F447278

General Info

Members Datasets Scaffolds Average Seq Length
453 222 442 64

Family's Representative Sequence

Representative Sequence 3300049679|Ga0501249_006731|Ga0501249_006731_519_740
Length 73
Sequence MASPGKKAYPLRIDPALWEELQRLAARDLRSVNAEIEFLLREGLARRGVKMKDDKSNDEDVESGELPDGSTKT

Samples

Sample ID Description Type Environment
1 2643221645 Massilia sp. Root351 Isolate Unclassified
2 2643221664 Massilia sp. Root418 Isolate Unclassified
3 2643221684 Massilia sp. Root133 Isolate Unclassified
4 2738541280 Massilia sp. GV090 Isolate Unclassified
5 2738541300 Massilia sp. GV016 Isolate Unclassified
6 2738543018 Massilia sp. GV045 Isolate Unclassified
7 2738543030 Massilia sp. GV097 Isolate Unclassified
8 2857553236 Duganella sp. R-74557 Isolate Unclassified
9 2857558681 Duganella sp. R-74565 Isolate Unclassified
10 2904424332 Duganella sp. 1411 Isolate Rhizosphere
11 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
12 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
13 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
14 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
15 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
16 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
23 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
37 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
38 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
41 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
54 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
55 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
56 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
57 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
58 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
64 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
87 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
88 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
89 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
90 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
91 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
92 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
93 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
94 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
95 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
96 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
97 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
98 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
99 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
100 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
101 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
102 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
103 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
104 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
105 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
106 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
107 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
108 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
109 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
110 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
111 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
116 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
117 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
118 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
119 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
120 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
121 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
122 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
123 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
124 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
130 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
131 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
132 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
135 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
136 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
137 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
138 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
139 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
140 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
141 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
142 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
145 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
146 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
147 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
148 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
151 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
155 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
159 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
160 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
163 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
164 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
165 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
166 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
167 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
168 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
169 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
170 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
171 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
172 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
175 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
182 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
185 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
186 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
189 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
204 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
205 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
209 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
211 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
212 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
213 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
214 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
215 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
219 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
220 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
222 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.13
Metatranscriptomes 0.44
Isolates 2.43

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.06
Nodule 0.22
Rhizoplane 4.86
Rhizosphere 82.78
Stem 0
Stem Tuber 0
Unclassified 5.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25158J39367_1005056 3300002739 Bacteria 1949
2 JGI25159J45721_1003893 3300002987 Bacteria 5104
3 rootL2_10143385 3300003322 Bacteria 2225
4 JGI25161J50226_1000542 3300003374 Bacteria 16111
5 Ga0055525_1000025 3300003759 Bacteria 347582
6 Ga0055542_1028482 3300003762 Bacteria 735
7 Ga0055526_1000514 3300003771 Bacteria 30863
8 Ga0055526_1046184 3300003771 Bacteria 1034
9 Ga0055537_1000098 3300003773 Bacteria 65302
10 Ga0055524_1024990 3300003775 Bacteria 1880
11 Ga0055534_1000009 3300003784 Bacteria 210256
12 Ga0055528_1000012 3300003790 Bacteria 182704
13 Ga0055543_1000760 3300004625 Bacteria 16149
14 Ga0055543_1012413 3300004625 Bacteria 1714
15 Ga0065165_1000051 3300005262 Bacteria 194844
16 Ga0065165_1003498 3300005262 Bacteria 10938
17 Ga0065165_1009472 3300005262 Bacteria 4362
18 Ga0070658_10256422 3300005327 Bacteria 1484
19 Ga0070658_10524302 3300005327 Bacteria 1024
20 Ga0070658_11510117 3300005327 Bacteria 582
21 Ga0070658_11588707 3300005327 Bacteria 567
22 Ga0070658_11610997 3300005327 Bacteria 562
23 Ga0070666_11185908 3300005335 Bacteria 569
24 Ga0070660_100015265 3300005339 Bacteria 5542
25 Ga0070660_100379049 3300005339 Bacteria 1167
26 Ga0070659_100090707 3300005366 Bacteria 2449
27 Ga0070663_100813119 3300005455 Bacteria 802
28 Ga0070663_101316059 3300005455 Bacteria 638
29 Ga0070662_100214420 3300005457 Bacteria 1533
30 Ga0070662_100282156 3300005457 Bacteria 1344
31 Ga0070662_100294257 3300005457 Bacteria 1317
32 Ga0068867_100629880 3300005459 Bacteria 939
33 Ga0068855_100035470 3300005563 Bacteria 5940
34 Ga0068855_100213646 3300005563 Bacteria 2166
35 Ga0070664_100234045 3300005564 Bacteria 1647
36 Ga0070664_102403498 3300005564 Bacteria 500
37 Ga0068857_102457908 3300005577 Bacteria 511
38 Ga0068856_100324739 3300005614 Bacteria 1556
39 Ga0068852_100333508 3300005616 Bacteria 1476
40 Ga0075362_10072624 3300006177 Bacteria 1574
41 Ga0079104_1004117 3300006946 Bacteria 6379
42 Ga0105244_10003601 3300009036 Bacteria 11001
43 Ga0105244_10297128 3300009036 Bacteria 748
44 Ga0105240_10750196 3300009093 Bacteria 1061
45 Ga0105243_12114403 3300009148 Bacteria 599
46 Ga0105241_10191084 3300009174 Bacteria 1704
47 Ga0105241_11056602 3300009174 Bacteria 762
48 Ga0105242_10240484 3300009176 Bacteria 1627
49 Ga0105242_10705786 3300009176 Bacteria 987
50 Ga0105242_11470153 3300009176 Bacteria 711
51 Ga0105248_10479800 3300009177 Bacteria 1401
52 Ga0105237_10980750 3300009545 Bacteria 852
53 Ga0105238_10338631 3300009551 Bacteria 1492
54 Ga0105239_10399044 3300010375 Bacteria 1556
55 Ga0105246_10353440 3300011119 Bacteria 1205
56 Ga0105246_12277374 3300011119 Bacteria 529
57 Ga0157371_10000060 3300013102 Bacteria 170456
58 Ga0157369_10451306 3300013105 Bacteria 1331
59 Ga0157374_10681251 3300013296 Bacteria 1041
60 Ga0157374_11843263 3300013296 Bacteria 630
61 Ga0157372_10672708 3300013307 Bacteria 1205
62 Ga0157372_10673428 3300013307 Bacteria 1204
63 Ga0157372_11421190 3300013307 Bacteria 800
64 Ga0157372_12147124 3300013307 Bacteria 642
65 Ga0157372_12657226 3300013307 Bacteria 574
66 Ga0163163_12495755 3300014325 Bacteria 575
67 Ga0182008_10182501 3300014497 Bacteria 1062
68 Ga0182006_1000054 3300015261 Bacteria 174021
69 Ga0182006_1049374 3300015261 Bacteria 1624
70 Ga0182006_1208317 3300015261 Bacteria 646
71 Ga0182007_10107553 3300015262 Bacteria 926
72 Ga0182007_10129612 3300015262 Bacteria 848
73 Ga0182007_10287233 3300015262 Bacteria 600
74 Ga0182005_1000012 3300015265 Bacteria 396944
75 Ga0209436_100099 3300025208 Bacteria 42519
76 Ga0209436_112786 3300025208 Bacteria 1409
77 Ga0209563_100003 3300025230 Bacteria 1932942
78 Ga0209677_107770 3300025253 Bacteria 2200
79 Ga0209148_1001884 3300025254 Bacteria 8677
80 Ga0209565_1000015 3300025263 Bacteria 494091
81 Ga0209673_1000017 3300025273 Bacteria 492994
82 Ga0209130_1000063 3300025284 Bacteria 198142
83 Ga0209130_1001327 3300025284 Bacteria 16820
84 Ga0209675_1000012 3300025291 Bacteria 494061
85 Ga0209564_1000016 3300025295 Bacteria 613131
86 Ga0209564_1038206 3300025295 Bacteria 1339
87 Ga0209256_1000593 3300025299 Bacteria 50391
88 Ga0207426_1116192 3300025302 Bacteria 668
89 Ga0207655_1030945 3300025728 Bacteria 2478
90 Ga0207705_10008590 3300025909 Bacteria 7445
91 Ga0207705_10734260 3300025909 Bacteria 767
92 Ga0207654_10097376 3300025911 Bacteria 1806
93 Ga0207695_10742496 3300025913 Bacteria 862
94 Ga0207671_10402673 3300025914 Bacteria 1088
95 Ga0207657_10021673 3300025919 Bacteria 6039
96 Ga0207657_10253278 3300025919 Bacteria 1403
97 Ga0207657_10284239 3300025919 Bacteria 1313
98 Ga0207649_10113539 3300025920 Bacteria 1814
99 Ga0207690_10043094 3300025932 Bacteria 2968
100 Ga0207706_10122474 3300025933 Bacteria 2287
101 Ga0207706_10316299 3300025933 Bacteria 1359
102 Ga0207706_10615991 3300025933 Bacteria 931
103 Ga0207686_10071301 3300025934 Bacteria 2235
104 Ga0207679_10073281 3300025945 Bacteria 2590
105 Ga0207679_10369299 3300025945 Bacteria 1255
106 Ga0207667_10014971 3300025949 Bacteria 8821
107 Ga0207667_10383648 3300025949 Bacteria 1432
108 Ga0207640_11157111 3300025981 Bacteria 686
109 Ga0207639_11861643 3300026041 Bacteria 563
110 Ga0207678_10448212 3300026067 Bacteria 1121
111 Ga0207702_11043670 3300026078 Bacteria 811
112 Ga0207674_11126314 3300026116 Bacteria 754
113 Ga0207698_10443745 3300026142 Bacteria 1251
114 Ga0207698_11613753 3300026142 Bacteria 664
115 Ga0316177_1065105 3300030731 Bacteria 1242
116 Ga0316178_1014113 3300030735 Bacteria 913
117 Ga0316180_1061982 3300030736 Bacteria 3369
118 Ga0316181_1085165 3300030744 Bacteria 1186
119 Ga0316181_1092946 3300030744 Bacteria 675
120 Ga0316182_1088262 3300030745 Bacteria 5540
121 Ga0316182_1220829 3300030745 Bacteria 599
122 Ga0307408_100000115 3300031548 Bacteria 88580
123 Ga0307408_100030755 3300031548 Bacteria 3731
124 Ga0307408_101035150 3300031548 Bacteria 758
125 Ga0307408_102055207 3300031548 Bacteria 550
126 Ga0307406_11688384 3300031901 Bacteria 561
127 Ga0307510_10473307 3300033180 Bacteria 694
128 Ga0395899_0009972 3300037312 Bacteria 7285
129 Ga0395899_0015599 3300037312 Bacteria 5793
130 Ga0395899_0015964 3300037312 Bacteria 5726
131 Ga0395899_0042960 3300037312 Bacteria 3372
132 Ga0395899_0190693 3300037312 Bacteria 1434
133 Ga0395899_0198965 3300037312 Bacteria 1398
134 Ga0395899_0336280 3300037312 Bacteria 1013
135 Ga0395899_0398420 3300037312 Bacteria 911
136 Ga0395899_0717455 3300037312 Bacteria 625
137 Ga0395900_0001651 3300037418 Bacteria 26103
138 Ga0395900_0040293 3300037418 Bacteria 4813
139 Ga0395900_0066863 3300037418 Bacteria 3693
140 Ga0395900_0117209 3300037418 Bacteria 2732
141 Ga0395900_0136346 3300037418 Bacteria 2514
142 Ga0395900_0277058 3300037418 Bacteria 1670
143 Ga0395900_0375594 3300037418 Bacteria 1390
144 Ga0395900_0380035 3300037418 Bacteria 1380
145 Ga0395900_0715228 3300037418 Bacteria 934
146 Ga0395900_1342690 3300037418 Bacteria 628
147 Ga0395898_0003616 3300037466 Bacteria 17209
148 Ga0395898_0060986 3300037466 Bacteria 3664
149 Ga0395898_0111766 3300037466 Bacteria 2618
150 Ga0395898_0260894 3300037466 Bacteria 1653
151 Ga0395898_0492134 3300037466 Bacteria 1166
152 Ga0395905_0030787 3300037471 Bacteria 5054
153 Ga0395905_0101509 3300037471 Bacteria 2700
154 Ga0395905_0304194 3300037471 Bacteria 1482
155 Ga0395905_0408833 3300037471 Bacteria 1252
156 Ga0395905_0774210 3300037471 Bacteria 862
157 Ga0395905_0788383 3300037471 Bacteria 853
158 Ga0395905_1147361 3300037471 Bacteria 680
159 Ga0395905_1658040 3300037471 Bacteria 544
160 Ga0395905_1815338 3300037471 Bacteria 515
161 Ga0395901_0000212 3300038443 Bacteria 73375
162 Ga0395901_0006637 3300038443 Bacteria 11691
163 Ga0395901_0074457 3300038443 Bacteria 3542
164 Ga0395901_0217719 3300038443 Bacteria 1996
165 Ga0395901_0296005 3300038443 Bacteria 1678
166 Ga0395901_0619258 3300038443 Bacteria 1089
167 Ga0395901_0676303 3300038443 Bacteria 1032
168 Ga0395901_0871002 3300038443 Bacteria 884
169 Ga0395901_1009956 3300038443 Bacteria 807
170 Ga0395901_1017081 3300038443 Bacteria 804
171 Ga0439433_0143336 3300041999 Bacteria 612
172 Ga0439448_0001989 3300042005 Bacteria 5465
173 Ga0439448_0002870 3300042005 Bacteria 4719
174 Ga0439448_0248527 3300042005 Bacteria 627
175 Ga0439449_0240098 3300042007 Bacteria 680
176 Ga0439450_014522 3300042008 Bacteria 1599
177 Ga0439450_030847 3300042008 Bacteria 1204
178 Ga0439455_0001953 3300042012 Bacteria 3634
179 Ga0439455_0018952 3300042012 Bacteria 1618
180 Ga0450911_038606 3300042115 Bacteria 619
181 Ga0450923_135349 3300042125 Bacteria 589
182 Ga0450904_000617 3300042139 Bacteria 6533
183 Ga0450906_014413 3300042145 Bacteria 1447
184 Ga0439458_0035450 3300042157 Bacteria 1199
185 Ga0439458_0046146 3300042157 Bacteria 1066
186 Ga0439458_0094442 3300042157 Bacteria 772
187 Ga0439458_0101782 3300042157 Bacteria 746
188 Ga0466969_0467808 3300044656 Bacteria 574
189 Ga0466972_0097447 3300044658 Bacteria 1393
190 Ga0466972_0218221 3300044658 Bacteria 892
191 Ga0466981_0279929 3300044669 Bacteria 1060
192 Ga0466965_0022307 3300044683 Bacteria 3053
193 Ga0466965_0031608 3300044683 Bacteria 2582
194 Ga0466965_0090731 3300044683 Bacteria 1554
195 Ga0466965_0128922 3300044683 Bacteria 1310
196 Ga0466966_0043982 3300044684 Bacteria 2860
197 Ga0466966_0063947 3300044684 Bacteria 2317
198 Ga0466966_0122513 3300044684 Bacteria 1596
199 Ga0466966_0146294 3300044684 Bacteria 1442
200 Ga0466966_0149658 3300044684 Bacteria 1424
201 Ga0466966_0176223 3300044684 Bacteria 1298
202 Ga0466966_0206452 3300044684 Bacteria 1188
203 Ga0466966_0815703 3300044684 Bacteria 562
204 Ga0466961_0160459 3300044693 Bacteria 1401
205 Ga0466961_0161747 3300044693 Bacteria 1395
206 Ga0466961_0216935 3300044693 Bacteria 1180
207 Ga0466961_0565297 3300044693 Bacteria 684
208 Ga0466964_0162126 3300044706 Bacteria 1046
209 Ga0466964_0230186 3300044706 Bacteria 904
210 Ga0466964_0690050 3300044706 Bacteria 568
211 Ga0466971_0123170 3300044719 Bacteria 1201
212 Ga0466971_0394712 3300044719 Bacteria 674
213 Ga0466968_0132824 3300044735 Bacteria 1134
214 Ga0466970_0032352 3300044765 Bacteria 2763
215 Ga0466970_0333357 3300044765 Bacteria 859
216 Ga0466957_0000121 3300044842 Bacteria 32737
217 Ga0466957_0529670 3300044842 Bacteria 819
218 Ga0466957_1042795 3300044842 Bacteria 588
219 Ga0466960_0381743 3300044901 Bacteria 809
220 Ga0466960_0757908 3300044901 Bacteria 585
221 Ga0466959_0049330 3300045049 Bacteria 3092
222 Ga0466959_0052265 3300045049 Bacteria 2993
223 Ga0466959_0203124 3300045049 Bacteria 1379
224 Ga0466958_0144378 3300045836 Bacteria 1499
225 Ga0466958_0435364 3300045836 Bacteria 848
226 Ga0466958_0550757 3300045836 Bacteria 749
227 Ga0466958_1029453 3300045836 Bacteria 537
228 Ga0466967_0022225 3300045976 Bacteria 5170
229 Ga0466967_0052799 3300045976 Bacteria 3570
230 Ga0466967_1476267 3300045976 Bacteria 677
231 Ga0495627_000007 3300046453 Bacteria 575915
232 Ga0495603_0015152 3300046455 Bacteria 4664
233 Ga0495590_0000005 3300046457 Bacteria 384276
234 Ga0495590_0000351 3300046457 Bacteria 23818
235 Ga0495590_0010773 3300046457 Bacteria 3427
236 Ga0495590_0018350 3300046457 Bacteria 2505
237 Ga0495638_0000027 3300046460 Bacteria 337569
238 Ga0495638_0039487 3300046460 Bacteria 2996
239 Ga0495638_0069291 3300046460 Bacteria 2162
240 Ga0495653_0029347 3300046463 Bacteria 4392
241 Ga0495653_0101394 3300046463 Bacteria 2085
242 Ga0495650_0005067 3300046471 Bacteria 8716
243 Ga0495580_0116060 3300046472 Bacteria 1859
244 Ga0495580_0373532 3300046472 Bacteria 964
245 Ga0495605_0000130 3300046474 Bacteria 98652
246 Ga0495605_0035728 3300046474 Bacteria 2510
247 Ga0495639_0069061 3300046475 Bacteria 1629
248 Ga0495664_0440544 3300046477 Bacteria 781
249 Ga0495584_0002296 3300046491 Bacteria 10910
250 Ga0495584_0023153 3300046491 Bacteria 3150
251 Ga0495584_0100451 3300046491 Bacteria 1462
252 Ga0495584_0127048 3300046491 Bacteria 1292
253 Ga0495584_0139500 3300046491 Bacteria 1231
254 Ga0495585_0127958 3300046492 Bacteria 1339
255 Ga0495594_0034155 3300046499 Bacteria 2767
256 Ga0495594_0194867 3300046499 Bacteria 1154
257 Ga0495596_0102206 3300046500 Bacteria 1113
258 Ga0495607_0000720 3300046501 Bacteria 31834
259 Ga0495607_0002353 3300046501 Bacteria 15449
260 Ga0495607_0003771 3300046501 Bacteria 11459
261 Ga0495607_0045162 3300046501 Bacteria 2593
262 Ga0495607_0048968 3300046501 Bacteria 2467
263 Ga0495607_0079564 3300046501 Bacteria 1805
264 Ga0495607_0137713 3300046501 Bacteria 1263
265 Ga0495583_0000100 3300046506 Bacteria 145745
266 Ga0495583_0086307 3300046506 Bacteria 1357
267 Ga0495606_0000907 3300046507 Bacteria 44030
268 Ga0495606_0013357 3300046507 Bacteria 6493
269 Ga0495606_0014188 3300046507 Bacteria 6236
270 Ga0495606_0018908 3300046507 Bacteria 5150
271 Ga0495606_0189323 3300046507 Bacteria 1180
272 Ga0495610_0035653 3300046512 Bacteria 2551
273 Ga0495610_0194909 3300046512 Bacteria 833
274 Ga0495616_0020730 3300046513 Bacteria 3570
275 Ga0495616_0051467 3300046513 Bacteria 2054
276 Ga0495630_0204651 3300046517 Bacteria 1506
277 Ga0495631_0029496 3300046518 Bacteria 2494
278 Ga0495643_0017494 3300046522 Bacteria 4189
279 Ga0495643_0039859 3300046522 Bacteria 2567
280 Ga0495643_0116173 3300046522 Bacteria 1355
281 Ga0495643_0272232 3300046522 Bacteria 782
282 Ga0495643_0329494 3300046522 Bacteria 688
283 Ga0495643_0477760 3300046522 Bacteria 539
284 Ga0495648_0000002 3300046524 Bacteria 593972
285 Ga0495648_0063987 3300046524 Bacteria 2169
286 Ga0495666_0002773 3300046526 Bacteria 8751
287 Ga0495666_0059723 3300046526 Bacteria 1823
288 Ga0495666_0227323 3300046526 Bacteria 853
289 Ga0495642_0001650 3300046528 Bacteria 9676
290 Ga0495642_0001734 3300046528 Bacteria 9396
291 Ga0495642_0004425 3300046528 Bacteria 5455
292 Ga0495642_0060610 3300046528 Bacteria 1569
293 Ga0495642_0111773 3300046528 Bacteria 1168
294 Ga0495652_0057178 3300046529 Bacteria 3309
295 Ga0495654_0038592 3300046530 Bacteria 2387
296 Ga0495654_0260549 3300046530 Bacteria 719
297 Ga0495665_0022066 3300046531 Bacteria 3423
298 Ga0495665_0540095 3300046531 Bacteria 585
299 Ga0495586_0021945 3300046535 Bacteria 3406
300 Ga0495587_0071730 3300046536 Bacteria 2014
301 Ga0495587_0137111 3300046536 Bacteria 1397
302 Ga0495587_0168312 3300046536 Bacteria 1245
303 Ga0495587_0184448 3300046536 Bacteria 1182
304 Ga0495609_0000055 3300046538 Bacteria 146808
305 Ga0495609_0017845 3300046538 Bacteria 3294
306 Ga0495609_0028210 3300046538 Bacteria 2562
307 Ga0495609_0085173 3300046538 Bacteria 1378
308 Ga0495597_0005636 3300046542 Bacteria 6598
309 Ga0495597_0016852 3300046542 Bacteria 3446
310 Ga0495597_0019193 3300046542 Bacteria 3201
311 Ga0495597_0084364 3300046542 Bacteria 1355
312 Ga0495645_0185021 3300046543 Bacteria 1424
313 Ga0495622_0000128 3300046557 Bacteria 65352
314 Ga0495622_0000313 3300046557 Bacteria 35947
315 Ga0495622_0099555 3300046557 Bacteria 1333
316 Ga0495633_0000031 3300046558 Bacteria 196727
317 Ga0495633_0000050 3300046558 Bacteria 155466
318 Ga0495633_0033913 3300046558 Bacteria 2458
319 Ga0495668_0000101 3300046616 Bacteria 137289
320 Ga0495668_0019952 3300046616 Bacteria 3856
321 Ga0495668_0024796 3300046616 Bacteria 3410
322 Ga0495668_0033381 3300046616 Bacteria 2891
323 Ga0495634_0048924 3300046642 Bacteria 2844
324 Ga0495625_0000121 3300046660 Bacteria 121186
325 Ga0495625_0019207 3300046660 Bacteria 5308
326 Ga0495625_0020342 3300046660 Bacteria 5127
327 Ga0495625_0279633 3300046660 Bacteria 1074
328 Ga0495659_0000204 3300046664 Bacteria 25590
329 Ga0495659_0003883 3300046664 Bacteria 4742
330 Ga0495661_0016832 3300046665 Bacteria 4833
331 Ga0495661_0034138 3300046665 Bacteria 3202
332 Ga0495661_0039378 3300046665 Bacteria 2937
333 Ga0495661_0053510 3300046665 Bacteria 2427
334 Ga0495661_0070618 3300046665 Bacteria 2043
335 Ga0495661_0411478 3300046665 Bacteria 656
336 Ga0495661_0488922 3300046665 Bacteria 588
337 Ga0495588_0000041 3300046674 Bacteria 377896
338 Ga0495588_0371690 3300046674 Bacteria 751
339 Ga0495588_0392610 3300046674 Bacteria 728
340 Ga0495599_0647049 3300046678 Bacteria 613
341 Ga0495623_0013663 3300046679 Bacteria 5263
342 Ga0495623_0041950 3300046679 Bacteria 2916
343 Ga0495646_0144343 3300046680 Bacteria 1328
344 Ga0495669_0002327 3300046684 Bacteria 7786
345 Ga0495613_0274683 3300046689 Bacteria 1171
346 Ga0495624_0038663 3300046690 Bacteria 3064
347 Ga0495670_0130447 3300046691 Bacteria 1310
348 Ga0495671_0000109 3300046692 Bacteria 74002
349 Ga0495649_0044576 3300046694 Bacteria 2421
350 Ga0495589_0000034 3300046794 Bacteria 162449
351 Ga0495589_0053074 3300046794 Bacteria 2001
352 Ga0495660_0000107 3300046810 Bacteria 89427
353 Ga0495660_0000860 3300046810 Bacteria 22420
354 Ga0495660_0001714 3300046810 Bacteria 14673
355 Ga0495660_0008054 3300046810 Bacteria 6192
356 Ga0495660_0032759 3300046810 Bacteria 2918
357 Ga0495660_0042127 3300046810 Bacteria 2523
358 Ga0495660_0102499 3300046810 Bacteria 1471
359 Ga0495581_0003117 3300047315 Bacteria 9493
360 Ga0495581_0077854 3300047315 Bacteria 1919
361 Ga0495581_0530015 3300047315 Bacteria 684
362 Ga0495604_0025156 3300047317 Bacteria 4743
363 Ga0495636_0005832 3300047318 Bacteria 4829
364 Ga0495672_0000244 3300047320 Bacteria 76463
365 Ga0495672_0107072 3300047320 Bacteria 1506
366 Ga0495680_0107112 3300047322 Bacteria 2076
367 Ga0495683_0093148 3300047323 Bacteria 1457
368 Ga0495687_000023 3300047443 Bacteria 317750
369 Ga0495687_000535 3300047443 Bacteria 45436
370 Ga0495687_000550 3300047443 Bacteria 44560
371 Ga0495687_001509 3300047443 Bacteria 21213
372 Ga0495687_022915 3300047443 Bacteria 2990
373 Ga0495675_0033927 3300047444 Bacteria 3258
374 Ga0495675_0231960 3300047444 Bacteria 1113
375 Ga0495675_0442231 3300047444 Bacteria 753
376 Ga0495677_0003378 3300047445 Bacteria 6211
377 Ga0495677_0009634 3300047445 Bacteria 3562
378 Ga0495677_0028108 3300047445 Bacteria 2041
379 Ga0495677_0101464 3300047445 Bacteria 1090
380 Ga0495685_017670 3300047447 Bacteria 2443
381 Ga0495685_061540 3300047447 Bacteria 1264
382 Ga0495681_0025025 3300047470 Bacteria 3129
383 Ga0495681_0042289 3300047470 Bacteria 2206
384 Ga0495681_0072981 3300047470 Bacteria 1550
385 Ga0495681_0165564 3300047470 Bacteria 918
386 Ga0495686_0001420 3300047472 Bacteria 26206
387 Ga0495686_0041981 3300047472 Bacteria 2910
388 Ga0495602_0019960 3300048088 Bacteria 6634
389 Ga0495626_0000037 3300048091 Bacteria 178573
390 Ga0495626_0164901 3300048091 Bacteria 926
391 Ga0496100_0244275 3300048903 Bacteria 1326
392 Ga0496100_0666647 3300048903 Bacteria 811
393 Ga0496100_0876345 3300048903 Bacteria 705
394 Ga0496102_0275122 3300048905 Bacteria 1587
395 Ga0496102_0357868 3300048905 Bacteria 1374
396 Ga0496102_0423092 3300048905 Bacteria 1251
397 Ga0496102_0989710 3300048905 Bacteria 761
398 Ga0496103_0001094 3300048906 Bacteria 18866
399 Ga0496105_0090364 3300048908 Bacteria 2529
400 Ga0496106_0007749 3300048909 Bacteria 7947
401 Ga0496106_0224057 3300048909 Bacteria 1500
402 Ga0496107_0029537 3300048910 Bacteria 3901
403 Ga0496108_1606227 3300048911 Bacteria 538
404 Ga0496110_0546455 3300048913 Bacteria 1053
405 Ga0496111_0456094 3300048914 Bacteria 943
406 Ga0496111_1058166 3300048914 Bacteria 580
407 Ga0496113_0240165 3300048916 Bacteria 1445
408 Ga0496113_0344536 3300048916 Bacteria 1195
409 Ga0496113_0722599 3300048916 Bacteria 794
410 Ga0496113_0851956 3300048916 Bacteria 722
411 Ga0496114_0040880 3300048917 Bacteria 3841
412 Ga0496115_1324130 3300048918 Bacteria 535
413 Ga0496116_0026712 3300048919 Bacteria 4213
414 Ga0496122_0034913 3300048925 Bacteria 4104
415 Ga0496122_0110900 3300048925 Bacteria 1801
416 Ga0496122_0408700 3300048925 Bacteria 686
417 Ga0496123_0118447 3300048926 Bacteria 1495
418 Ga0496123_0363983 3300048926 Bacteria 668
419 Ga0496124_0021280 3300048927 Bacteria 5979
420 Ga0496124_0028803 3300048927 Bacteria 4961
421 Ga0496124_0029090 3300048927 Bacteria 4929
422 Ga0496124_0030139 3300048927 Bacteria 4820
423 Ga0496125_0164534 3300048928 Bacteria 1501
424 Ga0501310_043633 3300049130 Bacteria 631
425 Ga0495678_000004 3300049459 Bacteria 532920
426 Ga0495678_029020 3300049459 Bacteria 2327
427 Ga0495678_121519 3300049459 Bacteria 876
428 Ga0501047_0323369 3300049581 Bacteria 1382
429 Ga0501224_022922 3300049664 Bacteria 932
430 Ga0501235_047561 3300049669 Bacteria 989
431 Ga0501249_006731 3300049679 Bacteria 2368
432 Ga0501249_014645 3300049679 Bacteria 1672
433 Ga0501234_107218 3300049707 Bacteria 512
434 Ga0501269_000036 3300049766 Bacteria 41517
435 Ga0501279_011679 3300049775 Bacteria 1190
436 Ga0501035_0269816 3300049822 Bacteria 1440
437 Ga0501044_0222077 3300049823 Bacteria 1840
438 Ga0501226_021430 3300049853 Bacteria 716
439 nmdc:mga03683_17796_c1 3300050489 Bacteria 2694
440 Ga0587088_181204 3300059508 Bacteria 528
441 Ga0466962_0091706 3300061719 Bacteria 1456
442 Ga0466962_0132195 3300061719 Bacteria 1206

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2643221645 2644254021 55
2 iso_pu_bacteria 2643221664 2644356791 57
3 iso_pu_bacteria 2643221684 2644473484 57
4 iso_pu_bacteria 2738541280 2738742022 57
5 3300003322 rootL2_10143385 rootL2_101433854 58
6 3300042125 Ga0450923_135349 Ga0450923_135349_135_329 58
7 3300046528 Ga0495642_0001650 Ga0495642_0001650_8344_8529 58
8 3300046616 Ga0495668_0000101 Ga0495668_0000101_25710_25922 58
9 3300049664 Ga0501224_022922 Ga0501224_022922_685_879 58
10 iso_pu_bacteria 2857553236 2857554663 58
11 iso_pu_bacteria 2857558681 2857563355 58
12 iso_pu_bacteria 2904424332 2904426861 58
13 iso_pu_bacteria 2738541300 2738844475 59
14 iso_pu_bacteria 2738543018 2739277053 59
15 iso_pu_bacteria 2738543030 2739346006 59
16 iso_pu_bacteria 8047673197 8047679211 59
17 3300005262 Ga0065165_1009472 Ga0065165_10094724 60
18 3300005563 Ga0068855_100213646 Ga0068855_1002136465 60
19 3300013307 Ga0157372_10672708 Ga0157372_106727082 60
20 3300025949 Ga0207667_10383648 Ga0207667_103836482 60
21 3300026116 Ga0207674_11126314 Ga0207674_111263142 60
22 3300037312 Ga0395899_0015599 Ga0395899_0015599_2483_2674 60
23 3300037312 Ga0395899_0015964 Ga0395899_0015964_891_1082 60
24 3300037312 Ga0395899_0198965 Ga0395899_0198965_108_299 60
25 3300037312 Ga0395899_0336280 Ga0395899_0336280_202_393 60
26 3300037418 Ga0395900_0040293 Ga0395900_0040293_1771_1962 60
27 3300037418 Ga0395900_0277058 Ga0395900_0277058_814_1005 60
28 3300037466 Ga0395898_0111766 Ga0395898_0111766_1686_1877 60
29 3300037466 Ga0395898_0492134 Ga0395898_0492134_252_443 60
30 3300037471 Ga0395905_0030787 Ga0395905_0030787_2621_2812 60
31 3300037471 Ga0395905_0101509 Ga0395905_0101509_1932_2123 60
32 3300037471 Ga0395905_1658040 Ga0395905_1658040_298_489 60
33 3300037471 Ga0395905_1815338 Ga0395905_1815338_63_254 60
34 3300038443 Ga0395901_0074457 Ga0395901_0074457_823_1014 60
35 3300038443 Ga0395901_0676303 Ga0395901_0676303_52_243 60
36 3300038443 Ga0395901_1009956 Ga0395901_1009956_173_364 60
37 3300042005 Ga0439448_0248527 Ga0439448_0248527_96_287 60
38 3300042139 Ga0450904_000617 Ga0450904_000617_1089_1277 60
39 3300044706 Ga0466964_0690050 Ga0466964_0690050_251_442 60
40 3300044765 Ga0466970_0032352 Ga0466970_0032352_2108_2290 60
41 3300045976 Ga0466967_0052799 Ga0466967_0052799_2937_3128 60
42 3300046536 Ga0495587_0168312 Ga0495587_0168312_518_706 60
43 3300048903 Ga0496100_0666647 Ga0496100_0666647_506_697 60
44 3300048905 Ga0496102_0275122 Ga0496102_0275122_723_914 60
45 3300048909 Ga0496106_0007749 Ga0496106_0007749_3949_4140 60
46 3300048910 Ga0496107_0029537 Ga0496107_0029537_2377_2568 60
47 3300048918 Ga0496115_1324130 Ga0496115_1324130_194_385 60
48 3300048927 Ga0496124_0028803 Ga0496124_0028803_3917_4108 60
49 3300003759 Ga0055525_1000025 Ga0055525_1000025139 61
50 3300003762 Ga0055542_1028482 Ga0055542_10284822 61
51 3300005327 Ga0070658_10256422 Ga0070658_102564221 61
52 3300005327 Ga0070658_10524302 Ga0070658_105243022 61
53 3300005327 Ga0070658_11510117 Ga0070658_115101172 61
54 3300005327 Ga0070658_11610997 Ga0070658_116109972 61
55 3300005335 Ga0070666_11185908 Ga0070666_111859081 61
56 3300005339 Ga0070660_100015265 Ga0070660_1000152654 61
57 3300005339 Ga0070660_100379049 Ga0070660_1003790491 61
58 3300005366 Ga0070659_100090707 Ga0070659_1000907075 61
59 3300005455 Ga0070663_100813119 Ga0070663_1008131192 61
60 3300005455 Ga0070663_101316059 Ga0070663_1013160592 61
61 3300005457 Ga0070662_100214420 Ga0070662_1002144202 61
62 3300005457 Ga0070662_100282156 Ga0070662_1002821563 61
63 3300005457 Ga0070662_100294257 Ga0070662_1002942572 61
64 3300005459 Ga0068867_100629880 Ga0068867_1006298802 61
65 3300005563 Ga0068855_100035470 Ga0068855_1000354704 61
66 3300005564 Ga0070664_100234045 Ga0070664_1002340451 61
67 3300005577 Ga0068857_102457908 Ga0068857_1024579081 61
68 3300005614 Ga0068856_100324739 Ga0068856_1003247391 61
69 3300005616 Ga0068852_100333508 Ga0068852_1003335082 61
70 3300009036 Ga0105244_10297128 Ga0105244_102971283 61
71 3300009093 Ga0105240_10750196 Ga0105240_107501961 61
72 3300009148 Ga0105243_12114403 Ga0105243_121144032 61
73 3300009174 Ga0105241_10191084 Ga0105241_101910843 61
74 3300009174 Ga0105241_11056602 Ga0105241_110566022 61
75 3300009176 Ga0105242_10240484 Ga0105242_102404842 61
76 3300009176 Ga0105242_10705786 Ga0105242_107057863 61
77 3300009545 Ga0105237_10980750 Ga0105237_109807502 61
78 3300009551 Ga0105238_10338631 Ga0105238_103386314 61
79 3300010375 Ga0105239_10399044 Ga0105239_103990443 61
80 3300011119 Ga0105246_10353440 Ga0105246_103534402 61
81 3300011119 Ga0105246_12277374 Ga0105246_122773741 61
82 3300013105 Ga0157369_10451306 Ga0157369_104513062 61
83 3300013296 Ga0157374_10681251 Ga0157374_106812512 61
84 3300013296 Ga0157374_11843263 Ga0157374_118432632 61
85 3300013307 Ga0157372_11421190 Ga0157372_114211902 61
86 3300013307 Ga0157372_12147124 Ga0157372_121471242 61
87 3300013307 Ga0157372_12657226 Ga0157372_126572262 61
88 3300015261 Ga0182006_1208317 Ga0182006_12083172 61
89 3300015262 Ga0182007_10129612 Ga0182007_101296122 61
90 3300025230 Ga0209563_100003 Ga0209563_100003916 61
91 3300025253 Ga0209677_107770 Ga0209677_1077702 61
92 3300025254 Ga0209148_1001884 Ga0209148_10018845 61
93 3300025909 Ga0207705_10008590 Ga0207705_100085904 61
94 3300025909 Ga0207705_10734260 Ga0207705_107342602 61
95 3300025911 Ga0207654_10097376 Ga0207654_100973764 61
96 3300025913 Ga0207695_10742496 Ga0207695_107424962 61
97 3300025914 Ga0207671_10402673 Ga0207671_104026732 61
98 3300025919 Ga0207657_10021673 Ga0207657_100216737 61
99 3300025919 Ga0207657_10253278 Ga0207657_102532783 61
100 3300025919 Ga0207657_10284239 Ga0207657_102842393 61
101 3300025920 Ga0207649_10113539 Ga0207649_101135393 61
102 3300025932 Ga0207690_10043094 Ga0207690_100430945 61
103 3300025933 Ga0207706_10122474 Ga0207706_101224742 61
104 3300025933 Ga0207706_10316299 Ga0207706_103162992 61
105 3300025933 Ga0207706_10615991 Ga0207706_106159912 61
106 3300025934 Ga0207686_10071301 Ga0207686_100713014 61
107 3300025945 Ga0207679_10073281 Ga0207679_100732812 61
108 3300025945 Ga0207679_10369299 Ga0207679_103692992 61
109 3300025949 Ga0207667_10014971 Ga0207667_100149714 61
110 3300025981 Ga0207640_11157111 Ga0207640_111571112 61
111 3300026041 Ga0207639_11861643 Ga0207639_118616432 61
112 3300026067 Ga0207678_10448212 Ga0207678_104482122 61
113 3300026078 Ga0207702_11043670 Ga0207702_110436702 61
114 3300026142 Ga0207698_10443745 Ga0207698_104437452 61
115 3300026142 Ga0207698_11613753 Ga0207698_116137532 61
116 3300031548 Ga0307408_102055207 Ga0307408_1020552072 61
117 3300037312 Ga0395899_0009972 Ga0395899_0009972_57_251 61
118 3300037312 Ga0395899_0042960 Ga0395899_0042960_1323_1517 61
119 3300037312 Ga0395899_0190693 Ga0395899_0190693_63_257 61
120 3300037312 Ga0395899_0398420 Ga0395899_0398420_133_327 61
121 3300037312 Ga0395899_0717455 Ga0395899_0717455_158_352 61
122 3300037418 Ga0395900_0001651 Ga0395900_0001651_4354_4548 61
123 3300037418 Ga0395900_0066863 Ga0395900_0066863_57_251 61
124 3300037418 Ga0395900_0117209 Ga0395900_0117209_1393_1587 61
125 3300037418 Ga0395900_0136346 Ga0395900_0136346_1167_1361 61
126 3300037418 Ga0395900_0375594 Ga0395900_0375594_537_731 61
127 3300037418 Ga0395900_0380035 Ga0395900_0380035_150_344 61
128 3300037418 Ga0395900_0715228 Ga0395900_0715228_88_282 61
129 3300037418 Ga0395900_1342690 Ga0395900_1342690_20_214 61
130 3300037466 Ga0395898_0003616 Ga0395898_0003616_12835_13029 61
131 3300037466 Ga0395898_0060986 Ga0395898_0060986_3024_3218 61
132 3300037466 Ga0395898_0260894 Ga0395898_0260894_736_930 61
133 3300037471 Ga0395905_0304194 Ga0395905_0304194_352_546 61
134 3300037471 Ga0395905_0408833 Ga0395905_0408833_604_798 61
135 3300037471 Ga0395905_0774210 Ga0395905_0774210_573_767 61
136 3300037471 Ga0395905_0788383 Ga0395905_0788383_545_739 61
137 3300037471 Ga0395905_1147361 Ga0395905_1147361_175_369 61
138 3300038443 Ga0395901_0000212 Ga0395901_0000212_59507_59701 61
139 3300038443 Ga0395901_0006637 Ga0395901_0006637_4181_4375 61
140 3300038443 Ga0395901_0217719 Ga0395901_0217719_1342_1536 61
141 3300038443 Ga0395901_0296005 Ga0395901_0296005_117_311 61
142 3300038443 Ga0395901_0619258 Ga0395901_0619258_64_258 61
143 3300038443 Ga0395901_0871002 Ga0395901_0871002_102_296 61
144 3300038443 Ga0395901_1017081 Ga0395901_1017081_25_219 61
145 3300041999 Ga0439433_0143336 Ga0439433_0143336_188_391 61
146 3300042005 Ga0439448_0001989 Ga0439448_0001989_5140_5334 61
147 3300042005 Ga0439448_0002870 Ga0439448_0002870_858_1061 61
148 3300042007 Ga0439449_0240098 Ga0439449_0240098_457_660 61
149 3300042008 Ga0439450_014522 Ga0439450_014522_316_510 61
150 3300042008 Ga0439450_030847 Ga0439450_030847_412_615 61
151 3300042012 Ga0439455_0001953 Ga0439455_0001953_2427_2630 61
152 3300042012 Ga0439455_0018952 Ga0439455_0018952_585_779 61
153 3300042157 Ga0439458_0035450 Ga0439458_0035450_319_522 61
154 3300042157 Ga0439458_0046146 Ga0439458_0046146_629_823 61
155 3300042157 Ga0439458_0094442 Ga0439458_0094442_481_675 61
156 3300044656 Ga0466969_0467808 Ga0466969_0467808_94_288 61
157 3300044658 Ga0466972_0097447 Ga0466972_0097447_118_312 61
158 3300044658 Ga0466972_0218221 Ga0466972_0218221_335_529 61
159 3300044669 Ga0466981_0279929 Ga0466981_0279929_522_716 61
160 3300044683 Ga0466965_0022307 Ga0466965_0022307_1280_1468 61
161 3300044683 Ga0466965_0031608 Ga0466965_0031608_1113_1307 61
162 3300044683 Ga0466965_0090731 Ga0466965_0090731_566_760 61
163 3300044683 Ga0466965_0128922 Ga0466965_0128922_20_214 61
164 3300044684 Ga0466966_0043982 Ga0466966_0043982_1954_2148 61
165 3300044684 Ga0466966_0063947 Ga0466966_0063947_367_561 61
166 3300044684 Ga0466966_0122513 Ga0466966_0122513_1266_1460 61
167 3300044684 Ga0466966_0146294 Ga0466966_0146294_1218_1412 61
168 3300044684 Ga0466966_0149658 Ga0466966_0149658_1114_1308 61
169 3300044684 Ga0466966_0176223 Ga0466966_0176223_219_413 61
170 3300044684 Ga0466966_0206452 Ga0466966_0206452_22_216 61
171 3300044684 Ga0466966_0815703 Ga0466966_0815703_236_424 61
172 3300044693 Ga0466961_0160459 Ga0466961_0160459_813_1007 61
173 3300044693 Ga0466961_0161747 Ga0466961_0161747_630_824 61
174 3300044693 Ga0466961_0216935 Ga0466961_0216935_204_392 61
175 3300044693 Ga0466961_0565297 Ga0466961_0565297_242_436 61
176 3300044706 Ga0466964_0162126 Ga0466964_0162126_710_904 61
177 3300044706 Ga0466964_0230186 Ga0466964_0230186_263_457 61
178 3300044719 Ga0466971_0123170 Ga0466971_0123170_115_309 61
179 3300044719 Ga0466971_0394712 Ga0466971_0394712_258_452 61
180 3300044735 Ga0466968_0132824 Ga0466968_0132824_752_946 61
181 3300044765 Ga0466970_0333357 Ga0466970_0333357_21_215 61
182 3300044842 Ga0466957_0000121 Ga0466957_0000121_2531_2719 61
183 3300044842 Ga0466957_0529670 Ga0466957_0529670_161_355 61
184 3300044842 Ga0466957_1042795 Ga0466957_1042795_161_355 61
185 3300044901 Ga0466960_0381743 Ga0466960_0381743_46_240 61
186 3300044901 Ga0466960_0757908 Ga0466960_0757908_301_495 61
187 3300045049 Ga0466959_0049330 Ga0466959_0049330_1639_1833 61
188 3300045049 Ga0466959_0052265 Ga0466959_0052265_1932_2126 61
189 3300045049 Ga0466959_0203124 Ga0466959_0203124_173_367 61
190 3300045836 Ga0466958_0144378 Ga0466958_0144378_857_1051 61
191 3300045836 Ga0466958_0435364 Ga0466958_0435364_486_680 61
192 3300045836 Ga0466958_0550757 Ga0466958_0550757_254_451 61
193 3300045836 Ga0466958_1029453 Ga0466958_1029453_37_231 61
194 3300045976 Ga0466967_0022225 Ga0466967_0022225_272_466 61
195 3300045976 Ga0466967_1476267 Ga0466967_1476267_126_320 61
196 3300046455 Ga0495603_0015152 Ga0495603_0015152_1050_1238 61
197 3300046457 Ga0495590_0000351 Ga0495590_0000351_18431_18619 61
198 3300046457 Ga0495590_0018350 Ga0495590_0018350_285_473 61
199 3300046460 Ga0495638_0069291 Ga0495638_0069291_881_1069 61
200 3300046463 Ga0495653_0029347 Ga0495653_0029347_1913_2101 61
201 3300046463 Ga0495653_0101394 Ga0495653_0101394_595_783 61
202 3300046472 Ga0495580_0116060 Ga0495580_0116060_1638_1826 61
203 3300046472 Ga0495580_0373532 Ga0495580_0373532_313_501 61
204 3300046474 Ga0495605_0000130 Ga0495605_0000130_97114_97308 61
205 3300046474 Ga0495605_0035728 Ga0495605_0035728_999_1187 61
206 3300046477 Ga0495664_0440544 Ga0495664_0440544_206_394 61
207 3300046491 Ga0495584_0127048 Ga0495584_0127048_301_489 61
208 3300046499 Ga0495594_0034155 Ga0495594_0034155_208_396 61
209 3300046499 Ga0495594_0194867 Ga0495594_0194867_132_320 61
210 3300046501 Ga0495607_0003771 Ga0495607_0003771_1552_1746 61
211 3300046501 Ga0495607_0045162 Ga0495607_0045162_1676_1864 61
212 3300046501 Ga0495607_0048968 Ga0495607_0048968_139_333 61
213 3300046506 Ga0495583_0086307 Ga0495583_0086307_352_540 61
214 3300046507 Ga0495606_0013357 Ga0495606_0013357_6008_6196 61
215 3300046507 Ga0495606_0189323 Ga0495606_0189323_80_274 61
216 3300046513 Ga0495616_0051467 Ga0495616_0051467_379_567 61
217 3300046517 Ga0495630_0204651 Ga0495630_0204651_790_978 61
218 3300046518 Ga0495631_0029496 Ga0495631_0029496_1591_1779 61
219 3300046522 Ga0495643_0017494 Ga0495643_0017494_2518_2712 61
220 3300046522 Ga0495643_0039859 Ga0495643_0039859_1365_1553 61
221 3300046522 Ga0495643_0116173 Ga0495643_0116173_1140_1334 61
222 3300046522 Ga0495643_0329494 Ga0495643_0329494_244_438 61
223 3300046524 Ga0495648_0063987 Ga0495648_0063987_1117_1311 61
224 3300046526 Ga0495666_0002773 Ga0495666_0002773_5877_6065 61
225 3300046526 Ga0495666_0059723 Ga0495666_0059723_791_979 61
226 3300046526 Ga0495666_0227323 Ga0495666_0227323_214_405 61
227 3300046528 Ga0495642_0001734 Ga0495642_0001734_8117_8305 61
228 3300046529 Ga0495652_0057178 Ga0495652_0057178_2678_2866 61
229 3300046530 Ga0495654_0260549 Ga0495654_0260549_11_199 61
230 3300046531 Ga0495665_0022066 Ga0495665_0022066_754_942 61
231 3300046531 Ga0495665_0540095 Ga0495665_0540095_298_486 61
232 3300046535 Ga0495586_0021945 Ga0495586_0021945_2282_2470 61
233 3300046536 Ga0495587_0071730 Ga0495587_0071730_394_582 61
234 3300046536 Ga0495587_0137111 Ga0495587_0137111_326_514 61
235 3300046536 Ga0495587_0184448 Ga0495587_0184448_383_571 61
236 3300046542 Ga0495597_0016852 Ga0495597_0016852_1547_1753 61
237 3300046542 Ga0495597_0019193 Ga0495597_0019193_2308_2511 61
238 3300046543 Ga0495645_0185021 Ga0495645_0185021_489_677 61
239 3300046557 Ga0495622_0000313 Ga0495622_0000313_12511_12699 61
240 3300046616 Ga0495668_0033381 Ga0495668_0033381_2053_2241 61
241 3300046642 Ga0495634_0048924 Ga0495634_0048924_298_486 61
242 3300046660 Ga0495625_0279633 Ga0495625_0279633_69_257 61
243 3300046665 Ga0495661_0034138 Ga0495661_0034138_1327_1515 61
244 3300046665 Ga0495661_0039378 Ga0495661_0039378_160_354 61
245 3300046665 Ga0495661_0488922 Ga0495661_0488922_388_576 61
246 3300046674 Ga0495588_0371690 Ga0495588_0371690_148_336 61
247 3300046674 Ga0495588_0392610 Ga0495588_0392610_176_364 61
248 3300046678 Ga0495599_0647049 Ga0495599_0647049_377_565 61
249 3300046679 Ga0495623_0013663 Ga0495623_0013663_1219_1410 61
250 3300046679 Ga0495623_0041950 Ga0495623_0041950_1092_1280 61
251 3300046689 Ga0495613_0274683 Ga0495613_0274683_675_863 61
252 3300046690 Ga0495624_0038663 Ga0495624_0038663_1135_1323 61
253 3300046692 Ga0495671_0000109 Ga0495671_0000109_51223_51426 61
254 3300046794 Ga0495589_0000034 Ga0495589_0000034_41880_42074 61
255 3300046794 Ga0495589_0053074 Ga0495589_0053074_652_840 61
256 3300046810 Ga0495660_0008054 Ga0495660_0008054_5175_5369 61
257 3300046810 Ga0495660_0042127 Ga0495660_0042127_852_1046 61
258 3300047315 Ga0495581_0003117 Ga0495581_0003117_4224_4412 61
259 3300047315 Ga0495581_0077854 Ga0495581_0077854_1119_1307 61
260 3300047315 Ga0495581_0530015 Ga0495581_0530015_272_460 61
261 3300047317 Ga0495604_0025156 Ga0495604_0025156_129_317 61
262 3300047320 Ga0495672_0000244 Ga0495672_0000244_59767_59970 61
263 3300047320 Ga0495672_0107072 Ga0495672_0107072_244_438 61
264 3300047322 Ga0495680_0107112 Ga0495680_0107112_195_383 61
265 3300047323 Ga0495683_0093148 Ga0495683_0093148_1128_1322 61
266 3300047443 Ga0495687_000535 Ga0495687_000535_4399_4593 61
267 3300047443 Ga0495687_000550 Ga0495687_000550_12530_12721 61
268 3300047444 Ga0495675_0033927 Ga0495675_0033927_2348_2536 61
269 3300047444 Ga0495675_0231960 Ga0495675_0231960_214_402 61
270 3300047444 Ga0495675_0442231 Ga0495675_0442231_537_725 61
271 3300047445 Ga0495677_0003378 Ga0495677_0003378_4691_4885 61
272 3300047445 Ga0495677_0028108 Ga0495677_0028108_699_887 61
273 3300047447 Ga0495685_061540 Ga0495685_061540_834_1022 61
274 3300047470 Ga0495681_0165564 Ga0495681_0165564_588_776 61
275 3300048088 Ga0495602_0019960 Ga0495602_0019960_4748_4936 61
276 3300048091 Ga0495626_0000037 Ga0495626_0000037_1478_1672 61
277 3300048091 Ga0495626_0164901 Ga0495626_0164901_689_877 61
278 3300048903 Ga0496100_0876345 Ga0496100_0876345_490_684 61
279 3300048905 Ga0496102_0357868 Ga0496102_0357868_60_254 61
280 3300048905 Ga0496102_0423092 Ga0496102_0423092_145_339 61
281 3300048905 Ga0496102_0989710 Ga0496102_0989710_556_750 61
282 3300048908 Ga0496105_0090364 Ga0496105_0090364_1423_1617 61
283 3300048909 Ga0496106_0224057 Ga0496106_0224057_1135_1329 61
284 3300048911 Ga0496108_1606227 Ga0496108_1606227_326_520 61
285 3300048913 Ga0496110_0546455 Ga0496110_0546455_674_868 61
286 3300048914 Ga0496111_0456094 Ga0496111_0456094_34_240 61
287 3300048914 Ga0496111_1058166 Ga0496111_1058166_305_499 61
288 3300048916 Ga0496113_0240165 Ga0496113_0240165_1101_1316 61
289 3300048916 Ga0496113_0344536 Ga0496113_0344536_158_352 61
290 3300048916 Ga0496113_0722599 Ga0496113_0722599_283_471 61
291 3300048916 Ga0496113_0851956 Ga0496113_0851956_289_483 61
292 3300048925 Ga0496122_0034913 Ga0496122_0034913_202_417 61
293 3300048925 Ga0496122_0110900 Ga0496122_0110900_113_307 61
294 3300048925 Ga0496122_0408700 Ga0496122_0408700_218_412 61
295 3300048926 Ga0496123_0118447 Ga0496123_0118447_121_336 61
296 3300048926 Ga0496123_0363983 Ga0496123_0363983_199_393 61
297 3300048927 Ga0496124_0021280 Ga0496124_0021280_5319_5513 61
298 3300048928 Ga0496125_0164534 Ga0496125_0164534_155_370 61
299 3300049581 Ga0501047_0323369 Ga0501047_0323369_142_336 61
300 3300049669 Ga0501235_047561 Ga0501235_047561_491_694 61
301 3300049822 Ga0501035_0269816 Ga0501035_0269816_1222_1416 61
302 3300049823 Ga0501044_0222077 Ga0501044_0222077_1133_1327 61
303 3300059508 Ga0587088_181204 Ga0587088_181204_14_208 61
304 3300061719 Ga0466962_0091706 Ga0466962_0091706_1143_1337 61
305 3300061719 Ga0466962_0132195 Ga0466962_0132195_180_374 61
306 3300003771 Ga0055526_1000514 Ga0055526_10005149 62
307 3300003771 Ga0055526_1046184 Ga0055526_10461842 62
308 3300003773 Ga0055537_1000098 Ga0055537_100009834 62
309 3300003775 Ga0055524_1024990 Ga0055524_10249901 62
310 3300003784 Ga0055534_1000009 Ga0055534_1000009172 62
311 3300003790 Ga0055528_1000012 Ga0055528_10000128 62
312 3300004625 Ga0055543_1012413 Ga0055543_10124132 62
313 3300005262 Ga0065165_1000051 Ga0065165_100005126 62
314 3300006177 Ga0075362_10072624 Ga0075362_100726241 62
315 3300006946 Ga0079104_1004117 Ga0079104_10041173 62
316 3300009036 Ga0105244_10003601 Ga0105244_100036017 62
317 3300009176 Ga0105242_11470153 Ga0105242_114701532 62
318 3300009177 Ga0105248_10479800 Ga0105248_104798002 62
319 3300013102 Ga0157371_10000060 Ga0157371_1000006051 62
320 3300014325 Ga0163163_12495755 Ga0163163_124957551 62
321 3300014497 Ga0182008_10182501 Ga0182008_101825012 62
322 3300015261 Ga0182006_1000054 Ga0182006_100005426 62
323 3300015261 Ga0182006_1049374 Ga0182006_10493743 62
324 3300015262 Ga0182007_10107553 Ga0182007_101075532 62
325 3300015262 Ga0182007_10287233 Ga0182007_102872331 62
326 3300015265 Ga0182005_1000012 Ga0182005_1000012211 62
327 3300025208 Ga0209436_112786 Ga0209436_1127862 62
328 3300025263 Ga0209565_1000015 Ga0209565_1000015447 62
329 3300025273 Ga0209673_1000017 Ga0209673_1000017338 62
330 3300025284 Ga0209130_1000063 Ga0209130_1000063172 62
331 3300025291 Ga0209675_1000012 Ga0209675_100001235 62
332 3300025295 Ga0209564_1000016 Ga0209564_1000016148 62
333 3300025295 Ga0209564_1038206 Ga0209564_10382062 62
334 3300025299 Ga0209256_1000593 Ga0209256_100059315 62
335 3300025728 Ga0207655_1030945 Ga0207655_10309452 62
336 3300030731 Ga0316177_1065105 Ga0316177_10651052 62
337 3300030735 Ga0316178_1014113 Ga0316178_10141132 62
338 3300030736 Ga0316180_1061982 Ga0316180_10619824 62
339 3300030744 Ga0316181_1085165 Ga0316181_10851652 62
340 3300030744 Ga0316181_1092946 Ga0316181_10929461 62
341 3300030745 Ga0316182_1088262 Ga0316182_10882626 62
342 3300030745 Ga0316182_1220829 Ga0316182_12208292 62
343 3300031548 Ga0307408_100030755 Ga0307408_1000307554 62
344 3300033180 Ga0307510_10473307 Ga0307510_104733072 62
345 3300042115 Ga0450911_038606 Ga0450911_038606_377_574 62
346 3300042145 Ga0450906_014413 Ga0450906_014413_461_649 62
347 3300042157 Ga0439458_0101782 Ga0439458_0101782_504_701 62
348 3300046453 Ga0495627_000007 Ga0495627_000007_151292_151486 62
349 3300046457 Ga0495590_0000005 Ga0495590_0000005_155367_155561 62
350 3300046457 Ga0495590_0010773 Ga0495590_0010773_823_1023 62
351 3300046460 Ga0495638_0000027 Ga0495638_0000027_37404_37598 62
352 3300046460 Ga0495638_0039487 Ga0495638_0039487_904_1104 62
353 3300046471 Ga0495650_0005067 Ga0495650_0005067_6631_6825 62
354 3300046475 Ga0495639_0069061 Ga0495639_0069061_736_930 62
355 3300046491 Ga0495584_0002296 Ga0495584_0002296_7818_8009 62
356 3300046491 Ga0495584_0023153 Ga0495584_0023153_1588_1788 62
357 3300046491 Ga0495584_0100451 Ga0495584_0100451_603_797 62
358 3300046491 Ga0495584_0139500 Ga0495584_0139500_848_1042 62
359 3300046492 Ga0495585_0127958 Ga0495585_0127958_232_426 62
360 3300046500 Ga0495596_0102206 Ga0495596_0102206_30_224 62
361 3300046501 Ga0495607_0000720 Ga0495607_0000720_7191_7385 62
362 3300046501 Ga0495607_0002353 Ga0495607_0002353_1059_1259 62
363 3300046501 Ga0495607_0137713 Ga0495607_0137713_793_987 62
364 3300046506 Ga0495583_0000100 Ga0495583_0000100_81352_81546 62
365 3300046507 Ga0495606_0000907 Ga0495606_0000907_1602_1796 62
366 3300046507 Ga0495606_0018908 Ga0495606_0018908_3819_4010 62
367 3300046512 Ga0495610_0035653 Ga0495610_0035653_695_889 62
368 3300046512 Ga0495610_0194909 Ga0495610_0194909_88_282 62
369 3300046513 Ga0495616_0020730 Ga0495616_0020730_683_883 62
370 3300046522 Ga0495643_0272232 Ga0495643_0272232_170_364 62
371 3300046522 Ga0495643_0477760 Ga0495643_0477760_229_429 62
372 3300046524 Ga0495648_0000002 Ga0495648_0000002_250814_251008 62
373 3300046528 Ga0495642_0004425 Ga0495642_0004425_4269_4463 62
374 3300046528 Ga0495642_0111773 Ga0495642_0111773_883_1083 62
375 3300046538 Ga0495609_0000055 Ga0495609_0000055_336_530 62
376 3300046538 Ga0495609_0028210 Ga0495609_0028210_273_473 62
377 3300046538 Ga0495609_0085173 Ga0495609_0085173_959_1153 62
378 3300046542 Ga0495597_0084364 Ga0495597_0084364_352_552 62
379 3300046557 Ga0495622_0000128 Ga0495622_0000128_37056_37250 62
380 3300046557 Ga0495622_0099555 Ga0495622_0099555_265_459 62
381 3300046558 Ga0495633_0000031 Ga0495633_0000031_89793_89987 62
382 3300046558 Ga0495633_0000050 Ga0495633_0000050_125831_126025 62
383 3300046558 Ga0495633_0033913 Ga0495633_0033913_710_904 62
384 3300046616 Ga0495668_0019952 Ga0495668_0019952_1778_1978 62
385 3300046616 Ga0495668_0024796 Ga0495668_0024796_2472_2666 62
386 3300046660 Ga0495625_0000121 Ga0495625_0000121_4330_4524 62
387 3300046660 Ga0495625_0019207 Ga0495625_0019207_272_472 62
388 3300046660 Ga0495625_0020342 Ga0495625_0020342_4392_4586 62
389 3300046664 Ga0495659_0003883 Ga0495659_0003883_840_1040 62
390 3300046665 Ga0495661_0016832 Ga0495661_0016832_33_221 62
391 3300046665 Ga0495661_0053510 Ga0495661_0053510_272_472 62
392 3300046665 Ga0495661_0070618 Ga0495661_0070618_1052_1240 62
393 3300046665 Ga0495661_0411478 Ga0495661_0411478_125_319 62
394 3300046674 Ga0495588_0000041 Ga0495588_0000041_375451_375639 62
395 3300046684 Ga0495669_0002327 Ga0495669_0002327_4965_5165 62
396 3300046691 Ga0495670_0130447 Ga0495670_0130447_353_547 62
397 3300046694 Ga0495649_0044576 Ga0495649_0044576_1791_1991 62
398 3300046810 Ga0495660_0000107 Ga0495660_0000107_34415_34612 62
399 3300046810 Ga0495660_0001714 Ga0495660_0001714_8227_8421 62
400 3300046810 Ga0495660_0032759 Ga0495660_0032759_1633_1827 62
401 3300046810 Ga0495660_0102499 Ga0495660_0102499_696_896 62
402 3300047318 Ga0495636_0005832 Ga0495636_0005832_832_1032 62
403 3300047443 Ga0495687_000023 Ga0495687_000023_174617_174808 62
404 3300047443 Ga0495687_001509 Ga0495687_001509_8577_8771 62
405 3300047443 Ga0495687_022915 Ga0495687_022915_1585_1785 62
406 3300047445 Ga0495677_0009634 Ga0495677_0009634_1778_1978 62
407 3300047445 Ga0495677_0101464 Ga0495677_0101464_609_803 62
408 3300047447 Ga0495685_017670 Ga0495685_017670_2142_2342 62
409 3300047470 Ga0495681_0025025 Ga0495681_0025025_964_1158 62
410 3300047470 Ga0495681_0042289 Ga0495681_0042289_1778_1972 62
411 3300047470 Ga0495681_0072981 Ga0495681_0072981_273_473 62
412 3300048903 Ga0496100_0244275 Ga0496100_0244275_484_678 62
413 3300048906 Ga0496103_0001094 Ga0496103_0001094_3466_3657 62
414 3300048917 Ga0496114_0040880 Ga0496114_0040880_111_302 62
415 3300048919 Ga0496116_0026712 Ga0496116_0026712_1841_2035 62
416 3300048927 Ga0496124_0029090 Ga0496124_0029090_186_383 62
417 3300048927 Ga0496124_0030139 Ga0496124_0030139_1192_1386 62
418 3300049130 Ga0501310_043633 Ga0501310_043633_419_613 62
419 3300049459 Ga0495678_000004 Ga0495678_000004_158083_158277 62
420 3300049459 Ga0495678_029020 Ga0495678_029020_253_447 62
421 3300049459 Ga0495678_121519 Ga0495678_121519_47_241 62
422 3300049679 Ga0501249_006731 Ga0501249_006731_519_740 62
423 3300049679 Ga0501249_014645 Ga0501249_014645_1112_1306 62
424 3300049707 Ga0501234_107218 Ga0501234_107218_126_347 62
425 3300049766 Ga0501269_000036 Ga0501269_000036_3951_4145 62
426 3300050489 nmdc:mga03683_17796_c1 nmdc:mga03683_17796_c1_225_413 62
427 3300002739 JGI25158J39367_1005056 JGI25158J39367_10050562 63
428 3300002987 JGI25159J45721_1003893 JGI25159J45721_10038934 63
429 3300003374 JGI25161J50226_1000542 JGI25161J50226_10005422 63
430 3300004625 Ga0055543_1000760 Ga0055543_10007602 63
431 3300005262 Ga0065165_1003498 Ga0065165_100349811 63
432 3300005327 Ga0070658_11588707 Ga0070658_115887071 63
433 3300005564 Ga0070664_102403498 Ga0070664_1024034981 63
434 3300013307 Ga0157372_10673428 Ga0157372_106734282 63
435 3300025208 Ga0209436_100099 Ga0209436_10009921 63
436 3300025284 Ga0209130_1001327 Ga0209130_10013277 63
437 3300025302 Ga0207426_1116192 Ga0207426_11161921 63
438 3300031548 Ga0307408_100000115 Ga0307408_10000011563 63
439 3300031548 Ga0307408_101035150 Ga0307408_1010351502 63
440 3300031901 Ga0307406_11688384 Ga0307406_116883842 63
441 3300046501 Ga0495607_0079564 Ga0495607_0079564_1533_1748 63
442 3300046507 Ga0495606_0014188 Ga0495606_0014188_1509_1724 63
443 3300046528 Ga0495642_0060610 Ga0495642_0060610_488_703 63
444 3300046530 Ga0495654_0038592 Ga0495654_0038592_268_477 63
445 3300046538 Ga0495609_0017845 Ga0495609_0017845_1679_1894 63
446 3300046542 Ga0495597_0005636 Ga0495597_0005636_4221_4412 63
447 3300046664 Ga0495659_0000204 Ga0495659_0000204_2796_3005 63
448 3300046680 Ga0495646_0144343 Ga0495646_0144343_1004_1204 63
449 3300046810 Ga0495660_0000860 Ga0495660_0000860_16524_16739 63
450 3300047472 Ga0495686_0001420 Ga0495686_0001420_24942_25154 63
451 3300047472 Ga0495686_0041981 Ga0495686_0041981_2226_2441 63
452 3300049775 Ga0501279_011679 Ga0501279_011679_720_911 63
453 3300049853 Ga0501226_021430 Ga0501226_021430_366_557 63

Feature Viewer

pLDDT pTM Quality
77.74 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map