metagRoot

F447284

General Info

Members	Datasets	Scaffolds	Average Seq Length
453	287	906	300

Family's Representative Sequence

Representative Sequence	3300053078\|Ga0495612_0056991\|Ga0495612_0056991_211_1272
Length	353
Sequence	VIRVRVVLDRLQWGQRPERGWGFALVPSWMRNFRRSLERRSGQVEKDEGRDAMTMLQSGGAAAPASVVKDTTTQTFVKDVIEESKRQPVLVDFWAEWCGPCKQLAPVLEKAVHAAKGKVKLVKMDIDKHPSIPGQLGIQSIPAVFAFVNGQPIDGFLGALPESQITAFIERVTKDRIGGEEKDLLKSADDALAKGDAAGAADLYARVLAQDSANVAALAGLARSYVRTGAIEQAKQTLSLVPEAKRNDAAVAAARAALEVAEQAKSVGPISELEQKVAANPLDHQGRFDLAVALNSKGRRAEAVDHLLEIVKRDRKWNDDGARKQLVQFFEAWGPTDEATVNGRKRLSSILFS

Samples

	Sample ID	Description	Type	Environment
1	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
2	3300001977	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5	Metagenome	Rhizosphere
3	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
4	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
5	3300002070	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4	Metagenome	Rhizosphere
6	3300002074	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1	Metagenome	Rhizosphere
7	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
8	3300002076	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3	Metagenome	Rhizosphere
9	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
10	3300002239	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2	Metagenome	Rhizosphere
11	3300002459	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6	Metagenome	Rhizosphere
12	3300003911	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
13	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
14	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
15	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
16	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
17	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
18	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
19	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
20	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
21	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
22	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
23	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
24	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
25	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
26	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
27	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
28	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
29	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
30	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
31	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
32	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
33	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
34	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
35	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
36	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
37	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
38	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
39	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
40	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
41	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
42	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
43	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
44	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
45	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
46	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
47	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
48	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
49	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
50	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
51	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
52	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
53	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
54	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
55	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
56	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
57	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
58	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
59	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
60	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
61	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
62	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
63	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
64	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
65	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
66	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
67	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
68	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
69	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
70	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
71	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
72	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
73	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
74	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
75	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
76	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
77	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
78	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
79	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
80	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
81	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
82	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
83	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
84	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
85	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
86	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
87	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
88	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
89	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
90	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
91	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
92	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
93	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
94	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
95	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
96	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
97	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
98	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
99	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
100	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
101	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
102	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
103	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
104	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
105	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
106	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
160	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
161	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
162	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
163	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
164	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
165	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
166	3300030763	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
167	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
168	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
169	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
170	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
171	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
172	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
173	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
174	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
175	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
176	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
177	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
178	3300035120	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5	Metagenome	Rhizosphere
179	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
180	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
181	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
182	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
183	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
184	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
185	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
186	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
187	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
188	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
189	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
190	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
191	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
192	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
193	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
194	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
195	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
196	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
197	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
198	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
199	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
200	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
201	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
202	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
203	3300046537	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere	Metagenome	Rhizosphere
204	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
205	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
206	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
207	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
208	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
209	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
210	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
211	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
212	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
213	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
214	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
215	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
216	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
217	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
218	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
219	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
220	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
221	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
222	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
223	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
224	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
225	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
226	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
227	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
228	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
229	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
230	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
231	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
232	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
233	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
234	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
235	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
236	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
237	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
238	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
239	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
240	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
241	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
242	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
243	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
244	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
245	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
246	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
247	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
248	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
249	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
250	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
251	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
252	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
253	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
254	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
255	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
256	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
257	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
258	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
259	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
260	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
261	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
262	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
263	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
264	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
265	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
266	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
267	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
268	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
269	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
270	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
271	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
272	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
273	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
274	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
275	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
276	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
277	3300053104	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere	Metagenome	Endosphere
278	3300053108	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere	Metagenome	Endosphere
279	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
280	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
281	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
282	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
283	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
284	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
285	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere
286	2643221651	Afipia sp. Root123D2	Isolate	Unclassified
287	2828305725	Xanthobacter tagetidis DSM 11105	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	99.34
Metatranscriptomes	0.22
Isolates	0.44

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	5.74
Nodule	0
Rhizoplane	13.47
Rhizosphere	77.04
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	Ga0495612_0056991	3300053078	Bacteria	1613
2	JGI24746J21847_1014934	3300001977	Bacteria	1119
3	JGI24739J22299_10041293	3300001989	Bacteria	1535
4	JGI24737J22298_10024127	3300001990	Bacteria	1926
5	JGI24750J21931_1000880	3300002070	Bacteria	4119
6	JGI24748J21848_1002003	3300002074	Bacteria	2272
7	JGI24738J21930_10004396	3300002075	Bacteria	3458
8	JGI24749J21850_1008452	3300002076	Bacteria	1435
9	JGI24744J21845_10010455	3300002077	Bacteria	1901
10	JGI24034J26672_10000600	3300002239	Bacteria	4611
11	JGI24751J29686_10002730	3300002459	Bacteria	3550
12	JGI25405J52794_10019493	3300003911	Bacteria	1361
13	Ga0070683_100216301	3300005329	Bacteria	1821
14	Ga0070690_100088044	3300005330	Bacteria	2041
15	Ga0070670_100019905	3300005331	Bacteria	5762
16	Ga0070670_100030263	3300005331	Bacteria	4662
17	Ga0070666_10019164	3300005335	Bacteria	4414
18	Ga0070680_100034138	3300005336	Bacteria	4102
19	Ga0070682_100064714	3300005337	Bacteria	2322
20	Ga0068868_100009632	3300005338	Bacteria	6968
21	Ga0070689_100001113	3300005340	Bacteria	16894
22	Ga0070691_10013770	3300005341	Bacteria	3711
23	Ga0070691_10017047	3300005341	Bacteria	3342
24	Ga0070661_100190529	3300005344	Bacteria	1564
25	Ga0070661_100264957	3300005344	Bacteria	1329
26	Ga0070668_100106057	3300005347	Bacteria	2232
27	Ga0070675_100041608	3300005354	Bacteria	3753
28	Ga0070671_100118334	3300005355	Bacteria	2228
29	Ga0070671_100221989	3300005355	Bacteria	1603
30	Ga0070673_100081888	3300005364	Bacteria	2618
31	Ga0070688_100003643	3300005365	Bacteria	7952
32	Ga0070659_100001009	3300005366	Bacteria	20680
33	Ga0070659_100014206	3300005366	Bacteria	5945
34	Ga0070659_100039958	3300005366	Bacteria	3664
35	Ga0070659_100068097	3300005366	Bacteria	2823
36	Ga0070667_100018744	3300005367	Bacteria	5740
37	Ga0070709_10011931	3300005434	Bacteria	4854
38	Ga0070713_100022225	3300005436	Bacteria	4898
39	Ga0070710_10040092	3300005437	Bacteria	2580
40	Ga0070711_100054692	3300005439	Bacteria	2755
41	Ga0070711_100220440	3300005439	Bacteria	1474
42	Ga0070700_100014616	3300005441	Bacteria	4435
43	Ga0070708_100070839	3300005445	Bacteria	3137
44	Ga0070663_100364017	3300005455	Bacteria	1174
45	Ga0070678_100114404	3300005456	Bacteria	2116
46	Ga0070662_100125759	3300005457	Bacteria	1970
47	Ga0070681_10018764	3300005458	Bacteria	6922
48	Ga0070681_10177629	3300005458	Bacteria	2051
49	Ga0070685_10024364	3300005466	Bacteria	3322
50	Ga0070679_100101586	3300005530	Bacteria	2862
51	Ga0070679_100165039	3300005530	Bacteria	2188
52	Ga0070684_100116116	3300005535	Bacteria	2404
53	Ga0070697_100164626	3300005536	Bacteria	1875
54	Ga0070697_100509463	3300005536	Bacteria	1053
55	Ga0068853_100028340	3300005539	Bacteria	4710
56	Ga0070672_100005101	3300005543	Bacteria	8662
57	Ga0070695_100000933	3300005545	Bacteria	15790
58	Ga0070696_100006042	3300005546	Bacteria	8082
59	Ga0070696_100182470	3300005546	Bacteria	1557
60	Ga0070696_100183163	3300005546	Bacteria	1555
61	Ga0070665_100000721	3300005548	Bacteria	44003
62	Ga0070665_100471818	3300005548	Bacteria	1265
63	Ga0070704_100084497	3300005549	Bacteria	2346
64	Ga0068855_100043012	3300005563	Bacteria	5353
65	Ga0070664_100125795	3300005564	Bacteria	2248
66	Ga0070664_100238575	3300005564	Bacteria	1631
67	Ga0068857_100200332	3300005577	Bacteria	1820
68	Ga0068854_100025402	3300005578	Bacteria	4064
69	Ga0068856_100093435	3300005614	Bacteria	2993
70	Ga0070702_100038401	3300005615	Bacteria	2666
71	Ga0068852_100104910	3300005616	Bacteria	2559
72	Ga0068859_100037368	3300005617	Bacteria	4873
73	Ga0068864_100001978	3300005618	Bacteria	16866
74	Ga0068864_100053510	3300005618	Bacteria	3482
75	Ga0068864_100210267	3300005618	Bacteria	1791
76	Ga0068866_10021973	3300005718	Bacteria	2946
77	Ga0068870_10002723	3300005840	Bacteria	7414
78	Ga0068863_100002977	3300005841	Bacteria	16752
79	Ga0068863_100131194	3300005841	Bacteria	2393
80	Ga0068858_100006382	3300005842	Bacteria	11488
81	Ga0068860_100039042	3300005843	Bacteria	4542
82	Ga0068860_100213595	3300005843	Bacteria	1872
83	Ga0081455_10001354	3300005937	Bacteria	30285
84	Ga0081455_10022825	3300005937	Bacteria	5836
85	Ga0081455_10209485	3300005937	Bacteria	1453
86	Ga0081538_10006350	3300005981	Bacteria	10426
87	Ga0081538_10047491	3300005981	Bacteria	2632
88	Ga0081540_1003104	3300005983	Bacteria	13307
89	Ga0081540_1017267	3300005983	Bacteria	4475
90	Ga0081540_1027873	3300005983	Bacteria	3188
91	Ga0070717_10041991	3300006028	Bacteria	3730
92	Ga0070717_10058212	3300006028	Bacteria	3195
93	Ga0070717_10087097	3300006028	Bacteria	2630
94	Ga0075364_10086505	3300006051	Bacteria	2077
95	Ga0070715_10005759	3300006163	Bacteria	4163
96	Ga0070715_10018973	3300006163	Bacteria	2630
97	Ga0070712_100003713	3300006175	Bacteria	9405
98	Ga0070712_100065650	3300006175	Bacteria	2577
99	Ga0070712_100183449	3300006175	Bacteria	1632
100	Ga0075362_10058170	3300006177	Bacteria	1743
101	Ga0075367_10077024	3300006178	Bacteria	2013
102	Ga0075366_10200880	3300006195	Bacteria	1213
103	Ga0097621_100035832	3300006237	Bacteria	3966
104	Ga0075370_10042602	3300006353	Bacteria	2564
105	Ga0075428_100138489	3300006844	Bacteria	2646
106	Ga0075428_100177074	3300006844	Bacteria	2310
107	Ga0075428_100254940	3300006844	Bacteria	1890
108	Ga0075430_100144106	3300006846	Bacteria	1984
109	Ga0075430_100259738	3300006846	Bacteria	1439
110	Ga0075431_100008522	3300006847	Bacteria	10266
111	Ga0075431_100055492	3300006847	Bacteria	4087
112	Ga0075431_100072114	3300006847	Bacteria	3563
113	Ga0075431_100076115	3300006847	Bacteria	3463
114	Ga0075431_100221313	3300006847	Bacteria	1931
115	Ga0075431_100294533	3300006847	Bacteria	1640
116	Ga0075433_10070240	3300006852	Bacteria	3077
117	Ga0075434_100085714	3300006871	Bacteria	3150
118	Ga0075434_100146777	3300006871	Bacteria	2379
119	Ga0075434_100389078	3300006871	Bacteria	1415
120	Ga0075434_100489955	3300006871	Bacteria	1250
121	Ga0068865_100002365	3300006881	Bacteria	11133
122	Ga0075436_100135189	3300006914	Bacteria	1731
123	Ga0075436_100307581	3300006914	Bacteria	1137
124	Ga0075436_100337178	3300006914	Bacteria	1085
125	Ga0097620_100037368	3300006931	Bacteria	4873
126	Ga0075435_100012162	3300007076	Bacteria	6364
127	Ga0075435_100161166	3300007076	Bacteria	1889
128	Ga0099794_10011365	3300007265	Bacteria	3809
129	Ga0105251_10077458	3300009011	Bacteria	1542
130	Ga0105250_10049324	3300009092	Bacteria	1688
131	Ga0105240_10009648	3300009093	Bacteria	13651
132	Ga0105240_10066752	3300009093	Bacteria	4461
133	Ga0111539_10051046	3300009094	Bacteria	4927
134	Ga0111539_10107341	3300009094	Bacteria	3276
135	Ga0111539_10128354	3300009094	Bacteria	2970
136	Ga0105247_10003234	3300009101	Bacteria	10720
137	Ga0105247_10061831	3300009101	Bacteria	2322
138	Ga0114129_10004544	3300009147	Bacteria	19590
139	Ga0114129_10011617	3300009147	Bacteria	12537
140	Ga0114129_10048513	3300009147	Bacteria	5966
141	Ga0114129_10055643	3300009147	Bacteria	5544
142	Ga0114129_10164727	3300009147	Bacteria	3026
143	Ga0105243_10038174	3300009148	Bacteria	3739
144	Ga0105248_10000650	3300009177	Bacteria	39474
145	Ga0105248_10016004	3300009177	Bacteria	8257
146	Ga0105248_10191160	3300009177	Bacteria	2307
147	Ga0105237_10116478	3300009545	Bacteria	2665
148	Ga0105238_10057017	3300009551	Bacteria	3917
149	Ga0105238_10133756	3300009551	Bacteria	2458
150	Ga0105238_10190917	3300009551	Bacteria	2024
151	Ga0105249_10009082	3300009553	Bacteria	8692
152	Ga0105249_10274699	3300009553	Bacteria	1680
153	Ga0105239_10461933	3300010375	Bacteria	1441
154	Ga0105239_10717540	3300010375	Bacteria	1143
155	Ga0157373_10000756	3300013100	Bacteria	25102
156	Ga0157374_10005986	3300013296	Bacteria	10292
157	Ga0157375_10009835	3300013308	Bacteria	8410
158	Ga0163163_10095123	3300014325	Bacteria	2998
159	Ga0163163_10172347	3300014325	Bacteria	2210
160	Ga0157377_10004874	3300014745	Bacteria	6241
161	Ga0157379_10029061	3300014968	Bacteria	4915
162	Ga0157376_10035109	3300014969	Bacteria	4054
163	Ga0163161_10062893	3300017792	Bacteria	2704
164	Ga0207656_10157741	3300025321	Bacteria	1078
165	Ga0207642_10001597	3300025899	Bacteria	6979
166	Ga0207710_10007024	3300025900	Bacteria	4784
167	Ga0207688_10003415	3300025901	Bacteria	8665
168	Ga0207647_10121430	3300025904	Bacteria	1540
169	Ga0207685_10001099	3300025905	Bacteria	5357
170	Ga0207699_10014408	3300025906	Bacteria	4075
171	Ga0207699_10066957	3300025906	Bacteria	2182
172	Ga0207643_10000591	3300025908	Bacteria	23005
173	Ga0207684_10224704	3300025910	Bacteria	1620
174	Ga0207707_10152178	3300025912	Bacteria	2022
175	Ga0207707_10298247	3300025912	Bacteria	1394
176	Ga0207695_10000269	3300025913	Bacteria	130183
177	Ga0207695_10001168	3300025913	Bacteria	45314
178	Ga0207695_10002758	3300025913	Bacteria	25593
179	Ga0207695_10048752	3300025913	Bacteria	4471
180	Ga0207671_10240810	3300025914	Bacteria	1421
181	Ga0207693_10002485	3300025915	Bacteria	16030
182	Ga0207693_10072946	3300025915	Bacteria	2687
183	Ga0207693_10078876	3300025915	Bacteria	2577
184	Ga0207693_10130276	3300025915	Bacteria	1977
185	Ga0207663_10161539	3300025916	Bacteria	1582
186	Ga0207663_10312962	3300025916	Bacteria	1177
187	Ga0207660_10003585	3300025917	Bacteria	10109
188	Ga0207662_10039841	3300025918	Bacteria	2758
189	Ga0207657_10019403	3300025919	Bacteria	6456
190	Ga0207649_10036791	3300025920	Bacteria	2951
191	Ga0207652_10093743	3300025921	Bacteria	2643
192	Ga0207652_10401782	3300025921	Bacteria	1236
193	Ga0207646_10108689	3300025922	Bacteria	2488
194	Ga0207681_10018703	3300025923	Bacteria	4369
195	Ga0207694_10048691	3300025924	Bacteria	3279
196	Ga0207650_10002307	3300025925	Bacteria	13287
197	Ga0207659_10043236	3300025926	Bacteria	3163
198	Ga0207687_10006331	3300025927	Bacteria	7824
199	Ga0207700_10116732	3300025928	Bacteria	2157
200	Ga0207644_10011626	3300025931	Bacteria	5829
201	Ga0207690_10000031	3300025932	Bacteria	154724
202	Ga0207690_10121759	3300025932	Bacteria	1896
203	Ga0207706_10009334	3300025933	Bacteria	9006
204	Ga0207706_10017459	3300025933	Bacteria	6466
205	Ga0207709_10030094	3300025935	Bacteria	3156
206	Ga0207670_10026550	3300025936	Bacteria	3651
207	Ga0207669_10005520	3300025937	Bacteria	5683
208	Ga0207704_10001150	3300025938	Bacteria	11768
209	Ga0207704_10030899	3300025938	Bacteria	3010
210	Ga0207665_10004102	3300025939	Bacteria	9717
211	Ga0207691_10001627	3300025940	Bacteria	22294
212	Ga0207711_10000368	3300025941	Bacteria	47898
213	Ga0207711_10022268	3300025941	Bacteria	5298
214	Ga0207711_10154428	3300025941	Bacteria	2073
215	Ga0207689_10007012	3300025942	Bacteria	9907
216	Ga0207661_10259196	3300025944	Bacteria	1548
217	Ga0207679_10122921	3300025945	Bacteria	2069
218	Ga0207679_10131670	3300025945	Bacteria	2007
219	Ga0207651_10007000	3300025960	Bacteria	5973
220	Ga0207712_10006136	3300025961	Bacteria	7574
221	Ga0207712_10099134	3300025961	Bacteria	2163
222	Ga0207712_10155010	3300025961	Bacteria	1773
223	Ga0207668_10496542	3300025972	Bacteria	1049
224	Ga0207640_10353448	3300025981	Bacteria	1181
225	Ga0207703_10027862	3300026035	Bacteria	4449
226	Ga0207639_10023179	3300026041	Bacteria	4480
227	Ga0207678_10161702	3300026067	Bacteria	1912
228	Ga0207708_10001502	3300026075	Bacteria	17383
229	Ga0207702_10026295	3300026078	Bacteria	4831
230	Ga0207641_10124846	3300026088	Bacteria	2303
231	Ga0207641_10289916	3300026088	Bacteria	1542
232	Ga0207648_10006668	3300026089	Bacteria	11454
233	Ga0207676_10015019	3300026095	Bacteria	5582
234	Ga0207676_10085969	3300026095	Bacteria	2568
235	Ga0207674_10180201	3300026116	Bacteria	2064
236	Ga0207675_100013475	3300026118	Bacteria	7630
237	Ga0207698_10111062	3300026142	Bacteria	2297
238	Ga0209179_1004005	3300027512	Bacteria	2185
239	Ga0268266_10000003	3300028379	Bacteria	1701703
240	Ga0268265_10039894	3300028380	Bacteria	3463
241	Ga0268264_10025917	3300028381	Bacteria	4786
242	Ga0307517_10006083	3300028786	Bacteria	17981
243	Ga0265338_10166063	3300028800	Bacteria	1699
244	Ga0265338_10195947	3300028800	Bacteria	1527
245	Ga0265763_1000592	3300030763	Bacteria	2268
246	Ga0265325_10007376	3300031241	Bacteria	6585
247	Ga0265327_10026840	3300031251	Bacteria	3327
248	Ga0307513_10006509	3300031456	Bacteria	15255
249	Ga0265313_10000008	3300031595	Bacteria	173405
250	Ga0265314_10097176	3300031711	Bacteria	1903
251	Ga0307416_100598683	3300032002	Bacteria	1182
252	Ga0307510_10023326	3300033180	Bacteria	7174
253	Ga0373926_0086935	3300035083	Bacteria	1160
254	Ga0373945_0046662	3300035116	Bacteria	1581
255	Ga0373953_0031810	3300035117	Bacteria	2054
256	Ga0373956_0026405	3300035119	Bacteria	2515
257	Ga0373957_0082614	3300035120	Bacteria	1270
258	Ga0373943_0096189	3300035170	Bacteria	1541
259	Ga0373943_0242179	3300035170	Bacteria	1011
260	Ga0373946_0025065	3300035171	Bacteria	2344
261	Ga0373931_0183004	3300035691	Bacteria	1242
262	Ga0373935_0041729	3300035692	Bacteria	2883
263	Ga0373927_0000111	3300035695	Bacteria	62031
264	Ga0373947_0010803	3300035725	Bacteria	5239
265	Ga0373937_0247011	3300036401	Bacteria	1682
266	Ga0373925_0000209	3300037068	Bacteria	64086
267	Ga0373925_0460091	3300037068	Bacteria	1042
268	Ga0395898_0144116	3300037466	Bacteria	2280
269	Ga0395905_0000453	3300037471	Bacteria	57443
270	Ga0436364_0485261	3300037853	Bacteria	4562
271	Ga0436364_1231270	3300037853	Bacteria	1090
272	Ga0400483_274856	3300039062	Bacteria	2452
273	Ga0436365_0043364	3300039437	Bacteria	2364
274	Ga0451853_2338745	3300041512	Bacteria	1342
275	Ga0466957_0007274	3300044842	Bacteria	6256
276	Ga0495629_0092608	3300046459	Bacteria	2109
277	Ga0495582_0031270	3300046473	Bacteria	2925
278	Ga0495662_0047098	3300046476	Bacteria	2082
279	Ga0495585_0010439	3300046492	Bacteria	5527
280	Ga0495585_0136957	3300046492	Bacteria	1285
281	Ga0495594_0140988	3300046499	Bacteria	1367
282	Ga0495630_0258133	3300046517	Bacteria	1331
283	Ga0495631_0046786	3300046518	Bacteria	1901
284	Ga0495663_0046624	3300046525	Bacteria	1332
285	Ga0495665_0073018	3300046531	Bacteria	1807
286	Ga0495598_0044864	3300046537	Bacteria	1307
287	Ga0495633_0013321	3300046558	Bacteria	4339
288	Ga0495633_0147511	3300046558	Bacteria	1087
289	Ga0495670_0004845	3300046691	Bacteria	6606
290	Ga0495670_0014749	3300046691	Bacteria	3846
291	Ga0495649_0105576	3300046694	Bacteria	1495
292	Ga0495581_0020895	3300047315	Bacteria	3799
293	Ga0495674_0469883	3300047319	Bacteria	1009
294	Ga0495672_0107354	3300047320	Bacteria	1504
295	Ga0495679_013119	3300047446	Bacteria	3124
296	Ga0495686_0023957	3300047472	Bacteria	4014
297	Ga0495593_0097561	3300047673	Bacteria	1509
298	Ga0496100_0007617	3300048903	Bacteria	5988
299	Ga0496100_0046713	3300048903	Bacteria	2786
300	Ga0496100_0067557	3300048903	Bacteria	2375
301	Ga0496100_0234671	3300048903	Bacteria	1351
302	Ga0496101_0000879	3300048904	Bacteria	17685
303	Ga0496101_0010122	3300048904	Bacteria	6218
304	Ga0496101_0072349	3300048904	Bacteria	2531
305	Ga0496101_0149803	3300048904	Bacteria	1784
306	Ga0496101_0452909	3300048904	Bacteria	1012
307	Ga0496102_0008462	3300048905	Bacteria	8821
308	Ga0496102_0011826	3300048905	Bacteria	7533
309	Ga0496102_0024604	3300048905	Bacteria	5354
310	Ga0496102_0200122	3300048905	Bacteria	1883
311	Ga0496103_0001968	3300048906	Bacteria	13279
312	Ga0496103_0007237	3300048906	Bacteria	6615
313	Ga0496104_0000671	3300048907	Bacteria	29392
314	Ga0496104_0004384	3300048907	Bacteria	12293
315	Ga0496104_0055533	3300048907	Bacteria	3744
316	Ga0496105_0001999	3300048908	Bacteria	14708
317	Ga0496105_0005181	3300048908	Bacteria	9880
318	Ga0496105_0015753	3300048908	Bacteria	6033
319	Ga0496105_0199507	3300048908	Bacteria	1633
320	Ga0496106_0003496	3300048909	Bacteria	11703
321	Ga0496106_0009176	3300048909	Bacteria	7304
322	Ga0496106_0011510	3300048909	Bacteria	6542
323	Ga0496107_0008551	3300048910	Bacteria	7083
324	Ga0496107_0016841	3300048910	Bacteria	5138
325	Ga0496107_0018195	3300048910	Bacteria	4945
326	Ga0496107_0224329	3300048910	Bacteria	1398
327	Ga0496107_0291804	3300048910	Bacteria	1214
328	Ga0496108_0000347	3300048911	Bacteria	39108
329	Ga0496108_0013218	3300048911	Bacteria	6727
330	Ga0496108_0018394	3300048911	Bacteria	5720
331	Ga0496108_0032557	3300048911	Bacteria	4330
332	Ga0496108_0378062	3300048911	Bacteria	1237
333	Ga0496109_0006103	3300048912	Bacteria	10123
334	Ga0496109_0032495	3300048912	Bacteria	4691
335	Ga0496109_0045633	3300048912	Bacteria	3977
336	Ga0496109_0053695	3300048912	Bacteria	3675
337	Ga0496109_0242919	3300048912	Bacteria	1695
338	Ga0496109_0284546	3300048912	Bacteria	1558
339	Ga0496110_0000339	3300048913	Bacteria	31235
340	Ga0496110_0012105	3300048913	Bacteria	7086
341	Ga0496110_0021611	3300048913	Bacteria	5452
342	Ga0496110_0039621	3300048913	Bacteria	4103
343	Ga0496110_0096972	3300048913	Bacteria	2642
344	Ga0496111_0001676	3300048914	Bacteria	12899
345	Ga0496111_0004594	3300048914	Bacteria	8738
346	Ga0496111_0008552	3300048914	Bacteria	6781
347	Ga0496111_0017366	3300048914	Bacteria	4975
348	Ga0496112_0004698	3300048915	Bacteria	11628
349	Ga0496112_0091509	3300048915	Bacteria	3010
350	Ga0496112_0114741	3300048915	Bacteria	2664
351	Ga0496112_0243265	3300048915	Bacteria	1751
352	Ga0496113_0000331	3300048916	Bacteria	22477
353	Ga0496113_0005262	3300048916	Bacteria	8057
354	Ga0496113_0015442	3300048916	Bacteria	5248
355	Ga0496114_0006125	3300048917	Bacteria	9463
356	Ga0496115_0056703	3300048918	Bacteria	3149
357	Ga0496115_0100161	3300048918	Bacteria	2375
358	Ga0496115_0164562	3300048918	Bacteria	1834
359	Ga0496116_0090822	3300048919	Bacteria	1858
360	Ga0496117_0051371	3300048920	Bacteria	2914
361	Ga0496118_0008376	3300048921	Bacteria	10695
362	Ga0496119_0069340	3300048922	Bacteria	2072
363	Ga0496121_0000042	3300048924	Bacteria	342304
364	Ga0496121_0000893	3300048924	Bacteria	53847
365	Ga0496121_0275783	3300048924	Bacteria	1153
366	Ga0501031_0152791	3300049568	Bacteria	1509
367	Ga0501033_0012161	3300049570	Bacteria	6570
368	Ga0501033_0061088	3300049570	Bacteria	2778
369	Ga0501034_0000286	3300049571	Bacteria	90126
370	Ga0501034_0081627	3300049571	Bacteria	3235
371	Ga0501039_0097094	3300049575	Bacteria	2298
372	Ga0501040_0108273	3300049576	Bacteria	1943
373	Ga0501041_0278318	3300049577	Bacteria	1053
374	Ga0501042_0202333	3300049578	Bacteria	1432
375	Ga0501043_0073528	3300049579	Bacteria	2685
376	Ga0501046_0106495	3300049580	Bacteria	2146
377	Ga0501047_0012196	3300049581	Bacteria	8136
378	Ga0501047_0026818	3300049581	Bacteria	5546
379	Ga0501068_0239120	3300049584	Bacteria	1156
380	Ga0501070_0029360	3300049586	Bacteria	4611
381	Ga0501070_0031336	3300049586	Bacteria	4455
382	Ga0501070_0079214	3300049586	Bacteria	2719
383	Ga0501072_0005274	3300049588	Bacteria	9844
384	Ga0501073_0318724	3300049589	Bacteria	1073
385	Ga0501074_0135174	3300049590	Bacteria	1764
386	Ga0501075_0009705	3300049591	Bacteria	6745
387	Ga0501075_0010739	3300049591	Bacteria	6448
388	Ga0501075_0110676	3300049591	Bacteria	2088
389	Ga0501076_0036177	3300049592	Bacteria	3867
390	Ga0501076_0194537	3300049592	Bacteria	1655
391	Ga0501076_0246445	3300049592	Bacteria	1462
392	Ga0501077_0007852	3300049593	Bacteria	6587
393	Ga0501077_0128318	3300049593	Bacteria	1608
394	Ga0501079_0001286	3300049741	Bacteria	17643
395	Ga0501080_0147261	3300049742	Bacteria	2177
396	Ga0501081_0010784	3300049743	Bacteria	5967
397	Ga0501081_0060620	3300049743	Bacteria	2622
398	Ga0501081_0094368	3300049743	Bacteria	2108
399	Ga0501083_0021080	3300049744	Bacteria	4530
400	Ga0501035_0000366	3300049822	Bacteria	52132
401	Ga0501044_0114162	3300049823	Bacteria	2707
402	nmdc:mga03683_19723_c1	3300050489	Bacteria	2108
403	nmdc:mga00v17_17145_c1	3300050491	Bacteria	4092
404	nmdc:mga00v17_188023_c1	3300050491	Bacteria	1333
405	nmdc:mga0yw44_239888_c1	3300050492	Bacteria	1205
406	nmdc:mga0k408_178271_c1	3300050493	Bacteria	1267
407	nmdc:mga06z11_27881_c1	3300050494	Bacteria	2704
408	nmdc:mga07m45_33295_c1	3300050496	Bacteria	2861
409	nmdc:mga05p37_117895_c1	3300050507	Bacteria	3262
410	nmdc:mga05p37_13689_c1	3300050507	Bacteria	9722
411	nmdc:mga05p37_343241_c1	3300050507	Bacteria	1760
412	nmdc:mga05p37_39438_c1	3300050507	Bacteria	5799
413	nmdc:mga09592_138830_c1	3300050508	Bacteria	2094
414	nmdc:mga09592_417833_c1	3300050508	Bacteria	1159
415	nmdc:mga0qj67_100890_c1	3300050509	Bacteria	2327
416	nmdc:mga0qj67_101636_c1	3300050509	Bacteria	2318
417	nmdc:mga0qj67_154920_c1	3300050509	Bacteria	1859
418	nmdc:mga06r32_146855_c1	3300050510	Bacteria	2335
419	nmdc:mga06r32_25000_c1	3300050510	Bacteria	5549
420	nmdc:mga06r32_58516_c1	3300050510	Bacteria	3704
421	nmdc:mga06r32_59274_c1	3300050510	Bacteria	3681
422	nmdc:mga06r32_594658_c1	3300050510	Bacteria	1078
423	nmdc:mga08y16_107915_c1	3300050511	Bacteria	2898
424	nmdc:mga0n895_170072_c1	3300050512	Bacteria	2211
425	nmdc:mga0n895_261288_c1	3300050512	Bacteria	1757
426	nmdc:mga0n895_558436_c1	3300050512	Bacteria	1150
427	nmdc:mga0rr50_7638_c1	3300050513	Bacteria	6686
428	nmdc:mga0a205_200052_c1	3300050515	Bacteria	1888
429	Ga0495619_0017196	3300053085	Bacteria	4581
430	Ga0495619_0032890	3300053085	Bacteria	3366
431	Ga0500643_000265	3300053087	Bacteria	46271
432	Ga0500643_010645	3300053087	Bacteria	3408
433	Ga0500647_0002985	3300053091	Bacteria	6478
434	Ga0500641_0001082	3300053096	Bacteria	9702
435	Ga0500555_002035	3300053103	Bacteria	5957
436	Ga0500556_0000688	3300053104	Bacteria	20792
437	Ga0500556_0014122	3300053104	Bacteria	2433
438	Ga0500562_001777	3300053108	Bacteria	5388
439	Ga0500562_040466	3300053108	Bacteria	1239
440	Ga0500618_000022	3300053125	Bacteria	157907
441	Ga0500616_0005399	3300053153	Bacteria	8678
442	Ga0500622_0009386	3300053156	Bacteria	5414
443	Ga0500645_000487	3300053730	Bacteria	26840
444	Ga0500645_001143	3300053730	Bacteria	14378
445	Ga0501084_0012824	3300054114	Bacteria	6943
446	Ga0501084_0106654	3300054114	Bacteria	2354
447	Ga0501082_0013537	3300060353	Bacteria	7008
448	Ga0501082_0101812	3300060353	Bacteria	2485
449	Ga0501082_0159009	3300060353	Bacteria	1963
450	Ga0530510_0006723	3300061734	Bacteria	8016
451	Ga0530510_0064977	3300061734	Bacteria	2643
452	2644290967	2643221651	Bacteria	4798932
453	2828306453	2828305725	Bacteria	4916900
454	Ga0495612_0056991
455	JGI24746J21847_1014934
456	JGI24739J22299_10041293
457	JGI24737J22298_10024127
458	JGI24750J21931_1000880
459	JGI24748J21848_1002003
460	JGI24738J21930_10004396
461	JGI24749J21850_1008452
462	JGI24744J21845_10010455
463	JGI24034J26672_10000600
464	JGI24751J29686_10002730
465	JGI25405J52794_10019493
466	Ga0070683_100216301
467	Ga0070690_100088044
468	Ga0070670_100019905
469	Ga0070670_100030263
470	Ga0070666_10019164
471	Ga0070680_100034138
472	Ga0070682_100064714
473	Ga0068868_100009632
474	Ga0070689_100001113
475	Ga0070691_10013770
476	Ga0070691_10017047
477	Ga0070661_100190529
478	Ga0070661_100264957
479	Ga0070668_100106057
480	Ga0070675_100041608
481	Ga0070671_100118334
482	Ga0070671_100221989
483	Ga0070673_100081888
484	Ga0070688_100003643
485	Ga0070659_100001009
486	Ga0070659_100014206
487	Ga0070659_100039958
488	Ga0070659_100068097
489	Ga0070667_100018744
490	Ga0070709_10011931
491	Ga0070713_100022225
492	Ga0070710_10040092
493	Ga0070711_100054692
494	Ga0070711_100220440
495	Ga0070700_100014616
496	Ga0070708_100070839
497	Ga0070663_100364017
498	Ga0070678_100114404
499	Ga0070662_100125759
500	Ga0070681_10018764
501	Ga0070681_10177629
502	Ga0070685_10024364
503	Ga0070679_100101586
504	Ga0070679_100165039
505	Ga0070684_100116116
506	Ga0070697_100164626
507	Ga0070697_100509463
508	Ga0068853_100028340
509	Ga0070672_100005101
510	Ga0070695_100000933
511	Ga0070696_100006042
512	Ga0070696_100182470
513	Ga0070696_100183163
514	Ga0070665_100000721
515	Ga0070665_100471818
516	Ga0070704_100084497
517	Ga0068855_100043012
518	Ga0070664_100125795
519	Ga0070664_100238575
520	Ga0068857_100200332
521	Ga0068854_100025402
522	Ga0068856_100093435
523	Ga0070702_100038401
524	Ga0068852_100104910
525	Ga0068859_100037368
526	Ga0068864_100001978
527	Ga0068864_100053510
528	Ga0068864_100210267
529	Ga0068866_10021973
530	Ga0068870_10002723
531	Ga0068863_100002977
532	Ga0068863_100131194
533	Ga0068858_100006382
534	Ga0068860_100039042
535	Ga0068860_100213595
536	Ga0081455_10001354
537	Ga0081455_10022825
538	Ga0081455_10209485
539	Ga0081538_10006350
540	Ga0081538_10047491
541	Ga0081540_1003104
542	Ga0081540_1017267
543	Ga0081540_1027873
544	Ga0070717_10041991
545	Ga0070717_10058212
546	Ga0070717_10087097
547	Ga0075364_10086505
548	Ga0070715_10005759
549	Ga0070715_10018973
550	Ga0070712_100003713
551	Ga0070712_100065650
552	Ga0070712_100183449
553	Ga0075362_10058170
554	Ga0075367_10077024
555	Ga0075366_10200880
556	Ga0097621_100035832
557	Ga0075370_10042602
558	Ga0075428_100138489
559	Ga0075428_100177074
560	Ga0075428_100254940
561	Ga0075430_100144106
562	Ga0075430_100259738
563	Ga0075431_100008522
564	Ga0075431_100055492
565	Ga0075431_100072114
566	Ga0075431_100076115
567	Ga0075431_100221313
568	Ga0075431_100294533
569	Ga0075433_10070240
570	Ga0075434_100085714
571	Ga0075434_100146777
572	Ga0075434_100389078
573	Ga0075434_100489955
574	Ga0068865_100002365
575	Ga0075436_100135189
576	Ga0075436_100307581
577	Ga0075436_100337178
578	Ga0097620_100037368
579	Ga0075435_100012162
580	Ga0075435_100161166
581	Ga0099794_10011365
582	Ga0105251_10077458
583	Ga0105250_10049324
584	Ga0105240_10009648
585	Ga0105240_10066752
586	Ga0111539_10051046
587	Ga0111539_10107341
588	Ga0111539_10128354
589	Ga0105247_10003234
590	Ga0105247_10061831
591	Ga0114129_10004544
592	Ga0114129_10011617
593	Ga0114129_10048513
594	Ga0114129_10055643
595	Ga0114129_10164727
596	Ga0105243_10038174
597	Ga0105248_10000650
598	Ga0105248_10016004
599	Ga0105248_10191160
600	Ga0105237_10116478
601	Ga0105238_10057017
602	Ga0105238_10133756
603	Ga0105238_10190917
604	Ga0105249_10009082
605	Ga0105249_10274699
606	Ga0105239_10461933
607	Ga0105239_10717540
608	Ga0157373_10000756
609	Ga0157374_10005986
610	Ga0157375_10009835
611	Ga0163163_10095123
612	Ga0163163_10172347
613	Ga0157377_10004874
614	Ga0157379_10029061
615	Ga0157376_10035109
616	Ga0163161_10062893
617	Ga0207656_10157741
618	Ga0207642_10001597
619	Ga0207710_10007024
620	Ga0207688_10003415
621	Ga0207647_10121430
622	Ga0207685_10001099
623	Ga0207699_10014408
624	Ga0207699_10066957
625	Ga0207643_10000591
626	Ga0207684_10224704
627	Ga0207707_10152178
628	Ga0207707_10298247
629	Ga0207695_10000269
630	Ga0207695_10001168
631	Ga0207695_10002758
632	Ga0207695_10048752
633	Ga0207671_10240810
634	Ga0207693_10002485
635	Ga0207693_10072946
636	Ga0207693_10078876
637	Ga0207693_10130276
638	Ga0207663_10161539
639	Ga0207663_10312962
640	Ga0207660_10003585
641	Ga0207662_10039841
642	Ga0207657_10019403
643	Ga0207649_10036791
644	Ga0207652_10093743
645	Ga0207652_10401782
646	Ga0207646_10108689
647	Ga0207681_10018703
648	Ga0207694_10048691
649	Ga0207650_10002307
650	Ga0207659_10043236
651	Ga0207687_10006331
652	Ga0207700_10116732
653	Ga0207644_10011626
654	Ga0207690_10000031
655	Ga0207690_10121759
656	Ga0207706_10009334
657	Ga0207706_10017459
658	Ga0207709_10030094
659	Ga0207670_10026550
660	Ga0207669_10005520
661	Ga0207704_10001150
662	Ga0207704_10030899
663	Ga0207665_10004102
664	Ga0207691_10001627
665	Ga0207711_10000368
666	Ga0207711_10022268
667	Ga0207711_10154428
668	Ga0207689_10007012
669	Ga0207661_10259196
670	Ga0207679_10122921
671	Ga0207679_10131670
672	Ga0207651_10007000
673	Ga0207712_10006136
674	Ga0207712_10099134
675	Ga0207712_10155010
676	Ga0207668_10496542
677	Ga0207640_10353448
678	Ga0207703_10027862
679	Ga0207639_10023179
680	Ga0207678_10161702
681	Ga0207708_10001502
682	Ga0207702_10026295
683	Ga0207641_10124846
684	Ga0207641_10289916
685	Ga0207648_10006668
686	Ga0207676_10015019
687	Ga0207676_10085969
688	Ga0207674_10180201
689	Ga0207675_100013475
690	Ga0207698_10111062
691	Ga0209179_1004005
692	Ga0268266_10000003
693	Ga0268265_10039894
694	Ga0268264_10025917
695	Ga0307517_10006083
696	Ga0265338_10166063
697	Ga0265338_10195947
698	Ga0265763_1000592
699	Ga0265325_10007376
700	Ga0265327_10026840
701	Ga0307513_10006509
702	Ga0265313_10000008
703	Ga0265314_10097176
704	Ga0307416_100598683
705	Ga0307510_10023326
706	Ga0373926_0086935
707	Ga0373945_0046662
708	Ga0373953_0031810
709	Ga0373956_0026405
710	Ga0373957_0082614
711	Ga0373943_0096189
712	Ga0373943_0242179
713	Ga0373946_0025065
714	Ga0373931_0183004
715	Ga0373935_0041729
716	Ga0373927_0000111
717	Ga0373947_0010803
718	Ga0373937_0247011
719	Ga0373925_0000209
720	Ga0373925_0460091
721	Ga0395898_0144116
722	Ga0395905_0000453
723	Ga0436364_0485261
724	Ga0436364_1231270
725	Ga0400483_274856
726	Ga0436365_0043364
727	Ga0451853_2338745
728	Ga0466957_0007274
729	Ga0495629_0092608
730	Ga0495582_0031270
731	Ga0495662_0047098
732	Ga0495585_0010439
733	Ga0495585_0136957
734	Ga0495594_0140988
735	Ga0495630_0258133
736	Ga0495631_0046786
737	Ga0495663_0046624
738	Ga0495665_0073018
739	Ga0495598_0044864
740	Ga0495633_0013321
741	Ga0495633_0147511
742	Ga0495670_0004845
743	Ga0495670_0014749
744	Ga0495649_0105576
745	Ga0495581_0020895
746	Ga0495674_0469883
747	Ga0495672_0107354
748	Ga0495679_013119
749	Ga0495686_0023957
750	Ga0495593_0097561
751	Ga0496100_0007617
752	Ga0496100_0046713
753	Ga0496100_0067557
754	Ga0496100_0234671
755	Ga0496101_0000879
756	Ga0496101_0010122
757	Ga0496101_0072349
758	Ga0496101_0149803
759	Ga0496101_0452909
760	Ga0496102_0008462
761	Ga0496102_0011826
762	Ga0496102_0024604
763	Ga0496102_0200122
764	Ga0496103_0001968
765	Ga0496103_0007237
766	Ga0496104_0000671
767	Ga0496104_0004384
768	Ga0496104_0055533
769	Ga0496105_0001999
770	Ga0496105_0005181
771	Ga0496105_0015753
772	Ga0496105_0199507
773	Ga0496106_0003496
774	Ga0496106_0009176
775	Ga0496106_0011510
776	Ga0496107_0008551
777	Ga0496107_0016841
778	Ga0496107_0018195
779	Ga0496107_0224329
780	Ga0496107_0291804
781	Ga0496108_0000347
782	Ga0496108_0013218
783	Ga0496108_0018394
784	Ga0496108_0032557
785	Ga0496108_0378062
786	Ga0496109_0006103
787	Ga0496109_0032495
788	Ga0496109_0045633
789	Ga0496109_0053695
790	Ga0496109_0242919
791	Ga0496109_0284546
792	Ga0496110_0000339
793	Ga0496110_0012105
794	Ga0496110_0021611
795	Ga0496110_0039621
796	Ga0496110_0096972
797	Ga0496111_0001676
798	Ga0496111_0004594
799	Ga0496111_0008552
800	Ga0496111_0017366
801	Ga0496112_0004698
802	Ga0496112_0091509
803	Ga0496112_0114741
804	Ga0496112_0243265
805	Ga0496113_0000331
806	Ga0496113_0005262
807	Ga0496113_0015442
808	Ga0496114_0006125
809	Ga0496115_0056703
810	Ga0496115_0100161
811	Ga0496115_0164562
812	Ga0496116_0090822
813	Ga0496117_0051371
814	Ga0496118_0008376
815	Ga0496119_0069340
816	Ga0496121_0000042
817	Ga0496121_0000893
818	Ga0496121_0275783
819	Ga0501031_0152791
820	Ga0501033_0012161
821	Ga0501033_0061088
822	Ga0501034_0000286
823	Ga0501034_0081627
824	Ga0501039_0097094
825	Ga0501040_0108273
826	Ga0501041_0278318
827	Ga0501042_0202333
828	Ga0501043_0073528
829	Ga0501046_0106495
830	Ga0501047_0012196
831	Ga0501047_0026818
832	Ga0501068_0239120
833	Ga0501070_0029360
834	Ga0501070_0031336
835	Ga0501070_0079214
836	Ga0501072_0005274
837	Ga0501073_0318724
838	Ga0501074_0135174
839	Ga0501075_0009705
840	Ga0501075_0010739
841	Ga0501075_0110676
842	Ga0501076_0036177
843	Ga0501076_0194537
844	Ga0501076_0246445
845	Ga0501077_0007852
846	Ga0501077_0128318
847	Ga0501079_0001286
848	Ga0501080_0147261
849	Ga0501081_0010784
850	Ga0501081_0060620
851	Ga0501081_0094368
852	Ga0501083_0021080
853	Ga0501035_0000366
854	Ga0501044_0114162
855	nmdc:mga03683_19723_c1
856	nmdc:mga00v17_17145_c1
857	nmdc:mga00v17_188023_c1
858	nmdc:mga0yw44_239888_c1
859	nmdc:mga0k408_178271_c1
860	nmdc:mga06z11_27881_c1
861	nmdc:mga07m45_33295_c1
862	nmdc:mga05p37_117895_c1
863	nmdc:mga05p37_13689_c1
864	nmdc:mga05p37_343241_c1
865	nmdc:mga05p37_39438_c1
866	nmdc:mga09592_138830_c1
867	nmdc:mga09592_417833_c1
868	nmdc:mga0qj67_100890_c1
869	nmdc:mga0qj67_101636_c1
870	nmdc:mga0qj67_154920_c1
871	nmdc:mga06r32_146855_c1
872	nmdc:mga06r32_25000_c1
873	nmdc:mga06r32_58516_c1
874	nmdc:mga06r32_59274_c1
875	nmdc:mga06r32_594658_c1
876	nmdc:mga08y16_107915_c1
877	nmdc:mga0n895_170072_c1
878	nmdc:mga0n895_261288_c1
879	nmdc:mga0n895_558436_c1
880	nmdc:mga0rr50_7638_c1
881	nmdc:mga0a205_200052_c1
882	Ga0495619_0017196
883	Ga0495619_0032890
884	Ga0500643_000265
885	Ga0500643_010645
886	Ga0500647_0002985
887	Ga0500641_0001082
888	Ga0500555_002035
889	Ga0500556_0000688
890	Ga0500556_0014122
891	Ga0500562_001777
892	Ga0500562_040466
893	Ga0500618_000022
894	Ga0500616_0005399
895	Ga0500622_0009386
896	Ga0500645_000487
897	Ga0500645_001143
898	Ga0501084_0012824
899	Ga0501084_0106654
900	Ga0501082_0013537
901	Ga0501082_0101812
902	Ga0501082_0159009
903	Ga0530510_0006723
904	Ga0530510_0064977
905	2644290967
906	2828306453

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14559

TPR_19

Tetratricopeptide repeat

191

258

0.98 PF14561

TPR_20

Tetratricopeptide repeat

263

352

0.98 PF00085

Thioredoxin

67

171

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2i4a-assembly1.cif.gz_A	crystal structure of thioredoxin from the acidophile acetobacter aceti	0.986	17	120
4cgq-assembly1.cif.gz_A	full length tah1 bound to hsp90 peptide srmeevd	0.9725	130	189
2yn1-assembly2.cif.gz_B	crystal structure of ancestral thioredoxin relative to last gamma- proteobacteria common ancestor (lgpca) from the precambrian period	0.9714	16	120
5hr1-assembly7.cif.gz_G	crystal structure of thioredoxin l107a mutant	0.9713	43	117
6nup-assembly1.cif.gz_A	structure of thioredoxin (trxa) from rickettsia prowazekii str. madrid e.	0.9695	17	121

ID	Description	Score	Start	End	Superfamily
af_P9WG61_44_154_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9717	16	124	3.40.30.10
af_Q9SEU7_68_173_3.40.30.10	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9605	18	123	3.40.30.10
1v98B00	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9582	37	123	3.40.30.10
4ulxA00	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9572	16	120	3.40.30.10
1thxA00	Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin	0.9496	15	122	3.40.30.10

ID	Description	Score	Start	End	GO Terms
AF-A0A842TT83-F1-model_v4	Thioredoxin	0.9857	19	120	GO:0005737 GO:0015035
AF-A0A2R5L2U2-F1-model_v4	Thioredoxin	0.9846	23	122	GO:0005739 GO:0015035 GO:0045454
AF-A0A3M7KS81-F1-model_v4	Thioredoxin domain-containing protein	0.9838	36	120	GO:0016668 GO:0097237
AF-A0A2M4AAG1-F1-model_v4	Putative thioredoxin mitochondrial	0.9802	23	121	GO:0005737 GO:0015035
AF-A0A2V1HFW6-F1-model_v4	deleted	0.9773	17	120

F447284

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF14559

TPR_19

Tetratricopeptide repeat

191

258

0.98

PF14561

TPR_20

Tetratricopeptide repeat

263

352

0.98

PF00085

Thioredoxin

Thioredoxin

67

171

0.95

Structural Annotation

Top 5 Hits

Map