 Ga0395898_0147519 3300037466 Bacteria 2251
72 Ga0395898_0151386 3300037466 Bacteria 2219
73 Ga0395898_0639579 3300037466 Bacteria 1006
74 Ga0395905_0042175 3300037471 Bacteria 4281
75 Ga0395905_0183260 3300037471 Bacteria 1966
76 Ga0395905_0240098 3300037471 Bacteria 1693
77 Ga0395905_0298089 3300037471 Bacteria 1499
78 Ga0395901_0000054 3300038443 Bacteria 160505
79 Ga0395901_0010533 3300038443 Bacteria 9365
80 Ga0395901_0056624 3300038443 Bacteria 4078
81 Ga0395901_0144792 3300038443 Bacteria 2498
82 Ga0395901_0173472 3300038443 Bacteria 2262
83 Ga0395901_0468412 3300038443 Bacteria 1286
84 Ga0395901_0554348 3300038443 Bacteria 1164
85 Ga0395901_0649616 3300038443 Bacteria 1058
86 Ga0439465_0010410 3300041413 Bacteria 2922
87 Ga0439448_0000525 3300042005 Bacteria 8907
88 Ga0439448_0072841 3300042005 Bacteria 1145
89 Ga0439449_0014062 3300042007 Bacteria 3010
90 Ga0439450_020230 3300042008 Bacteria 1419
91 Ga0439450_032211 3300042008 Bacteria 1183
92 Ga0439455_0102196 3300042012 Bacteria 793
93 Ga0450904_000438 3300042139 Bacteria 8300
94 Ga0466969_0090829 3300044656 Bacteria 1447
95 Ga0466972_0014484 3300044658 Bacteria 3949
96 Ga0466972_0102929 3300044658 Bacteria 1351
97 Ga0466965_0006430 3300044683 Bacteria 5335
98 Ga0466965_0105819 3300044683 Bacteria 1442
99 Ga0466965_0111750 3300044683 Bacteria 1404
100 Ga0466965_0135689 3300044683 Bacteria 1278
101 Ga0466966_0016098 3300044684 Bacteria 4944
102 Ga0466966_0057169 3300044684 Bacteria 2466
103 Ga0466966_0064102 3300044684 Bacteria 2314
104 Ga0466966_0072759 3300044684 Bacteria 2151
105 Ga0466966_0083733 3300044684 Bacteria 1984
106 Ga0466966_0097037 3300044684 Bacteria 1825
107 Ga0466963_0033690 3300044694 Bacteria 3328
108 Ga0466964_0000091 3300044706 Bacteria 21332
109 Ga0466964_0001048 3300044706 Bacteria 9221
110 Ga0466964_0018806 3300044706 Bacteria 2653
111 Ga0466964_0132348 3300044706 Bacteria 1137
112 Ga0466971_0155982 3300044719 Bacteria 1067
113 Ga0466968_0000777 3300044735 Bacteria 11090
114 Ga0466968_0103935 3300044735 Bacteria 1271
115 Ga0466970_0179706 3300044765 Bacteria 1174
116 Ga0466957_0000064 3300044842 Bacteria 40442
117 Ga0466959_0065839 3300045049 Bacteria 2629
118 Ga0466959_0071415 3300045049 Bacteria 2514
119 Ga0466959_0111314 3300045049 Bacteria 1953
120 Ga0466959_0112489 3300045049 Bacteria 1942
121 Ga0466958_0035713 3300045836 Bacteria 2970
122 Ga0466958_0050060 3300045836 Bacteria 2529
123 Ga0466958_0238454 3300045836 Bacteria 1162
124 Ga0466967_0015997 3300045976 Bacteria 5900
125 Ga0466967_0026938 3300045976 Bacteria 4772
126 Ga0466967_0353233 3300045976 Bacteria 1423
127 Ga0466967_0376251 3300045976 Bacteria 1378
128 Ga0495617_001102 3300046452 Bacteria 12291
129 Ga0495627_030531 3300046453 Bacteria 1707
130 Ga0495590_0000251 3300046457 Bacteria 29217
131 Ga0495590_0003051 3300046457 Bacteria 6864
132 Ga0495590_0068651 3300046457 Bacteria 1242
133 Ga0495590_0108730 3300046457 Bacteria 988
134 Ga0495629_0272119 3300046459 Bacteria 1163
135 Ga0495638_0002966 3300046460 Bacteria 13544
136 Ga0495638_0050332 3300046460 Bacteria 2602
137 Ga0495638_0103743 3300046460 Bacteria 1697
138 Ga0495653_0005312 3300046463 Bacteria 10477
139 Ga0495653_0180234 3300046463 Bacteria 1450
140 Ga0495650_0000108 3300046471 Bacteria 200369
141 Ga0495580_0364588 3300046472 Bacteria 977
142 Ga0495582_0015720 3300046473 Bacteria 4151
143 Ga0495605_0001736 3300046474 Bacteria 13967
144 Ga0495605_0003011 3300046474 Bacteria 10174
145 Ga0495605_0008745 3300046474 Bacteria 5716
146 Ga0495605_0022216 3300046474 Bacteria 3352
147 Ga0495605_0036697 3300046474 Bacteria 2469
148 Ga0495605_0038620 3300046474 Bacteria 2394
149 Ga0495605_0048567 3300046474 Bacteria 2077
150 Ga0495605_0055188 3300046474 Bacteria 1920
151 Ga0495584_0000006 3300046491 Bacteria 301775
152 Ga0495584_0001835 3300046491 Bacteria 12335
153 Ga0495584_0002247 3300046491 Bacteria 11024
154 Ga0495584_0003129 3300046491 Bacteria 9193
155 Ga0495584_0016820 3300046491 Bacteria 3728
156 Ga0495584_0037689 3300046491 Bacteria 2444
157 Ga0495585_0000282 3300046492 Bacteria 50936
158 Ga0495585_0000926 3300046492 Bacteria 24849
159 Ga0495585_0003548 3300046492 Bacteria 10477
160 Ga0495585_0004128 3300046492 Bacteria 9503
161 Ga0495585_0011838 3300046492 Bacteria 5153
162 Ga0495585_0016766 3300046492 Bacteria 4244
163 Ga0495585_0042367 3300046492 Bacteria 2550
164 Ga0495585_0050115 3300046492 Bacteria 2316
165 Ga0495585_0053233 3300046492 Bacteria 2240
166 Ga0495585_0065363 3300046492 Bacteria 1993
167 Ga0495585_0083761 3300046492 Bacteria 1725
168 Ga0495585_0174736 3300046492 Bacteria 1107
169 Ga0495585_0190305 3300046492 Bacteria 1050
170 Ga0495585_0214952 3300046492 Bacteria 972
171 Ga0495585_0267440 3300046492 Bacteria 848
172 Ga0495594_0043725 3300046499 Bacteria 2455
173 Ga0495594_0058985 3300046499 Bacteria 2121
174 Ga0495596_0000236 3300046500 Bacteria 37630
175 Ga0495596_0001429 3300046500 Bacteria 13705
176 Ga0495596_0004975 3300046500 Bacteria 6367
177 Ga0495596_0005735 3300046500 Bacteria 5828
178 Ga0495596_0010298 3300046500 Bacteria 4076
179 Ga0495596_0038137 3300046500 Bacteria 1900
180 Ga0495596_0078678 3300046500 Bacteria 1280
181 Ga0495596_0106628 3300046500 Bacteria 1088
182 Ga0495607_0002467 3300046501 Bacteria 15021
183 Ga0495607_0034546 3300046501 Bacteria 3066
184 Ga0495607_0042358 3300046501 Bacteria 2698
185 Ga0495607_0059159 3300046501 Bacteria 2187
186 Ga0495607_0060944 3300046501 Bacteria 2145
187 Ga0495607_0130550 3300046501 Bacteria 1308
188 Ga0495607_0193736 3300046501 Bacteria 1010
189 Ga0495607_0238066 3300046501 Bacteria 882
190 Ga0495583_0000525 3300046506 Bacteria 54370
191 Ga0495583_0001445 3300046506 Bacteria 24126
192 Ga0495583_0004816 3300046506 Bacteria 9459
193 Ga0495583_0020340 3300046506 Bacteria 3441
194 Ga0495583_0053522 3300046506 Bacteria 1831
195 Ga0495583_0071760 3300046506 Bacteria 1520
196 Ga0495583_0083798 3300046506 Bacteria 1382
197 Ga0495583_0153010 3300046506 Bacteria 955
198 Ga0495606_0008706 3300046507 Bacteria 8739
199 Ga0495606_0013368 3300046507 Bacteria 6489
200 Ga0495606_0039043 3300046507 Bacteria 3206
201 Ga0495606_0251379 3300046507 Bacteria 980
202 Ga0495616_0000272 3300046513 Bacteria 41986
203 Ga0495616_0000343 3300046513 Bacteria 36983
204 Ga0495616_0000680 3300046513 Bacteria 25142
205 Ga0495616_0001661 3300046513 Bacteria 15228
206 Ga0495616_0004092 3300046513 Bacteria 9255
207 Ga0495616_0008070 3300046513 Bacteria 6269
208 Ga0495616_0042463 3300046513 Bacteria 2314
209 Ga0495616_0087272 3300046513 Bacteria 1482
210 Ga0495616_0087281 3300046513 Bacteria 1482
211 Ga0495616_0184254 3300046513 Bacteria 926
212 Ga0495620_0003145 3300046515 Bacteria 9470
213 Ga0495620_0021396 3300046515 Bacteria 3141
214 Ga0495630_0087983 3300046517 Bacteria 2346
215 Ga0495631_0002105 3300046518 Bacteria 11552
216 Ga0495631_0002733 3300046518 Bacteria 9782
217 Ga0495631_0005046 3300046518 Bacteria 6953
218 Ga0495631_0063477 3300046518 Bacteria 1599
219 Ga0495631_0089252 3300046518 Bacteria 1327
220 Ga0495631_0099688 3300046518 Bacteria 1250
221 Ga0495632_0002631 3300046519 Bacteria 13521
222 Ga0495632_0011701 3300046519 Bacteria 5107
223 Ga0495632_0041991 3300046519 Bacteria 2294
224 Ga0495632_0050548 3300046519 Bacteria 2049
225 Ga0495632_0088904 3300046519 Bacteria 1467
226 Ga0495637_0005727 3300046520 Bacteria 6296
227 Ga0495643_0000969 3300046522 Bacteria 29411
228 Ga0495643_0001637 3300046522 Bacteria 19768
229 Ga0495643_0017482 3300046522 Bacteria 4191
230 Ga0495643_0041798 3300046522 Bacteria 2499
231 Ga0495643_0055575 3300046522 Bacteria 2115
232 Ga0495643_0055831 3300046522 Bacteria 2110
233 Ga0495643_0063362 3300046522 Bacteria 1955
234 Ga0495643_0098068 3300046522 Bacteria 1505
235 Ga0495644_0011559 3300046523 Bacteria 3398
236 Ga0495644_0011988 3300046523 Bacteria 3330
237 Ga0495644_0043345 3300046523 Bacteria 1693
238 Ga0495644_0082432 3300046523 Bacteria 1212
239 Ga0495648_0000109 3300046524 Bacteria 101519
240 Ga0495648_0003866 3300046524 Bacteria 12989
241 Ga0495648_0013051 3300046524 Bacteria 6163
242 Ga0495648_0037544 3300046524 Bacteria 3111
243 Ga0495648_0054628 3300046524 Bacteria 2412
244 Ga0495648_0094938 3300046524 Bacteria 1660
245 Ga0495663_0016965 3300046525 Bacteria 2062
246 Ga0495666_0021598 3300046526 Bacteria 3186
247 Ga0495666_0078558 3300046526 Bacteria 1563
248 Ga0495642_0002912 3300046528 Bacteria 6821
249 Ga0495642_0006490 3300046528 Bacteria 4488
250 Ga0495642_0008590 3300046528 Bacteria 3906
251 Ga0495642_0033167 3300046528 Bacteria 2075
252 Ga0495652_0037125 3300046529 Bacteria 4229
253 Ga0495654_0057655 3300046530 Bacteria 1875
254 Ga0495654_0084440 3300046530 Bacteria 1483
255 Ga0495665_0023043 3300046531 Bacteria 3344
256 Ga0495586_0007801 3300046535 Bacteria 5706
257 Ga0495587_0014029 3300046536 Bacteria 5030
258 Ga0495587_0093840 3300046536 Bacteria 1733
259 Ga0495609_0000009 3300046538 Bacteria 354860
260 Ga0495609_0002695 3300046538 Bacteria 10719
261 Ga0495609_0006181 3300046538 Bacteria 6158
262 Ga0495609_0045806 3300046538 Bacteria 1959
263 Ga0495609_0056121 3300046538 Bacteria 1746
264 Ga0495609_0086094 3300046538 Bacteria 1370
265 Ga0495609_0114208 3300046538 Bacteria 1164
266 Ga0495609_0119400 3300046538 Bacteria 1134
267 Ga0495609_0123095 3300046538 Bacteria 1114
268 Ga0495597_0001393 3300046542 Bacteria 17466
269 Ga0495597_0001796 3300046542 Bacteria 14723
270 Ga0495597_0004290 3300046542 Bacteria 7877
271 Ga0495597_0012231 3300046542 Bacteria 4146
272 Ga0495597_0021415 3300046542 Bacteria 3005
273 Ga0495597_0057245 3300046542 Bacteria 1706
274 Ga0495597_0069368 3300046542 Bacteria 1521
275 Ga0495597_0120347 3300046542 Bacteria 1094
276 Ga0495622_0117163 3300046557 Bacteria 1217
277 Ga0495633_0005794 3300046558 Bacteria 7455
278 Ga0495633_0011196 3300046558 Bacteria 4852
279 Ga0495633_0014297 3300046558 Bacteria 4155
280 Ga0495633_0025180 3300046558 Bacteria 2931
281 Ga0495633_0158229 3300046558 Bacteria 1045
282 Ga0495667_0133507 3300046559 Bacteria 1601
283 Ga0495656_0006954 3300046615 Bacteria 3981
284 Ga0495656_0098545 3300046615 Bacteria 1348
285 Ga0495656_0127161 3300046615 Bacteria 1209
286 Ga0495656_0153693 3300046615 Bacteria 1113
287 Ga0495656_0322342 3300046615 Bacteria 796
288 Ga0495668_0007462 3300046616 Bacteria 6987
289 Ga0495668_0012593 3300046616 Bacteria 5014
290 Ga0495668_0017401 3300046616 Bacteria 4168
291 Ga0495668_0037456 3300046616 Bacteria 2713
292 Ga0495668_0072311 3300046616 Bacteria 1895
293 Ga0495668_0098201 3300046616 Bacteria 1602
294 Ga0495668_0126392 3300046616 Bacteria 1399
295 Ga0495668_0133888 3300046616 Bacteria 1356
296 Ga0495668_0187981 3300046616 Bacteria 1131
297 Ga0495611_0008042 3300046648 Bacteria 4479
298 Ga0495611_0008929 3300046648 Bacteria 4239
299 Ga0495611_0070410 3300046648 Bacteria 1598
300 Ga0495611_0085255 3300046648 Unclassified 1456
301 Ga0495611_0108540 3300046648 Bacteria 1291
302 Ga0495625_0009819 3300046660 Bacteria 7965
303 Ga0495625_0060807 3300046660 Bacteria 2675
304 Ga0495625_0094143 3300046660 Bacteria 2067
305 Ga0495625_0181224 3300046660 Bacteria 1400
306 Ga0495625_0311136 3300046660 Bacteria 1005
307 Ga0495659_0157974 3300046664 Bacteria 914
308 Ga0495661_0000368 3300046665 Bacteria 48926
309 Ga0495661_0001167 3300046665 Bacteria 22911
310 Ga0495661_0002320 3300046665 Bacteria 14679
311 Ga0495661_0012089 3300046665 Bacteria 5837
312 Ga0495661_0019494 3300046665 Bacteria 4444
313 Ga0495661_0022097 3300046665 Bacteria 4141
314 Ga0495661_0053532 3300046665 Bacteria 2426
315 Ga0495661_0082899 3300046665 Bacteria 1844
316 Ga0495661_0091450 3300046665 Bacteria 1730
317 Ga0495661_0109605 3300046665 Bacteria 1540
318 Ga0495661_0117147 3300046665 Bacteria 1476
319 Ga0495661_0119117 3300046665 Bacteria 1460
320 Ga0495661_0169098 3300046665 Bacteria 1167
321 Ga0495661_0219924 3300046665 Bacteria 984
322 Ga0495661_0220601 3300046665 Bacteria 982
323 Ga0495661_0227878 3300046665 Bacteria 962
324 Ga0495588_0000077 3300046674 Bacteria 215338
325 Ga0495588_0115073 3300046674 Bacteria 1417
326 Ga0495623_0007712 3300046679 Bacteria 6995
327 Ga0495623_0023641 3300046679 Bacteria 3964
328 Ga0495646_0086340 3300046680 Bacteria 1820
329 Ga0495669_0086781 3300046684 Bacteria 1441
330 Ga0495670_0000391 3300046691 Bacteria 20872
331 Ga0495670_0004488 3300046691 Bacteria 6840
332 Ga0495670_0044076 3300046691 Bacteria 2227
333 Ga0495670_0068384 3300046691 Bacteria 1794
334 Ga0495670_0071260 3300046691 Bacteria 1759
335 Ga0495670_0103917 3300046691 Bacteria 1465
336 Ga0495670_0111933 3300046691 Bacteria 1413
337 Ga0495671_0079660 3300046692 Bacteria 1605
338 Ga0495671_0111927 3300046692 Bacteria 1333
339 Ga0495671_0132129 3300046692 Bacteria 1217
340 Ga0495649_0019117 3300046694 Bacteria 3849
341 Ga0495649_0047179 3300046694 Bacteria 2343
342 Ga0495589_0000037 3300046794 Bacteria 150603
343 Ga0495589_0001177 3300046794 Bacteria 15597
344 Ga0495589_0001412 3300046794 Bacteria 13925
345 Ga0495589_0028314 3300046794 Bacteria 2828
346 Ga0495589_0035572 3300046794 Bacteria 2497
347 Ga0495589_0045909 3300046794 Bacteria 2169
348 Ga0495589_0114573 3300046794 Bacteria 1300
349 Ga0495589_0205155 3300046794 Unclassified 929
350 Ga0495589_0246209 3300046794 Unclassified 836
351 Ga0495660_0000178 3300046810 Bacteria 68956
352 Ga0495660_0059823 3300046810 Bacteria 2048
353 Ga0495660_0069647 3300046810 Bacteria 1869
354 Ga0495581_0042771 3300047315 Bacteria 2622
355 Ga0495604_0034515 3300047317 Bacteria 4001
356 Ga0495636_0226197 3300047318 Bacteria 860
357 Ga0495672_0000590 3300047320 Bacteria 41027
358 Ga0495672_0001672 3300047320 Bacteria 21505
359 Ga0495672_0111073 3300047320 Bacteria 1471
360 Ga0495672_0111611 3300047320 Bacteria 1466
361 Ga0495672_0123579 3300047320 Bacteria 1372
362 Ga0495672_0241650 3300047320 Bacteria 881
363 Ga0495680_0109368 3300047322 Bacteria 2050
364 Ga0495683_0000144 3300047323 Bacteria 69959
365 Ga0495683_0017082 3300047323 Bacteria 3764
366 Ga0495683_0067653 3300047323 Bacteria 1758
367 Ga0495683_0071100 3300047323 Bacteria 1708
368 Ga0495683_0083263 3300047323 Bacteria 1558
369 Ga0495683_0161661 3300047323 Unclassified 1035
370 Ga0495687_000002 3300047443 Bacteria 1085770
371 Ga0495687_000017 3300047443 Bacteria 350429
372 Ga0495687_000024 3300047443 Bacteria 316676
373 Ga0495687_001539 3300047443 Bacteria 20979
374 Ga0495687_005580 3300047443 Bacteria 7970
375 Ga0495687_095239 3300047443 Bacteria 1130
376 Ga0495675_0009655 3300047444 Bacteria 6011
377 Ga0495677_0000011 3300047445 Bacteria 149837
378 Ga0495677_0001358 3300047445 Bacteria 9771
379 Ga0495677_0005209 3300047445 Bacteria 4946
380 Ga0495677_0013765 3300047445 Bacteria 2944
381 Ga0495677_0013935 3300047445 Bacteria 2926
382 Ga0495677_0013944 3300047445 Bacteria 2925
383 Ga0495677_0034146 3300047445 Bacteria 1855
384 Ga0495677_0035549 3300047445 Bacteria 1818
385 Ga0495679_003113 3300047446 Bacteria 8123
386 Ga0495679_003713 3300047446 Bacteria 7264
387 Ga0495685_016614 3300047447 Bacteria 2515
388 Ga0495685_078926 3300047447 Bacteria 1097
389 Ga0495673_0017732 3300047469 Bacteria 3605
390 Ga0495681_0068369 3300047470 Bacteria 1616
391 Ga0495681_0119687 3300047470 Bacteria 1131
392 Ga0495681_0211990 3300047470 Bacteria 780
393 Ga0495686_0000428 3300047472 Bacteria 65588
394 Ga0495686_0062975 3300047472 Bacteria 2299
395 Ga0495686_0252309 3300047472 Bacteria 991
396 Ga0495686_0318566 3300047472 Unclassified 853
397 Ga0495602_0193676 3300048088 Bacteria 1556
398 Ga0495626_0000004 3300048091 Bacteria 356599
399 Ga0495626_0000016 3300048091 Bacteria 232214
400 Ga0495626_0004950 3300048091 Bacteria 7991
401 Ga0495626_0008239 3300048091 Bacteria 5734
402 Ga0495626_0009770 3300048091 Bacteria 5165
403 Ga0495626_0019424 3300048091 Bacteria 3400
404 Ga0495626_0038140 3300048091 Bacteria 2279
405 Ga0495626_0054195 3300048091 Bacteria 1842
406 Ga0495626_0057599 3300048091 Bacteria 1777
407 Ga0495626_0059364 3300048091 Bacteria 1745
408 Ga0495626_0060062 3300048091 Bacteria 1733
409 Ga0495626_0096530 3300048091 Bacteria 1293
410 Ga0495626_0102495 3300048091 Bacteria 1246
411 Ga0495626_0137407 3300048091 Bacteria 1038
412 Ga0496100_0022184 3300048903 Bacteria 3838
413 Ga0496101_0027268 3300048904 Bacteria 3977
414 Ga0496103_0091203 3300048906 Bacteria 1923
415 Ga0496104_0067691 3300048907 Bacteria 3393
416 Ga0496107_0213538 3300048910 Bacteria 1435
417 Ga0496109_0044201 3300048912 Bacteria 4041
418 Ga0496110_0000019 3300048913 Bacteria 79137
419 Ga0496112_0283705 3300048915 Bacteria 1603
420 Ga0496113_0062180 3300048916 Bacteria 2819
421 Ga0496113_0408553 3300048916 Bacteria 1090
422 Ga0496113_0602707 3300048916 Bacteria 880
423 Ga0496115_0034428 3300048918 Bacteria 4003
424 Ga0496122_0000835 3300048925 Bacteria 58311
425 Ga0496122_0032945 3300048925 Bacteria 4271
426 Ga0496122_0058109 3300048925 Bacteria 2866
427 Ga0496123_0001003 3300048926 Bacteria 43216
428 Ga0496123_0004574 3300048926 Bacteria 14422
429 Ga0496123_0118961 3300048926 Bacteria 1491
430 Ga0496124_0002249 3300048927 Bacteria 25656
431 Ga0496124_0017479 3300048927 Bacteria 6757
432 Ga0496124_0035943 3300048927 Bacteria 4328
433 Ga0496124_0036117 3300048927 Bacteria 4314
434 Ga0496124_0051166 3300048927 Bacteria 3516
435 Ga0496124_0106208 3300048927 Bacteria 2267
436 Ga0496124_0143771 3300048927 Bacteria 1879
437 Ga0496125_0001280 3300048928 Bacteria 37321
438 Ga0496125_0152811 3300048928 Bacteria 1582
439 Ga0495678_000866 3300049459 Bacteria 26949
440 Ga0495678_017396 3300049459 Bacteria 3260
441 Ga0495682_0040552 3300049460 Bacteria 1707
442 Ga0501222_002170 3300049662 Bacteria 2723
443 Ga0501035_0000965 3300049822 Bacteria 30391
444 Ga0501044_0276736 3300049823 Bacteria 1613
445 Ga0587068_000339 3300059641 Bacteria 4003
446 Ga0466962_0030951 3300061719 Bacteria 2562
447 Ga0466962_0092745 3300061719 Bacteria 1448
448 2643802319 2643221556 Bacteria 7251154
449 2644475827 2643221684 Bacteria 7145183
450 2809145364 2808606418 Bacteria 6724496
451 8047673823 8047673197 Bacteria 7395230
452 Ga0495594_0207948
453 rootL2_10038554
454 rootL2_10213119
455 Ga0055542_1010392
456 Ga0065165_1044855
457 Ga0070658_10220609
458 Ga0070658_10381350
459 Ga0070658_10414589
460 Ga0070660_100023965
461 Ga0070659_100016372
462 Ga0070659_100056924
463 Ga0070662_100153941
464 Ga0070662_100330169
465 Ga0068855_100044300
466 Ga0070664_100025699
467 Ga0070664_100130935
468 Ga0070664_100375388
469 Ga0068852_100192020
470 Ga0105244_10073325
471 Ga0105240_10331692
472 Ga0105245_10415178
473 Ga0105243_10216463
474 Ga0105241_10042866
475 Ga0105242_10106528
476 Ga0105246_10268197
477 Ga0157373_10275201
478 Ga0157369_10597316
479 Ga0157374_10880064
480 Ga0157372_10496275
481 Ga0157372_10557090
482 Ga0209563_100007
483 Ga0209677_103206
484 Ga0209148_1000360
485 Ga0207705_10054445
486 Ga0207705_10200519
487 Ga0207705_10265807
488 Ga0207654_10065325
489 Ga0207695_10256060
490 Ga0207657_10016079
491 Ga0207657_10035032
492 Ga0207649_10038766
493 Ga0207687_10380565
494 Ga0207690_10010877
495 Ga0207690_10095364
496 Ga0207706_10073957
497 Ga0207706_10405224
498 Ga0207709_10046828
499 Ga0207679_10042853
500 Ga0207679_10806378
501 Ga0207667_10027566
502 Ga0207648_10378577
503 Ga0207698_10284585
504 Ga0307408_100546255
505 Ga0395899_0013241
506 Ga0395899_0013423
507 Ga0395899_0048779
508 Ga0395899_0082816
509 Ga0395899_0092186
510 Ga0395900_0000393
511 Ga0395900_0004592
512 Ga0395900_0025364
513 Ga0395900_0046773
514 Ga0395900_0069281
515 Ga0395900_0087176
516 Ga0395900_0156231
517 Ga0395900_0264253
518 Ga0395900_0511531
519 Ga0395900_0641466
520 Ga0395900_0660560
521 Ga0395898_0056910
522 Ga0395898_0147519
523 Ga0395898_0151386
524 Ga0395898_0639579
525 Ga0395905_0042175
526 Ga0395905_0183260
527 Ga0395905_0240098
528 Ga0395905_0298089
529 Ga0395901_0000054
530 Ga0395901_0010533
531 Ga0395901_0056624
532 Ga0395901_0144792
533 Ga0395901_0173472
534 Ga0395901_0468412
535 Ga0395901_0554348
536 Ga0395901_0649616
537 Ga0439465_0010410
538 Ga0439448_0000525
539 Ga0439448_0072841
540 Ga0439449_0014062
541 Ga0439450_020230
542 Ga0439450_032211
543 Ga0439455_0102196
544 Ga0450904_000438
545 Ga0466969_0090829
546 Ga0466972_0014484
547 Ga0466972_0102929
548 Ga0466965_0006430
549 Ga0466965_0105819
550 Ga0466965_0111750
551 Ga0466965_0135689
552 Ga0466966_0016098
553 Ga0466966_0057169
554 Ga0466966_0064102
555 Ga0466966_0072759
556 Ga0466966_0083733
557 Ga0466966_0097037
558 Ga0466963_0033690
559 Ga0466964_0000091
560 Ga0466964_0001048
561 Ga0466964_0018806
562 Ga0466964_0132348
563 Ga0466971_0155982
564 Ga0466968_0000777
565 Ga0466968_0103935
566 Ga0466970_0179706
567 Ga0466957_0000064
568 Ga0466959_0065839
569 Ga0466959_0071415
570 Ga0466959_0111314
571 Ga0466959_0112489
572 Ga0466958_0035713
573 Ga0466958_0050060
574 Ga0466958_0238454
575 Ga0466967_0015997
576 Ga0466967_0026938
577 Ga0466967_0353233
578 Ga0466967_0376251
579 Ga0495617_001102
580 Ga0495627_030531
581 Ga0495590_0000251
582 Ga0495590_0003051
583 Ga0495590_0068651
584 Ga0495590_0108730
585 Ga0495629_0272119
586 Ga0495638_0002966
587 Ga0495638_0050332
588 Ga0495638_0103743
589 Ga0495653_0005312
590 Ga0495653_0180234
591 Ga0495650_0000108
592 Ga0495580_0364588
593 Ga0495582_0015720
594 Ga0495605_0001736
595 Ga0495605_0003011
596 Ga0495605_0008745
597 Ga0495605_0022216
598 Ga0495605_0036697
599 Ga0495605_0038620
600 Ga0495605_0048567
601 Ga0495605_0055188
602 Ga0495584_0000006
603 Ga0495584_0001835
604 Ga0495584_0002247
605 Ga0495584_0003129
606 Ga0495584_0016820
607 Ga0495584_0037689
608 Ga0495585_0000282
609 Ga0495585_0000926
610 Ga0495585_0003548
611 Ga0495585_0004128
612 Ga0495585_0011838
613 Ga0495585_0016766
614 Ga0495585_0042367
615 Ga0495585_0050115
616 Ga0495585_0053233
617 Ga0495585_0065363
618 Ga0495585_0083761
619 Ga0495585_0174736
620 Ga0495585_0190305
621 Ga0495585_0214952
622 Ga0495585_0267440
623 Ga0495594_0043725
624 Ga0495594_0058985
625 Ga0495596_0000236
626 Ga0495596_0001429
627 Ga0495596_0004975
628 Ga0495596_0005735
629 Ga0495596_0010298
630 Ga0495596_0038137
631 Ga0495596_0078678
632 Ga0495596_0106628
633 Ga0495607_0002467
634 Ga0495607_0034546
635 Ga0495607_0042358
636 Ga0495607_0059159
637 Ga0495607_0060944
638 Ga0495607_0130550
639 Ga0495607_0193736
640 Ga0495607_0238066
641 Ga0495583_0000525
642 Ga0495583_0001445
643 Ga0495583_0004816
644 Ga0495583_0020340
645 Ga0495583_0053522
646 Ga0495583_0071760
647 Ga0495583_0083798
648 Ga0495583_0153010
649 Ga0495606_0008706
650 Ga0495606_0013368
651 Ga0495606_0039043
652 Ga0495606_0251379
653 Ga0495616_0000272
654 Ga0495616_0000343
655 Ga0495616_0000680
656 Ga0495616_0001661
657 Ga0495616_0004092
658 Ga0495616_0008070
659 Ga0495616_0042463
660 Ga0495616_0087272
661 Ga0495616_0087281
662 Ga0495616_0184254
663 Ga0495620_0003145
664 Ga0495620_0021396
665 Ga0495630_0087983
666 Ga0495631_0002105
667 Ga0495631_0002733
668 Ga0495631_0005046
669 Ga0495631_0063477
670 Ga0495631_0089252
671 Ga0495631_0099688
672 Ga0495632_0002631
673 Ga0495632_0011701
674 Ga0495632_0041991
675 Ga0495632_0050548
676 Ga0495632_0088904
677 Ga0495637_0005727
678 Ga0495643_0000969
679 Ga0495643_0001637
680 Ga0495643_0017482
681 Ga0495643_0041798
682 Ga0495643_0055575
683 Ga0495643_0055831
684 Ga0495643_0063362
685 Ga0495643_0098068
686 Ga0495644_0011559
687 Ga0495644_0011988
688 Ga0495644_0043345
689 Ga0495644_0082432
690 Ga0495648_0000109
691 Ga0495648_0003866
692 Ga0495648_0013051
693 Ga0495648_0037544
694 Ga0495648_0054628
695 Ga0495648_0094938
696 Ga0495663_0016965
697 Ga0495666_0021598
698 Ga0495666_0078558
699 Ga0495642_0002912
700 Ga0495642_0006490
701 Ga0495642_0008590
702 Ga0495642_0033167
703 Ga0495652_0037125
704 Ga0495654_0057655
705 Ga0495654_0084440
706 Ga0495665_0023043
707 Ga0495586_0007801
708 Ga0495587_0014029
709 Ga0495587_0093840
710 Ga0495609_0000009
711 Ga0495609_0002695
712 Ga0495609_0006181
713 Ga0495609_0045806
714 Ga0495609_0056121
715 Ga0495609_0086094
716 Ga0495609_0114208
717 Ga0495609_0119400
718 Ga0495609_0123095
719 Ga0495597_0001393
720 Ga0495597_0001796
721 Ga0495597_0004290
722 Ga0495597_0012231
723 Ga0495597_0021415
724 Ga0495597_0057245
725 Ga0495597_0069368
726 Ga0495597_0120347
727 Ga0495622_0117163
728 Ga0495633_0005794
729 Ga0495633_0011196
730 Ga0495633_0014297
731 Ga0495633_0025180
732 Ga0495633_0158229
733 Ga0495667_0133507
734 Ga0495656_0006954
735 Ga0495656_0098545
736 Ga0495656_0127161
737 Ga0495656_0153693
738 Ga0495656_0322342
739 Ga0495668_0007462
740 Ga0495668_0012593
741 Ga0495668_0017401
742 Ga0495668_0037456
743 Ga0495668_0072311
744 Ga0495668_0098201
745 Ga0495668_0126392
746 Ga0495668_0133888
747 Ga0495668_0187981
748 Ga0495611_0008042
749 Ga0495611_0008929
750 Ga0495611_0070410
751 Ga0495611_0085255
752 Ga0495611_0108540
753 Ga0495625_0009819
754 Ga0495625_0060807
755 Ga0495625_0094143
756 Ga0495625_0181224
757 Ga0495625_0311136
758 Ga0495659_0157974
759 Ga0495661_0000368
760 Ga0495661_0001167
761 Ga0495661_0002320
762 Ga0495661_0012089
763 Ga0495661_0019494
764 Ga0495661_0022097
765 Ga0495661_0053532
766 Ga0495661_0082899
767 Ga0495661_0091450
768 Ga0495661_0109605
769 Ga0495661_0117147
770 Ga0495661_0119117
771 Ga0495661_0169098
772 Ga0495661_0219924
773 Ga0495661_0220601
774 Ga0495661_0227878
775 Ga0495588_0000077
776 Ga0495588_0115073
777 Ga0495623_0007712
778 Ga0495623_0023641
779 Ga0495646_0086340
780 Ga0495669_0086781
781 Ga0495670_0000391
782 Ga0495670_0004488
783 Ga0495670_0044076
784 Ga0495670_0068384
785 Ga0495670_0071260
786 Ga0495670_0103917
787 Ga0495670_0111933
788 Ga0495671_0079660
789 Ga0495671_0111927
790 Ga0495671_0132129
791 Ga0495649_0019117
792 Ga0495649_0047179
793 Ga0495589_0000037
794 Ga0495589_0001177
795 Ga0495589_0001412
796 Ga0495589_0028314
797 Ga0495589_0035572
798 Ga0495589_0045909
799 Ga0495589_0114573
800 Ga0495589_0205155
801 Ga0495589_0246209
802 Ga0495660_0000178
803 Ga0495660_0059823
804 Ga0495660_0069647
805 Ga0495581_0042771
806 Ga0495604_0034515
807 Ga0495636_0226197
808 Ga0495672_0000590
809 Ga0495672_0001672
810 Ga0495672_0111073
811 Ga0495672_0111611
812 Ga0495672_0123579
813 Ga0495672_0241650
814 Ga0495680_0109368
815 Ga0495683_0000144
816 Ga0495683_0017082
817 Ga0495683_0067653
818 Ga0495683_0071100
819 Ga0495683_0083263
820 Ga0495683_0161661
821 Ga0495687_000002
822 Ga0495687_000017
823 Ga0495687_000024
824 Ga0495687_001539
825 Ga0495687_005580
826 Ga0495687_095239
827 Ga0495675_0009655
828 Ga0495677_0000011
829 Ga0495677_0001358
830 Ga0495677_0005209
831 Ga0495677_0013765
832 Ga0495677_0013935
833 Ga0495677_0013944
834 Ga0495677_0034146
835 Ga0495677_0035549
836 Ga0495679_003113
837 Ga0495679_003713
838 Ga0495685_016614
839 Ga0495685_078926
840 Ga0495673_0017732
841 Ga0495681_0068369
842 Ga0495681_0119687
843 Ga0495681_0211990
844 Ga0495686_0000428
845 Ga0495686_0062975
846 Ga0495686_0252309
847 Ga0495686_0318566
848 Ga0495602_0193676
849 Ga0495626_0000004
850 Ga0495626_0000016
851 Ga0495626_0004950
852 Ga0495626_0008239
853 Ga0495626_0009770
854 Ga0495626_0019424
855 Ga0495626_0038140
856 Ga0495626_0054195
857 Ga0495626_0057599
858 Ga0495626_0059364
859 Ga0495626_0060062
860 Ga0495626_0096530
861 Ga0495626_0102495
862 Ga0495626_0137407
863 Ga0496100_0022184
864 Ga0496101_0027268
865 Ga0496103_0091203
866 Ga0496104_0067691
867 Ga0496107_0213538
868 Ga0496109_0044201
869 Ga0496110_0000019
870 Ga0496112_0283705
871 Ga0496113_0062180
872 Ga0496113_0408553
873 Ga0496113_0602707
874 Ga0496115_0034428
875 Ga0496122_0000835
876 Ga0496122_0032945
877 Ga0496122_0058109
878 Ga0496123_0001003
879 Ga0496123_0004574
880 Ga0496123_0118961
881 Ga0496124_0002249
882 Ga0496124_0017479
883 Ga0496124_0035943
884 Ga0496124_0036117
885 Ga0496124_0051166
886 Ga0496124_0106208
887 Ga0496124_0143771
888 Ga0496125_0001280
889 Ga0496125_0152811
890 Ga0495678_000866
891 Ga0495678_017396
892 Ga0495682_0040552
893 Ga0501222_002170
894 Ga0501035_0000965
895 Ga0501044_0276736
896 Ga0587068_000339
897 Ga0466962_0030951
898 Ga0466962_0092745
899 2643802319
900 2644475827
901 2809145364
902 8047673823

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07238

PilZ

PilZ domain

134

246

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5y6g-assembly1.cif.gz_A pilz domain with c-di-gmp of ycgr from escherichia coli 0.8123 133 250
5y6h-assembly1.cif.gz_A crystal structure of ycgr-n domain of ycgr from escherichia coli 0.8038 31 132
5y4r-assembly1.cif.gz_D structure of a methyltransferase complex 0.7971 133 249
5y6h-assembly1.cif.gz_A crystal structure of ycgr-n domain of ycgr from escherichia coli 0.7449 31 132
4rt1-assembly1.cif.gz_A structure of the alg44 pilz domain (r95a mutant) from pseudomonas aeruginosa pao1 in complex with c-di-gmp 0.7416 134 246
ID Description Score Start End Superfamily
2gjgA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8483 31 133 2.30.110.10
af_P76010_6_112_2.30.110.10 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.832 31 133 2.30.110.10
af_P76010_114_240_2.40.10.220 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.8304 139 250 2.40.10.220
5kedC02 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.8165 140 250 2.40.10.220
5y4rC00 Mainly Beta;Beta Barrel;Thrombin, subunit H;predicted glycosyltransferase like domains 0.813 133 249 2.40.10.220
ID Description Score Start End GO Terms
AF-A0A0U3MP31-F1-model_v4 Putative flagellar brake protein containing PilZ domain 0.9276 132 248 GO:0035438
AF-A0A377QCG1-F1-model_v4 Cyclic di-GMP binding protein YcgR 0.9017 129 250 GO:0035438
AF-A0A850FB25-F1-model_v4 PilZ domain-containing protein 0.8987 134 248 GO:0035438
AF-A0A2K2VTK2-F1-model_v4 PilZ domain-containing protein 0.8853 134 251 GO:0035438
AF-A0A522DG38-F1-model_v4 GNAT family N-acetyltransferase 0.881 161 240

Map