F447261

General Info

Members Datasets Scaffolds Average Seq Length
453 290 906 217

Family's Representative Sequence

Representative Sequence 3300048909|Ga0496106_0157071|Ga0496106_0157071_702_1433
Length 243
Sequence LRPQIAREERNDNFVDNAQTTGVLMSIELYGFWRSIASFRVRVALRLKNLSFEETSVDILSGEQFKPGYDAVNPEHVVPTFVHDGHSLFQSLAIMEYLEDIKPTPPLLPKDAKERAYARSLALMTIADAHPLVVPRVRNHLAKTFGADAKAIENWGKHWTSEGLSTYERLLARRRPAPFALGAQVGLADICIAGQVVGAHFLKIELTPFPIVAGLAERCFKMPEFSSSHPFEQPGYKAASASH

Samples

Sample ID Description Type Environment
1 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
85 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
132 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
133 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
135 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
138 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
139 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
140 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
141 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
142 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
145 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
152 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
153 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
176 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
177 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
178 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
184 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
187 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
193 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
194 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
195 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
196 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
199 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
200 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
201 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
202 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
206 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
212 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
213 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
216 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
217 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
218 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
219 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
220 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
221 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
222 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
226 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
227 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
232 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
238 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
239 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
240 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
241 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
249 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
250 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
251 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
252 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
253 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
257 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
258 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
262 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
263 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
264 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
265 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
266 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
267 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
268 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
269 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
270 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
271 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
272 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
273 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
274 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
275 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
276 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
277 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
278 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
279 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
280 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
281 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
282 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
283 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
284 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
285 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
286 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
287 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
290 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0.66
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.17
Nodule 0
Rhizoplane 2.87
Rhizosphere 82.12
Stem 0
Stem Tuber 0
Unclassified 4.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496106_0157071 3300048909 Bacteria 1797
2 JGI25406J46586_10000019 3300003203 Bacteria 87589
3 rootL2_10341808 3300003322 Bacteria 1268
4 rootH1_10015906 3300003323 Bacteria 9735
5 Ga0065715_10126737 3300005293 Bacteria 2102
6 Ga0070658_10202564 3300005327 Bacteria 1675
7 Ga0070683_100001350 3300005329 Bacteria 18730
8 Ga0070690_100585510 3300005330 Unclassified 845
9 Ga0070677_10094007 3300005333 Bacteria 1309
10 Ga0070680_100004381 3300005336 Bacteria 10628
11 Ga0070680_100005784 3300005336 Bacteria 9384
12 Ga0068868_100164526 3300005338 Bacteria 1834
13 Ga0070660_100006367 3300005339 Bacteria 8183
14 Ga0070689_100028949 3300005340 Bacteria 4189
15 Ga0070661_100184804 3300005344 Bacteria 1587
16 Ga0070661_100334649 3300005344 Unclassified 1185
17 Ga0070669_100072671 3300005353 Bacteria 2547
18 Ga0070675_100654712 3300005354 Bacteria 955
19 Ga0070671_100507043 3300005355 Bacteria 1038
20 Ga0070674_100009522 3300005356 Bacteria 5818
21 Ga0070673_100461258 3300005364 Bacteria 1144
22 Ga0070667_100725939 3300005367 Bacteria 920
23 Ga0070709_10239670 3300005434 Bacteria 1302
24 Ga0070709_10497577 3300005434 Bacteria 925
25 Ga0070714_100106686 3300005435 Bacteria 2475
26 Ga0070714_100632307 3300005435 Bacteria 1029
27 Ga0070713_100006029 3300005436 Bacteria 8350
28 Ga0070713_100020265 3300005436 Bacteria 5095
29 Ga0070713_100486124 3300005436 Bacteria 1163
30 Ga0070713_100689487 3300005436 Bacteria 975
31 Ga0070713_101096951 3300005436 Bacteria 769
32 Ga0070710_10004892 3300005437 Bacteria 6338
33 Ga0070710_10007397 3300005437 Bacteria 5316
34 Ga0070711_100358838 3300005439 Bacteria 1173
35 Ga0070678_100031723 3300005456 Bacteria 3649
36 Ga0070662_100019649 3300005457 Bacteria 4589
37 Ga0070681_10133416 3300005458 Bacteria 2414
38 Ga0070681_10145373 3300005458 Bacteria 2300
39 Ga0068867_100340806 3300005459 Bacteria 1248
40 Ga0070685_10144930 3300005466 Bacteria 1499
41 Ga0070706_100092289 3300005467 Unclassified 2809
42 Ga0070699_100608193 3300005518 Bacteria 997
43 Ga0070679_100104595 3300005530 Bacteria 2817
44 Ga0070684_100001137 3300005535 Bacteria 19108
45 Ga0070684_100001541 3300005535 Bacteria 16650
46 Ga0070684_100044955 3300005535 Bacteria 3822
47 Ga0070684_100485174 3300005535 Bacteria 1144
48 Ga0068853_100186616 3300005539 Bacteria 1882
49 Ga0070686_100534206 3300005544 Bacteria 915
50 Ga0070696_100494286 3300005546 Bacteria 972
51 Ga0070693_100186494 3300005547 Bacteria 1339
52 Ga0070665_100322862 3300005548 Bacteria 1548
53 Ga0070665_100499152 3300005548 Bacteria 1228
54 Ga0068857_100789246 3300005577 Bacteria 906
55 Ga0068856_100000183 3300005614 Bacteria 65005
56 Ga0068852_101080960 3300005616 Bacteria 822
57 Ga0068859_100107949 3300005617 Bacteria 2844
58 Ga0068864_100029244 3300005618 Bacteria 4664
59 Ga0068863_100014067 3300005841 Bacteria 7710
60 Ga0068863_100255283 3300005841 Bacteria 1694
61 Ga0068858_100224675 3300005842 Bacteria 1779
62 Ga0068860_100937450 3300005843 Bacteria 883
63 Ga0081539_10000003 3300005985 Bacteria 594833
64 Ga0081539_10003401 3300005985 Bacteria 19633
65 Ga0081539_10054554 3300005985 Bacteria 2230
66 Ga0070717_10000620 3300006028 Bacteria 22822
67 Ga0070717_10089663 3300006028 Bacteria 2594
68 Ga0070717_10096213 3300006028 Bacteria 2508
69 Ga0070717_10096261 3300006028 Bacteria 2507
70 Ga0070717_10309282 3300006028 Bacteria 1406
71 Ga0075363_100012256 3300006048 Bacteria 4128
72 Ga0075432_10066251 3300006058 Bacteria 1292
73 Ga0070715_10036714 3300006163 Bacteria 2023
74 Ga0070715_10192062 3300006163 Bacteria 1031
75 Ga0070716_100018019 3300006173 Bacteria 3673
76 Ga0070716_100331259 3300006173 Bacteria 1070
77 Ga0070712_100004971 3300006175 Bacteria 8224
78 Ga0070712_100355237 3300006175 Bacteria 1200
79 Ga0075362_10200926 3300006177 Unclassified 970
80 Ga0075367_10503454 3300006178 Bacteria 768
81 Ga0075369_10098186 3300006186 Unclassified 1312
82 Ga0068871_100029518 3300006358 Bacteria 4308
83 Ga0075428_100080372 3300006844 Bacteria 3558
84 Ga0068865_100335989 3300006881 Bacteria 1219
85 Ga0097620_100107941 3300006931 Bacteria 2844
86 Ga0099794_10082119 3300007265 Bacteria 1591
87 Ga0099794_10085915 3300007265 Bacteria 1557
88 Ga0099795_10014712 3300007788 Bacteria 2432
89 Ga0099795_10052784 3300007788 Bacteria 1486
90 Ga0105240_10771301 3300009093 Bacteria 1044
91 Ga0111539_10139723 3300009094 Bacteria 2836
92 Ga0105245_10050839 3300009098 Bacteria 3716
93 Ga0105245_10923085 3300009098 Bacteria 915
94 Ga0105245_11092148 3300009098 Bacteria 844
95 Ga0105247_10156712 3300009101 Bacteria 1505
96 Ga0105247_10226382 3300009101 Bacteria 1268
97 Ga0105241_10211344 3300009174 Bacteria 1626
98 Ga0105242_10145835 3300009176 Bacteria 2059
99 Ga0105248_10008738 3300009177 Bacteria 11126
100 Ga0105248_10031594 3300009177 Bacteria 5917
101 Ga0105237_10047065 3300009545 Bacteria 4336
102 Ga0105237_10118667 3300009545 Bacteria 2639
103 Ga0105237_10146791 3300009545 Bacteria 2354
104 Ga0105249_10498341 3300009553 Bacteria 1263
105 Ga0099796_10053169 3300010159 Bacteria 1412
106 Ga0105246_10377378 3300011119 Bacteria 1170
107 Ga0157370_10033790 3300013104 Bacteria 4984
108 Ga0157370_11142434 3300013104 Bacteria 703
109 Ga0157369_10002453 3300013105 Bacteria 22254
110 Ga0157369_10021884 3300013105 Bacteria 7146
111 Ga0157369_10068642 3300013105 Bacteria 3809
112 Ga0157369_11065505 3300013105 Unclassified 827
113 Ga0157378_10507905 3300013297 Bacteria 1205
114 Ga0163162_10122333 3300013306 Bacteria 2707
115 Ga0157372_10097620 3300013307 Bacteria 3351
116 Ga0157372_10291682 3300013307 Bacteria 1897
117 Ga0157372_10314234 3300013307 Bacteria 1824
118 Ga0157380_10594887 3300014326 Bacteria 1093
119 Ga0182008_10081611 3300014497 Bacteria 1591
120 Ga0157379_10298764 3300014968 Bacteria 1467
121 Ga0157376_10231454 3300014969 Bacteria 1717
122 Ga0182006_1000201 3300015261 Bacteria 61463
123 Ga0182007_10081637 3300015262 Bacteria 1061
124 Ga0163161_10025092 3300017792 Bacteria 4216
125 Ga0206353_11725562 3300020082 Bacteria 1118
126 Ga0207682_10085081 3300025893 Bacteria 1362
127 Ga0207692_10056745 3300025898 Bacteria 2010
128 Ga0207692_10142740 3300025898 Bacteria 1363
129 Ga0207642_10316615 3300025899 Bacteria 910
130 Ga0207710_10001695 3300025900 Bacteria 10686
131 Ga0207710_10113221 3300025900 Bacteria 1290
132 Ga0207685_10077418 3300025905 Bacteria 1366
133 Ga0207699_10133548 3300025906 Bacteria 1622
134 Ga0207699_10389096 3300025906 Bacteria 991
135 Ga0207645_10236147 3300025907 Bacteria 1207
136 Ga0207684_10041923 3300025910 Unclassified 3880
137 Ga0207684_10147282 3300025910 Bacteria 2025
138 Ga0207707_10007942 3300025912 Bacteria 9229
139 Ga0207707_10214007 3300025912 Bacteria 1678
140 Ga0207671_10052033 3300025914 Bacteria 3034
141 Ga0207671_10418075 3300025914 Bacteria 1067
142 Ga0207693_10009722 3300025915 Bacteria 7830
143 Ga0207693_10568330 3300025915 Bacteria 884
144 Ga0207663_10179273 3300025916 Bacteria 1512
145 Ga0207660_10002420 3300025917 Bacteria 12257
146 Ga0207660_10064050 3300025917 Bacteria 2652
147 Ga0207657_10001056 3300025919 Bacteria 29204
148 Ga0207649_10263837 3300025920 Unclassified 1246
149 Ga0207652_10020277 3300025921 Bacteria 5473
150 Ga0207694_10010992 3300025924 Bacteria 6837
151 Ga0207694_10083216 3300025924 Bacteria 2516
152 Ga0207694_10224263 3300025924 Bacteria 1534
153 Ga0207650_10542967 3300025925 Bacteria 974
154 Ga0207687_10153460 3300025927 Bacteria 1760
155 Ga0207700_10014731 3300025928 Bacteria 5132
156 Ga0207700_10470863 3300025928 Bacteria 1109
157 Ga0207664_10033662 3300025929 Bacteria 3940
158 Ga0207644_10280348 3300025931 Bacteria 1338
159 Ga0207706_10004468 3300025933 Bacteria 13134
160 Ga0207686_10284805 3300025934 Bacteria 1221
161 Ga0207669_10017954 3300025937 Bacteria 3643
162 Ga0207669_10595655 3300025937 Bacteria 898
163 Ga0207704_10067821 3300025938 Bacteria 2246
164 Ga0207665_10000194 3300025939 Bacteria 40747
165 Ga0207665_10018338 3300025939 Bacteria 4599
166 Ga0207665_10033456 3300025939 Bacteria 3407
167 Ga0207691_10067170 3300025940 Bacteria 3242
168 Ga0207661_10000876 3300025944 Bacteria 19798
169 Ga0207661_10000978 3300025944 Bacteria 18856
170 Ga0207679_10242760 3300025945 Unclassified 1527
171 Ga0207679_10484321 3300025945 Bacteria 1102
172 Ga0207651_10650371 3300025960 Bacteria 925
173 Ga0207658_10105140 3300025986 Bacteria 2220
174 Ga0207658_10746162 3300025986 Bacteria 886
175 Ga0207703_10119204 3300026035 Bacteria 2263
176 Ga0207678_10555752 3300026067 Bacteria 1004
177 Ga0207702_10000931 3300026078 Bacteria 30177
178 Ga0207641_10091990 3300026088 Bacteria 2656
179 Ga0207648_10036853 3300026089 Bacteria 4308
180 Ga0207676_10793772 3300026095 Bacteria 923
181 Ga0207674_10129270 3300026116 Bacteria 2490
182 Ga0207674_10231820 3300026116 Bacteria 1794
183 Ga0207674_10729956 3300026116 Bacteria 956
184 Ga0207683_10013948 3300026121 Bacteria 6853
185 Ga0209588_1002236 3300027671 Bacteria 5233
186 Ga0268265_10034669 3300028380 Bacteria 3681
187 Ga0268264_10000020 3300028381 Bacteria 483593
188 Ga0265318_10004229 3300028577 Bacteria 7005
189 Ga0307511_10027900 3300030521 Bacteria 5144
190 Ga0307511_10204401 3300030521 Unclassified 1019
191 Ga0265763_1012000 3300030763 Unclassified 821
192 Ga0265330_10004110 3300031235 Bacteria 7456
193 Ga0265330_10095378 3300031235 Unclassified 1275
194 Ga0265332_10006990 3300031238 Bacteria 5114
195 Ga0265332_10034822 3300031238 Bacteria 2188
196 Ga0265320_10015256 3300031240 Bacteria 4346
197 Ga0265325_10036484 3300031241 Bacteria 2603
198 Ga0265325_10045667 3300031241 Unclassified 2275
199 Ga0265325_10197846 3300031241 Bacteria 929
200 Ga0265329_10009312 3300031242 Bacteria 3670
201 Ga0265340_10001351 3300031247 Bacteria 14058
202 Ga0265340_10024123 3300031247 Bacteria 3091
203 Ga0265340_10112238 3300031247 Bacteria 1259
204 Ga0265339_10023622 3300031249 Bacteria 3552
205 Ga0265339_10041919 3300031249 Bacteria 2537
206 Ga0265339_10048863 3300031249 Bacteria 2318
207 Ga0265331_10037754 3300031250 Unclassified 2363
208 Ga0265331_10105071 3300031250 Bacteria 1297
209 Ga0265316_10087444 3300031344 Bacteria 2381
210 Ga0307509_10045936 3300031507 Bacteria 4704
211 Ga0307509_10458203 3300031507 Bacteria 968
212 Ga0265313_10016271 3300031595 Bacteria 4283
213 Ga0307508_10000025 3300031616 Bacteria 174642
214 Ga0307508_10454209 3300031616 Bacteria 874
215 Ga0265314_10001458 3300031711 Bacteria 26393
216 Ga0265314_10035914 3300031711 Bacteria 3609
217 Ga0265314_10057494 3300031711 Bacteria 2670
218 Ga0265314_10058265 3300031711 Bacteria 2647
219 Ga0265342_10007270 3300031712 Bacteria 8131
220 Ga0265342_10014256 3300031712 Bacteria 5284
221 Ga0265342_10014569 3300031712 Bacteria 5215
222 Ga0265342_10068648 3300031712 Bacteria 2071
223 Ga0265342_10197650 3300031712 Bacteria 1094
224 Ga0307516_10124744 3300031730 Bacteria 2361
225 Ga0307507_10092036 3300033179 Bacteria 2591
226 Ga0307510_10025977 3300033180 Bacteria 6744
227 Ga0316214_1031211 3300033545 Bacteria 757
228 Ga0373934_0024897 3300035086 Bacteria 2315
229 Ga0373934_0033694 3300035086 Bacteria 2011
230 Ga0373923_0020395 3300035111 Bacteria 2575
231 Ga0373923_0031289 3300035111 Bacteria 2144
232 Ga0373936_0243095 3300035113 Bacteria 802
233 Ga0373953_0038429 3300035117 Bacteria 1893
234 Ga0373954_0009900 3300035118 Bacteria 4198
235 Ga0373954_0014357 3300035118 Bacteria 3532
236 Ga0373954_0048897 3300035118 Bacteria 1982
237 Ga0373954_0091960 3300035118 Bacteria 1457
238 Ga0373956_0001688 3300035119 Bacteria 9097
239 Ga0373956_0047986 3300035119 Bacteria 1912
240 Ga0373957_0008815 3300035120 Bacteria 3285
241 Ga0373943_0002726 3300035170 Bacteria 8032
242 Ga0373943_0040217 3300035170 Bacteria 2257
243 Ga0373943_0146095 3300035170 Bacteria 1278
244 Ga0373946_0163375 3300035171 Bacteria 1047
245 Ga0373955_0009336 3300035172 Bacteria 4593
246 Ga0373955_0024145 3300035172 Bacteria 3105
247 Ga0373924_0020354 3300035410 Bacteria 2578
248 Ga0373935_0012434 3300035692 Bacteria 5120
249 Ga0373935_0034615 3300035692 Bacteria 3149
250 Ga0373935_0090502 3300035692 Bacteria 2002
251 Ga0373935_0258083 3300035692 Bacteria 1222
252 Ga0373927_0007505 3300035695 Bacteria 7374
253 Ga0373927_0089688 3300035695 Bacteria 1996
254 Ga0373927_0172474 3300035695 Bacteria 1418
255 Ga0373933_0058851 3300035724 Bacteria 2312
256 Ga0373933_0198735 3300035724 Bacteria 1282
257 Ga0373933_0566613 3300035724 Bacteria 745
258 Ga0373947_0027463 3300035725 Bacteria 3331
259 Ga0373947_0034020 3300035725 Bacteria 3013
260 Ga0373937_0310475 3300036401 Bacteria 1491
261 Ga0373937_0421699 3300036401 Bacteria 1266
262 Ga0372808_010158 3300036459 Bacteria 1321
263 Ga0373925_0003409 3300037068 Bacteria 12313
264 Ga0373925_0006116 3300037068 Bacteria 8897
265 Ga0373925_0014687 3300037068 Bacteria 5657
266 Ga0373925_0103712 3300037068 Bacteria 2189
267 Ga0395898_0051658 3300037466 Bacteria 4019
268 Ga0395901_0017612 3300038443 Bacteria 7295
269 Ga0436365_0711862 3300039437 Bacteria 1324
270 Ga0436365_1916011 3300039437 Bacteria 1566
271 Ga0439453_0005302 3300041408 Bacteria 1957
272 Ga0451853_1042173 3300041512 Bacteria 906
273 Ga0439441_028703 3300042001 Bacteria 1068
274 Ga0439443_003736 3300042003 Bacteria 1944
275 Ga0439435_0002197 3300042436 Bacteria 3816
276 Ga0450893_0045704 3300042532 Bacteria 811
277 Ga0451577_0716942 3300042876 Bacteria 905
278 Ga0466969_0104477 3300044656 Unclassified 1331
279 Ga0451576_0645680 3300045051 Bacteria 1112
280 Ga0495592_0028627 3300046454 Bacteria 4218
281 Ga0495592_0106207 3300046454 Bacteria 1993
282 Ga0495603_0007837 3300046455 Bacteria 6438
283 Ga0495603_0121928 3300046455 Bacteria 1519
284 Ga0495591_039184 3300046458 Bacteria 1360
285 Ga0495629_0001252 3300046459 Bacteria 19953
286 Ga0495629_0012160 3300046459 Bacteria 6237
287 Ga0495629_0080952 3300046459 Bacteria 2267
288 Ga0495638_0011046 3300046460 Bacteria 6240
289 Ga0495641_0010413 3300046461 Bacteria 5391
290 Ga0495651_0006647 3300046462 Bacteria 8839
291 Ga0495651_0030811 3300046462 Bacteria 4182
292 Ga0495651_0290736 3300046462 Bacteria 1100
293 Ga0495653_0024002 3300046463 Bacteria 4919
294 Ga0495653_0160811 3300046463 Bacteria 1559
295 Ga0495653_0246764 3300046463 Bacteria 1187
296 Ga0495580_0006686 3300046472 Bacteria 9359
297 Ga0495582_0002066 3300046473 Bacteria 11239
298 Ga0495605_0302543 3300046474 Bacteria 676
299 Ga0495639_0001991 3300046475 Bacteria 9054
300 Ga0495639_0012023 3300046475 Bacteria 3732
301 Ga0495662_0005330 3300046476 Bacteria 6442
302 Ga0495662_0080125 3300046476 Bacteria 1588
303 Ga0495664_0018547 3300046477 Bacteria 3989
304 Ga0495664_0063286 3300046477 Bacteria 2204
305 Ga0495585_0005773 3300046492 Bacteria 7764
306 Ga0495594_0003206 3300046499 Bacteria 8474
307 Ga0495594_0055287 3300046499 Bacteria 2188
308 Ga0495607_0038687 3300046501 Bacteria 2856
309 Ga0495606_0221165 3300046507 Bacteria 1067
310 Ga0495608_0017922 3300046511 Bacteria 4894
311 Ga0495608_0084528 3300046511 Bacteria 2058
312 Ga0495608_0118470 3300046511 Bacteria 1699
313 Ga0495610_0016363 3300046512 Bacteria 4273
314 Ga0495618_0087277 3300046514 Bacteria 1995
315 Ga0495618_0093764 3300046514 Bacteria 1920
316 Ga0495628_0021805 3300046516 Bacteria 5263
317 Ga0495628_0039096 3300046516 Bacteria 3795
318 Ga0495630_0011449 3300046517 Bacteria 6423
319 Ga0495630_0224816 3300046517 Bacteria 1433
320 Ga0495644_0027970 3300046523 Bacteria 2135
321 Ga0495663_0055070 3300046525 Bacteria 1240
322 Ga0495652_0025892 3300046529 Bacteria 5183
323 Ga0495652_0031736 3300046529 Bacteria 4623
324 Ga0495652_0103850 3300046529 Bacteria 2299
325 Ga0495665_0002799 3300046531 Bacteria 9412
326 Ga0495665_0055444 3300046531 Bacteria 2093
327 Ga0495640_0006125 3300046533 Bacteria 9533
328 Ga0495640_0065023 3300046533 Bacteria 2464
329 Ga0495640_0372983 3300046533 Bacteria 879
330 Ga0495586_0360568 3300046535 Unclassified 835
331 Ga0495587_0078629 3300046536 Bacteria 1913
332 Ga0495598_0076300 3300046537 Bacteria 1066
333 Ga0495621_0022303 3300046539 Bacteria 2097
334 Ga0495621_0030071 3300046539 Bacteria 1855
335 Ga0495645_0002070 3300046543 Bacteria 13648
336 Ga0495645_0030179 3300046543 Bacteria 3948
337 Ga0495622_0003052 3300046557 Bacteria 7949
338 Ga0495622_0026781 3300046557 Bacteria 2691
339 Ga0495633_0002841 3300046558 Bacteria 11923
340 Ga0495667_0006925 3300046559 Bacteria 7689
341 Ga0495667_0022397 3300046559 Bacteria 4256
342 Ga0495656_0042639 3300046615 Bacteria 1901
343 Ga0495634_0005305 3300046642 Bacteria 9947
344 Ga0495634_0016983 3300046642 Bacteria 5199
345 Ga0495634_0118677 3300046642 Bacteria 1695
346 Ga0495611_0015773 3300046648 Bacteria 3229
347 Ga0495635_0001193 3300046663 Bacteria 17302
348 Ga0495635_0020068 3300046663 Bacteria 4657
349 Ga0495588_0011562 3300046674 Bacteria 4146
350 Ga0495657_0128742 3300046675 Bacteria 1587
351 Ga0495599_0025814 3300046678 Bacteria 3680
352 Ga0495599_0028560 3300046678 Bacteria 3497
353 Ga0495623_0043179 3300046679 Bacteria 2869
354 Ga0495623_0173133 3300046679 Bacteria 1259
355 Ga0495646_0012137 3300046680 Bacteria 5477
356 Ga0495646_0047397 3300046680 Bacteria 2616
357 Ga0495646_0104727 3300046680 Bacteria 1617
358 Ga0495647_0003931 3300046681 Bacteria 4795
359 Ga0495647_0005047 3300046681 Bacteria 4320
360 Ga0495658_0001671 3300046683 Bacteria 11547
361 Ga0495613_0022696 3300046689 Bacteria 4675
362 Ga0495613_0065511 3300046689 Bacteria 2655
363 Ga0495624_0034993 3300046690 Bacteria 3245
364 Ga0495600_0010221 3300046809 Bacteria 5816
365 Ga0495600_0100867 3300046809 Bacteria 1882
366 Ga0495581_0001954 3300047315 Bacteria 11537
367 Ga0495581_0064251 3300047315 Bacteria 2120
368 Ga0495581_0175428 3300047315 Bacteria 1253
369 Ga0495604_0023640 3300047317 Bacteria 4904
370 Ga0495674_0009015 3300047319 Bacteria 9480
371 Ga0495674_0172795 3300047319 Bacteria 1802
372 Ga0495674_0414001 3300047319 Bacteria 1087
373 Ga0495676_0009448 3300047321 Bacteria 8881
374 Ga0495676_0135087 3300047321 Bacteria 1775
375 Ga0495680_0038379 3300047322 Bacteria 3827
376 Ga0495680_0057657 3300047322 Bacteria 3002
377 Ga0495677_0018444 3300047445 Bacteria 2530
378 Ga0495684_0000835 3300047471 Bacteria 24958
379 Ga0495684_0005632 3300047471 Bacteria 9760
380 Ga0495684_0115423 3300047471 Bacteria 2024
381 Ga0495686_0025256 3300047472 Bacteria 3897
382 Ga0495593_0008170 3300047673 Bacteria 6087
383 Ga0495593_0030902 3300047673 Bacteria 2928
384 Ga0495593_0044632 3300047673 Bacteria 2370
385 Ga0495614_0016153 3300048089 Bacteria 3251
386 Ga0495614_0062846 3300048089 Bacteria 1596
387 Ga0496104_0109451 3300048907 Bacteria 2648
388 Ga0496106_0008279 3300048909 Bacteria 7695
389 Ga0496108_0061781 3300048911 Bacteria 3154
390 Ga0496111_0137234 3300048914 Bacteria 1812
391 Ga0496111_0189930 3300048914 Bacteria 1527
392 Ga0496112_0000039 3300048915 Bacteria 91123
393 Ga0496112_0642987 3300048915 Unclassified 991
394 Ga0496113_0241128 3300048916 Bacteria 1442
395 Ga0496115_0005640 3300048918 Bacteria 9108
396 Ga0496115_0147567 3300048918 Bacteria 1942
397 Ga0496115_0304294 3300048918 Bacteria 1306
398 Ga0496115_0637224 3300048918 Bacteria 844
399 Ga0496117_0016587 3300048920 Bacteria 6206
400 Ga0496118_0022704 3300048921 Bacteria 5474
401 Ga0496119_0147750 3300048922 Bacteria 1263
402 Ga0496120_0010640 3300048923 Bacteria 6395
403 Ga0496121_0007078 3300048924 Bacteria 13619
404 Ga0496121_0010211 3300048924 Bacteria 10628
405 Ga0496121_0122484 3300048924 Bacteria 1961
406 Ga0496124_0103662 3300048927 Bacteria 2301
407 Ga0496126_0033909 3300048929 Bacteria 4801
408 Ga0496126_0038185 3300048929 Bacteria 4470
409 Ga0496126_0038554 3300048929 Bacteria 4445
410 Ga0496126_0203395 3300048929 Bacteria 1671
411 Ga0496126_0225773 3300048929 Bacteria 1571
412 Ga0501070_0006733 3300049586 Bacteria 9786
413 nmdc:mga03683_183285_c1 3300050489 Unclassified 956
414 nmdc:mga03n38_3743_c1 3300050490 Unclassified 2165
415 nmdc:mga06z11_155617_c1 3300050494 Unclassified 1303
416 nmdc:mga08y16_257293_c1 3300050511 Bacteria 1803
417 Ga0495601_0043976 3300053077 Bacteria 2807
418 Ga0495595_0011892 3300053084 Bacteria 3648
419 Ga0495619_0017649 3300053085 Bacteria 4521
420 Ga0495619_0029783 3300053085 Bacteria 3529
421 Ga0500647_0058772 3300053091 Bacteria 1849
422 Ga0500647_0161224 3300053091 Bacteria 1041
423 Ga0500566_0000075 3300053094 Bacteria 48255
424 Ga0500566_0000166 3300053094 Bacteria 33843
425 Ga0500640_016561 3300053095 Bacteria 3111
426 Ga0500641_0003170 3300053096 Bacteria 5818
427 Ga0500554_006995 3300053102 Bacteria 2570
428 Ga0500556_0005119 3300053104 Bacteria 3709
429 Ga0500569_034032 3300053109 Bacteria 1452
430 Ga0500572_000975 3300053111 Bacteria 8675
431 Ga0500595_010972 3300053119 Bacteria 3572
432 Ga0500614_001306 3300053123 Bacteria 6016
433 Ga0500626_226350 3300053128 Bacteria 716
434 Ga0500652_000016 3300053131 Bacteria 126768
435 Ga0500559_0006018 3300053136 Bacteria 5505
436 Ga0500559_0152326 3300053136 Unclassified 1085
437 Ga0500568_0000057 3300053139 Bacteria 109287
438 Ga0500573_0008366 3300053140 Bacteria 5697
439 Ga0500590_135826 3300053148 Unclassified 1131
440 Ga0500603_000053 3300053150 Bacteria 28532
441 Ga0500603_000124 3300053150 Bacteria 18201
442 Ga0500603_032035 3300053150 Bacteria 1361
443 Ga0500616_0030579 3300053153 Bacteria 2956
444 Ga0500630_000448 3300053159 Bacteria 17947
445 Ga0500638_094098 3300053162 Bacteria 1407
446 Ga0500639_000309 3300053163 Bacteria 24089
447 Ga0500636_0102253 3300053177 Bacteria 1627
448 Ga0500637_0000181 3300053178 Bacteria 23527
449 Ga0500596_002917 3300053735 Bacteria 3314
450 Ga0500599_002419 3300053736 Bacteria 2238
451 Ga0501082_0000008 3300060353 Bacteria 125977
452 3005713080 3005710791 Bacteria 7622528
453 8006932387 8006926726 Bacteria 6749210
454 Ga0496106_0157071
455 JGI25406J46586_10000019
456 rootL2_10341808
457 rootH1_10015906
458 Ga0065715_10126737
459 Ga0070658_10202564
460 Ga0070683_100001350
461 Ga0070690_100585510
462 Ga0070677_10094007
463 Ga0070680_100004381
464 Ga0070680_100005784
465 Ga0068868_100164526
466 Ga0070660_100006367
467 Ga0070689_100028949
468 Ga0070661_100184804
469 Ga0070661_100334649
470 Ga0070669_100072671
471 Ga0070675_100654712
472 Ga0070671_100507043
473 Ga0070674_100009522
474 Ga0070673_100461258
475 Ga0070667_100725939
476 Ga0070709_10239670
477 Ga0070709_10497577
478 Ga0070714_100106686
479 Ga0070714_100632307
480 Ga0070713_100006029
481 Ga0070713_100020265
482 Ga0070713_100486124
483 Ga0070713_100689487
484 Ga0070713_101096951
485 Ga0070710_10004892
486 Ga0070710_10007397
487 Ga0070711_100358838
488 Ga0070678_100031723
489 Ga0070662_100019649
490 Ga0070681_10133416
491 Ga0070681_10145373
492 Ga0068867_100340806
493 Ga0070685_10144930
494 Ga0070706_100092289
495 Ga0070699_100608193
496 Ga0070679_100104595
497 Ga0070684_100001137
498 Ga0070684_100001541
499 Ga0070684_100044955
500 Ga0070684_100485174
501 Ga0068853_100186616
502 Ga0070686_100534206
503 Ga0070696_100494286
504 Ga0070693_100186494
505 Ga0070665_100322862
506 Ga0070665_100499152
507 Ga0068857_100789246
508 Ga0068856_100000183
509 Ga0068852_101080960
510 Ga0068859_100107949
511 Ga0068864_100029244
512 Ga0068863_100014067
513 Ga0068863_100255283
514 Ga0068858_100224675
515 Ga0068860_100937450
516 Ga0081539_10000003
517 Ga0081539_10003401
518 Ga0081539_10054554
519 Ga0070717_10000620
520 Ga0070717_10089663
521 Ga0070717_10096213
522 Ga0070717_10096261
523 Ga0070717_10309282
524 Ga0075363_100012256
525 Ga0075432_10066251
526 Ga0070715_10036714
527 Ga0070715_10192062
528 Ga0070716_100018019
529 Ga0070716_100331259
530 Ga0070712_100004971
531 Ga0070712_100355237
532 Ga0075362_10200926
533 Ga0075367_10503454
534 Ga0075369_10098186
535 Ga0068871_100029518
536 Ga0075428_100080372
537 Ga0068865_100335989
538 Ga0097620_100107941
539 Ga0099794_10082119
540 Ga0099794_10085915
541 Ga0099795_10014712
542 Ga0099795_10052784
543 Ga0105240_10771301
544 Ga0111539_10139723
545 Ga0105245_10050839
546 Ga0105245_10923085
547 Ga0105245_11092148
548 Ga0105247_10156712
549 Ga0105247_10226382
550 Ga0105241_10211344
551 Ga0105242_10145835
552 Ga0105248_10008738
553 Ga0105248_10031594
554 Ga0105237_10047065
555 Ga0105237_10118667
556 Ga0105237_10146791
557 Ga0105249_10498341
558 Ga0099796_10053169
559 Ga0105246_10377378
560 Ga0157370_10033790
561 Ga0157370_11142434
562 Ga0157369_10002453
563 Ga0157369_10021884
564 Ga0157369_10068642
565 Ga0157369_11065505
566 Ga0157378_10507905
567 Ga0163162_10122333
568 Ga0157372_10097620
569 Ga0157372_10291682
570 Ga0157372_10314234
571 Ga0157380_10594887
572 Ga0182008_10081611
573 Ga0157379_10298764
574 Ga0157376_10231454
575 Ga0182006_1000201
576 Ga0182007_10081637
577 Ga0163161_10025092
578 Ga0206353_11725562
579 Ga0207682_10085081
580 Ga0207692_10056745
581 Ga0207692_10142740
582 Ga0207642_10316615
583 Ga0207710_10001695
584 Ga0207710_10113221
585 Ga0207685_10077418
586 Ga0207699_10133548
587 Ga0207699_10389096
588 Ga0207645_10236147
589 Ga0207684_10041923
590 Ga0207684_10147282
591 Ga0207707_10007942
592 Ga0207707_10214007
593 Ga0207671_10052033
594 Ga0207671_10418075
595 Ga0207693_10009722
596 Ga0207693_10568330
597 Ga0207663_10179273
598 Ga0207660_10002420
599 Ga0207660_10064050
600 Ga0207657_10001056
601 Ga0207649_10263837
602 Ga0207652_10020277
603 Ga0207694_10010992
604 Ga0207694_10083216
605 Ga0207694_10224263
606 Ga0207650_10542967
607 Ga0207687_10153460
608 Ga0207700_10014731
609 Ga0207700_10470863
610 Ga0207664_10033662
611 Ga0207644_10280348
612 Ga0207706_10004468
613 Ga0207686_10284805
614 Ga0207669_10017954
615 Ga0207669_10595655
616 Ga0207704_10067821
617 Ga0207665_10000194
618 Ga0207665_10018338
619 Ga0207665_10033456
620 Ga0207691_10067170
621 Ga0207661_10000876
622 Ga0207661_10000978
623 Ga0207679_10242760
624 Ga0207679_10484321
625 Ga0207651_10650371
626 Ga0207658_10105140
627 Ga0207658_10746162
628 Ga0207703_10119204
629 Ga0207678_10555752
630 Ga0207702_10000931
631 Ga0207641_10091990
632 Ga0207648_10036853
633 Ga0207676_10793772
634 Ga0207674_10129270
635 Ga0207674_10231820
636 Ga0207674_10729956
637 Ga0207683_10013948
638 Ga0209588_1002236
639 Ga0268265_10034669
640 Ga0268264_10000020
641 Ga0265318_10004229
642 Ga0307511_10027900
643 Ga0307511_10204401
644 Ga0265763_1012000
645 Ga0265330_10004110
646 Ga0265330_10095378
647 Ga0265332_10006990
648 Ga0265332_10034822
649 Ga0265320_10015256
650 Ga0265325_10036484
651 Ga0265325_10045667
652 Ga0265325_10197846
653 Ga0265329_10009312
654 Ga0265340_10001351
655 Ga0265340_10024123
656 Ga0265340_10112238
657 Ga0265339_10023622
658 Ga0265339_10041919
659 Ga0265339_10048863
660 Ga0265331_10037754
661 Ga0265331_10105071
662 Ga0265316_10087444
663 Ga0307509_10045936
664 Ga0307509_10458203
665 Ga0265313_10016271
666 Ga0307508_10000025
667 Ga0307508_10454209
668 Ga0265314_10001458
669 Ga0265314_10035914
670 Ga0265314_10057494
671 Ga0265314_10058265
672 Ga0265342_10007270
673 Ga0265342_10014256
674 Ga0265342_10014569
675 Ga0265342_10068648
676 Ga0265342_10197650
677 Ga0307516_10124744
678 Ga0307507_10092036
679 Ga0307510_10025977
680 Ga0316214_1031211
681 Ga0373934_0024897
682 Ga0373934_0033694
683 Ga0373923_0020395
684 Ga0373923_0031289
685 Ga0373936_0243095
686 Ga0373953_0038429
687 Ga0373954_0009900
688 Ga0373954_0014357
689 Ga0373954_0048897
690 Ga0373954_0091960
691 Ga0373956_0001688
692 Ga0373956_0047986
693 Ga0373957_0008815
694 Ga0373943_0002726
695 Ga0373943_0040217
696 Ga0373943_0146095
697 Ga0373946_0163375
698 Ga0373955_0009336
699 Ga0373955_0024145
700 Ga0373924_0020354
701 Ga0373935_0012434
702 Ga0373935_0034615
703 Ga0373935_0090502
704 Ga0373935_0258083
705 Ga0373927_0007505
706 Ga0373927_0089688
707 Ga0373927_0172474
708 Ga0373933_0058851
709 Ga0373933_0198735
710 Ga0373933_0566613
711 Ga0373947_0027463
712 Ga0373947_0034020
713 Ga0373937_0310475
714 Ga0373937_0421699
715 Ga0372808_010158
716 Ga0373925_0003409
717 Ga0373925_0006116
718 Ga0373925_0014687
719 Ga0373925_0103712
720 Ga0395898_0051658
721 Ga0395901_0017612
722 Ga0436365_0711862
723 Ga0436365_1916011
724 Ga0439453_0005302
725 Ga0451853_1042173
726 Ga0439441_028703
727 Ga0439443_003736
728 Ga0439435_0002197
729 Ga0450893_0045704
730 Ga0451577_0716942
731 Ga0466969_0104477
732 Ga0451576_0645680
733 Ga0495592_0028627
734 Ga0495592_0106207
735 Ga0495603_0007837
736 Ga0495603_0121928
737 Ga0495591_039184
738 Ga0495629_0001252
739 Ga0495629_0012160
740 Ga0495629_0080952
741 Ga0495638_0011046
742 Ga0495641_0010413
743 Ga0495651_0006647
744 Ga0495651_0030811
745 Ga0495651_0290736
746 Ga0495653_0024002
747 Ga0495653_0160811
748 Ga0495653_0246764
749 Ga0495580_0006686
750 Ga0495582_0002066
751 Ga0495605_0302543
752 Ga0495639_0001991
753 Ga0495639_0012023
754 Ga0495662_0005330
755 Ga0495662_0080125
756 Ga0495664_0018547
757 Ga0495664_0063286
758 Ga0495585_0005773
759 Ga0495594_0003206
760 Ga0495594_0055287
761 Ga0495607_0038687
762 Ga0495606_0221165
763 Ga0495608_0017922
764 Ga0495608_0084528
765 Ga0495608_0118470
766 Ga0495610_0016363
767 Ga0495618_0087277
768 Ga0495618_0093764
769 Ga0495628_0021805
770 Ga0495628_0039096
771 Ga0495630_0011449
772 Ga0495630_0224816
773 Ga0495644_0027970
774 Ga0495663_0055070
775 Ga0495652_0025892
776 Ga0495652_0031736
777 Ga0495652_0103850
778 Ga0495665_0002799
779 Ga0495665_0055444
780 Ga0495640_0006125
781 Ga0495640_0065023
782 Ga0495640_0372983
783 Ga0495586_0360568
784 Ga0495587_0078629
785 Ga0495598_0076300
786 Ga0495621_0022303
787 Ga0495621_0030071
788 Ga0495645_0002070
789 Ga0495645_0030179
790 Ga0495622_0003052
791 Ga0495622_0026781
792 Ga0495633_0002841
793 Ga0495667_0006925
794 Ga0495667_0022397
795 Ga0495656_0042639
796 Ga0495634_0005305
797 Ga0495634_0016983
798 Ga0495634_0118677
799 Ga0495611_0015773
800 Ga0495635_0001193
801 Ga0495635_0020068
802 Ga0495588_0011562
803 Ga0495657_0128742
804 Ga0495599_0025814
805 Ga0495599_0028560
806 Ga0495623_0043179
807 Ga0495623_0173133
808 Ga0495646_0012137
809 Ga0495646_0047397
810 Ga0495646_0104727
811 Ga0495647_0003931
812 Ga0495647_0005047
813 Ga0495658_0001671
814 Ga0495613_0022696
815 Ga0495613_0065511
816 Ga0495624_0034993
817 Ga0495600_0010221
818 Ga0495600_0100867
819 Ga0495581_0001954
820 Ga0495581_0064251
821 Ga0495581_0175428
822 Ga0495604_0023640
823 Ga0495674_0009015
824 Ga0495674_0172795
825 Ga0495674_0414001
826 Ga0495676_0009448
827 Ga0495676_0135087
828 Ga0495680_0038379
829 Ga0495680_0057657
830 Ga0495677_0018444
831 Ga0495684_0000835
832 Ga0495684_0005632
833 Ga0495684_0115423
834 Ga0495686_0025256
835 Ga0495593_0008170
836 Ga0495593_0030902
837 Ga0495593_0044632
838 Ga0495614_0016153
839 Ga0495614_0062846
840 Ga0496104_0109451
841 Ga0496106_0008279
842 Ga0496108_0061781
843 Ga0496111_0137234
844 Ga0496111_0189930
845 Ga0496112_0000039
846 Ga0496112_0642987
847 Ga0496113_0241128
848 Ga0496115_0005640
849 Ga0496115_0147567
850 Ga0496115_0304294
851 Ga0496115_0637224
852 Ga0496117_0016587
853 Ga0496118_0022704
854 Ga0496119_0147750
855 Ga0496120_0010640
856 Ga0496121_0007078
857 Ga0496121_0010211
858 Ga0496121_0122484
859 Ga0496124_0103662
860 Ga0496126_0033909
861 Ga0496126_0038185
862 Ga0496126_0038554
863 Ga0496126_0203395
864 Ga0496126_0225773
865 Ga0501070_0006733
866 nmdc:mga03683_183285_c1
867 nmdc:mga03n38_3743_c1
868 nmdc:mga06z11_155617_c1
869 nmdc:mga08y16_257293_c1
870 Ga0495601_0043976
871 Ga0495595_0011892
872 Ga0495619_0017649
873 Ga0495619_0029783
874 Ga0500647_0058772
875 Ga0500647_0161224
876 Ga0500566_0000075
877 Ga0500566_0000166
878 Ga0500640_016561
879 Ga0500641_0003170
880 Ga0500554_006995
881 Ga0500556_0005119
882 Ga0500569_034032
883 Ga0500572_000975
884 Ga0500595_010972
885 Ga0500614_001306
886 Ga0500626_226350
887 Ga0500652_000016
888 Ga0500559_0006018
889 Ga0500559_0152326
890 Ga0500568_0000057
891 Ga0500573_0008366
892 Ga0500590_135826
893 Ga0500603_000053
894 Ga0500603_000124
895 Ga0500603_032035
896 Ga0500616_0030579
897 Ga0500630_000448
898 Ga0500638_094098
899 Ga0500639_000309
900 Ga0500636_0102253
901 Ga0500637_0000181
902 Ga0500596_002917
903 Ga0500599_002419
904 Ga0501082_0000008
905 3005713080
906 8006932387

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

25

100

0.97

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

34

101

0.93

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

29

106

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jl4-assembly1.cif.gz_B holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class 0.9469 4 210
4pxo-assembly1.cif.gz_B crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068) 0.9396 4 211
3niv-assembly1.cif.gz_B the crystal structure of glutathione s-transferase from legionella pneumophila 0.9292 4 206
3niv-assembly2.cif.gz_D the crystal structure of glutathione s-transferase from legionella pneumophila 0.9273 4 208
1fw1-assembly1.cif.gz_A-2 glutathione transferase zeta/maleylacetoacetate isomerase 0.9266 3 212
ID Description Score Start End Superfamily
af_B8A514_42_123_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9661 2 76 3.40.30.10
4yh2C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9644 3 78 3.40.30.10
4pxoB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.96 6 78 3.40.30.10
af_K7TUZ4_3_77_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9597 3 65 3.40.30.10
3zmkC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9566 3 78 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A429MKP1-F1-model_v4 Maleylacetoacetate isomerase 0.9755 4 98 GO:0004364
GO:0006559
GO:0006749
GO:0016034
AF-A0A438JAI0-F1-model_v4 Glutathione S-transferase zeta class 0.9745 2 93 GO:0016740
AF-A0A7Y1Z2B7-F1-model_v4 Maleylacetoacetate isomerase (EC 5.2.1.2) 0.9589 4 212 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
AF-A0A128F930-F1-model_v4 Maleylpyruvate isomerase (EC 5.2.1.4) 0.9576 4 209 GO:0004364
GO:0005737
GO:0006559
GO:0006749
GO:0016034
GO:0050077
AF-A0A7J9MFQ6-F1-model_v4 GST N-terminal domain-containing protein 0.9571 2 113 GO:0004364
GO:0006559
GO:0006749
GO:0016034

Map