F447301

General Info

Members Datasets Scaffolds Average Seq Length
453 275 906 153

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2941475908|2941478898
Length 165
Sequence YSNQRLRMTARKRYWLMKSEPDAFSIDDLQRVGREPWNGVRNYQARNFMRDGMKVGDGVMFYHSNTKVPGIVGLATVASEAYPDDTQFDPKSDYYDPKATREEPRWMLVDVAFERKLRDTISLDEIKLHADALGEGFPLTARGNRLSILPVTAAQWKLLLSLEKH

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
10 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
13 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
39 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300012476 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 Metagenome Rhizosphere
49 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
59 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
60 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
61 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
62 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
63 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
64 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
70 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
110 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
111 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
112 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
113 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
114 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
127 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
128 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
129 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
130 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
133 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
134 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
135 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
136 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
137 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
138 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
139 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
140 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
141 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
142 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
143 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
144 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
145 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
146 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
147 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
148 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
149 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
152 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
153 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
154 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
155 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
163 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
164 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
165 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
166 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
167 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
170 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
171 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
172 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
173 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
174 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
177 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
178 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
179 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
191 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
192 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
193 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
194 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
195 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
196 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
197 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
198 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
209 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
210 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
211 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
212 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
213 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
214 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
217 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
218 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
219 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
221 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
222 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
223 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
224 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
225 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
226 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
227 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
228 2643221559 Lysobacter sp. Root559 Isolate Unclassified
229 2643221573 Lysobacter sp. Root604 Isolate Unclassified
230 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
231 2643221586 Lysobacter sp. Root667 Isolate Unclassified
232 2643221593 Lysobacter sp. Root690 Isolate Unclassified
233 2643221612 Lysobacter sp. Root76 Isolate Unclassified
234 2643221695 Lysobacter sp. Root494 Isolate Unclassified
235 2643221720 Lysobacter sp. Root916 Isolate Unclassified
236 2643221727 Lysobacter sp. Root96 Isolate Unclassified
237 2643221728 Lysobacter sp. Root983 Isolate Unclassified
238 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
239 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
240 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
241 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
242 2818991457 Xanthomonas translucens 569 Isolate Unclassified
243 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
244 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
245 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
246 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
247 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
248 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
249 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
250 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
251 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
252 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
253 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
254 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
255 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
256 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
257 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
258 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
259 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
260 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
261 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
262 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
263 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
264 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
265 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
266 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
267 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
268 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
269 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
270 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
271 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
272 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
273 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
274 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
275 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.52
Metatranscriptomes 0
Isolates 11.48

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 17
Nodule 0.22
Rhizoplane 4.64
Rhizosphere 58.72
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3082486 2162886007 Bacteria 1739
2 JGI25152J39213_1001190 3300002773 Bacteria 11974
3 JGI25150J39212_1000714 3300002774 Bacteria 11902
4 JGI25150J39212_1021101 3300002774 Bacteria 996
5 JGI25151J46595_10000105 3300003187 Bacteria 113763
6 JGI25151J46595_10000116 3300003187 Bacteria 107172
7 JGI25153J46596_10000077 3300003215 Bacteria 113763
8 rootH2_10121715 3300003320 Bacteria 4556
9 JGI26145J50221_1015200 3300003371 Bacteria 710
10 Ga0055526_1000316 3300003771 Bacteria 40300
11 Ga0055526_1001846 3300003771 Bacteria 14660
12 Ga0055537_1000238 3300003773 Bacteria 40300
13 Ga0055537_1000526 3300003773 Bacteria 22324
14 Ga0055524_1000074 3300003775 Bacteria 122843
15 Ga0055524_1007046 3300003775 Bacteria 4826
16 Ga0055524_1032907 3300003775 Bacteria 1460
17 Ga0055536_1001527 3300003781 Bacteria 13876
18 Ga0055536_1001898 3300003781 Bacteria 12140
19 Ga0055536_1005035 3300003781 Bacteria 6565
20 Ga0055534_1000121 3300003784 Bacteria 57849
21 Ga0055534_1000231 3300003784 Bacteria 40300
22 Ga0055528_1000028 3300003790 Bacteria 122843
23 Ga0055528_1000148 3300003790 Bacteria 57842
24 Ga0055530_10000618 3300003791 Bacteria 30889
25 Ga0055530_10001089 3300003791 Bacteria 21346
26 Ga0055530_10001387 3300003791 Bacteria 17936
27 Ga0055540_1024867 3300003792 Bacteria 1478
28 Ga0055540_1076471 3300003792 Bacteria 647
29 Ga0055531_10002056 3300003794 Bacteria 13876
30 Ga0055531_10039059 3300003794 Bacteria 1415
31 Ga0055531_10039781 3300003794 Bacteria 1389
32 Ga0058692_1000013 3300003856 Bacteria 316299
33 Ga0058692_1000045 3300003856 Bacteria 115083
34 Ga0065714_10099633 3300005288 Bacteria 1682
35 Ga0065704_10001264 3300005289 Bacteria 8604
36 Ga0065704_10183855 3300005289 Bacteria 1223
37 Ga0065704_10255881 3300005289 Bacteria 977
38 Ga0065715_10001279 3300005293 Bacteria 7063
39 Ga0065715_10012881 3300005293 Bacteria 3459
40 Ga0065715_10101061 3300005293 Bacteria 3241
41 Ga0065715_10356514 3300005293 Bacteria 942
42 Ga0070658_11027595 3300005327 Bacteria 717
43 Ga0070670_100006122 3300005331 Bacteria 10172
44 Ga0070670_100026589 3300005331 Bacteria 4978
45 Ga0070677_10324702 3300005333 Bacteria 789
46 Ga0070680_100519123 3300005336 Bacteria 1020
47 Ga0070660_100841226 3300005339 Bacteria 773
48 Ga0070668_100007597 3300005347 Bacteria 8047
49 Ga0070669_100261404 3300005353 Bacteria 1381
50 Ga0070669_100447744 3300005353 Bacteria 1064
51 Ga0070671_100163823 3300005355 Bacteria 1880
52 Ga0070671_100177377 3300005355 Bacteria 1803
53 Ga0070674_100025257 3300005356 Bacteria 3866
54 Ga0070659_100451916 3300005366 Bacteria 1090
55 Ga0070659_100839398 3300005366 Bacteria 800
56 Ga0070667_100258096 3300005367 Bacteria 1560
57 Ga0070678_100049382 3300005456 Bacteria 3036
58 Ga0070662_100309568 3300005457 Bacteria 1285
59 Ga0070662_100492410 3300005457 Bacteria 1022
60 Ga0070679_100343741 3300005530 Bacteria 1440
61 Ga0070672_100061192 3300005543 Bacteria 2967
62 Ga0070665_100082364 3300005548 Bacteria 3223
63 Ga0070665_100164091 3300005548 Bacteria 2224
64 Ga0070665_100337924 3300005548 Bacteria 1510
65 Ga0070664_101267013 3300005564 Bacteria 696
66 Ga0081539_10051143 3300005985 Bacteria 2331
67 Ga0075365_10106405 3300006038 Bacteria 1925
68 Ga0075363_100146322 3300006048 Bacteria 1332
69 Ga0075363_100163499 3300006048 Bacteria 1261
70 Ga0075364_10001855 3300006051 Bacteria 11727
71 Ga0075364_10098345 3300006051 Bacteria 1947
72 Ga0075364_10473735 3300006051 Bacteria 856
73 Ga0075369_10278014 3300006186 Bacteria 780
74 Ga0105251_10000350 3300009011 Bacteria 45818
75 Ga0105251_10007580 3300009011 Bacteria 6661
76 Ga0105251_10158209 3300009011 Bacteria 1022
77 Ga0105244_10019377 3300009036 Bacteria 3800
78 Ga0105244_10157951 3300009036 Bacteria 1084
79 Ga0105243_10140978 3300009148 Bacteria 2057
80 Ga0105242_10120837 3300009176 Bacteria 2248
81 Ga0105242_10620958 3300009176 Bacteria 1047
82 Ga0105248_10694102 3300009177 Bacteria 1148
83 Ga0157344_1008232 3300012476 Bacteria 711
84 Ga0157326_1010732 3300012513 Bacteria 1025
85 Ga0157373_10158854 3300013100 Bacteria 1590
86 Ga0157373_10287536 3300013100 Bacteria 1166
87 Ga0157373_10403399 3300013100 Bacteria 980
88 Ga0157371_10000184 3300013102 Bacteria 92100
89 Ga0157371_10100030 3300013102 Bacteria 2056
90 Ga0157371_11176772 3300013102 Bacteria 590
91 Ga0157370_10004081 3300013104 Bacteria 16932
92 Ga0163162_10213689 3300013306 Bacteria 2059
93 Ga0163162_10309047 3300013306 Bacteria 1713
94 Ga0157372_10205487 3300013307 Bacteria 2282
95 Ga0157372_10431720 3300013307 Bacteria 1535
96 Ga0157375_10190473 3300013308 Bacteria 2206
97 Ga0157375_10324989 3300013308 Bacteria 1703
98 Ga0182008_10000939 3300014497 Bacteria 20309
99 Ga0182008_10015701 3300014497 Bacteria 3948
100 Ga0182006_1005214 3300015261 Bacteria 6229
101 Ga0182006_1006571 3300015261 Bacteria 5390
102 Ga0182006_1015640 3300015261 Bacteria 3249
103 Ga0182006_1033551 3300015261 Bacteria 2057
104 Ga0182006_1094828 3300015261 Bacteria 1067
105 Ga0182007_10000118 3300015262 Bacteria 54536
106 Ga0182005_1000268 3300015265 Bacteria 32952
107 Ga0182005_1002760 3300015265 Bacteria 6124
108 Ga0183360_10005 3300015689 Bacteria 73748
109 Ga0163161_10000766 3300017792 Bacteria 25292
110 Ga0163161_10020893 3300017792 Bacteria 4598
111 Ga0207425_1000045 3300025245 Bacteria 194257
112 Ga0207425_1001522 3300025245 Bacteria 9524
113 Ga0209129_1000057 3300025258 Bacteria 253632
114 Ga0209565_1000023 3300025263 Bacteria 388244
115 Ga0209565_1000034 3300025263 Bacteria 312950
116 Ga0209565_1003391 3300025263 Bacteria 5183
117 Ga0209673_1000039 3300025273 Bacteria 312950
118 Ga0209673_1000047 3300025273 Bacteria 289276
119 Ga0209130_1004089 3300025284 Bacteria 5750
120 Ga0209675_1000016 3300025291 Bacteria 391965
121 Ga0209675_1000023 3300025291 Bacteria 312950
122 Ga0209676_1000037 3300025292 Bacteria 457562
123 Ga0209676_1000160 3300025292 Bacteria 161069
124 Ga0209676_1000796 3300025292 Bacteria 41705
125 Ga0209676_1008927 3300025292 Bacteria 4401
126 Ga0209025_1000013 3300025294 Bacteria 871757
127 Ga0209025_1000023 3300025294 Bacteria 541307
128 Ga0209564_1000066 3300025295 Bacteria 312899
129 Ga0209564_1000194 3300025295 Bacteria 141518
130 Ga0209564_1005813 3300025295 Bacteria 6880
131 Ga0209564_1009492 3300025295 Bacteria 4622
132 Ga0209758_1000014 3300025297 Bacteria 871757
133 Ga0209758_1007000 3300025297 Bacteria 7846
134 Ga0209050_1000462 3300025298 Bacteria 72638
135 Ga0209050_1000971 3300025298 Bacteria 36685
136 Ga0209050_1002178 3300025298 Bacteria 17699
137 Ga0209050_1021158 3300025298 Bacteria 2383
138 Ga0209256_1000048 3300025299 Bacteria 312899
139 Ga0209256_1001572 3300025299 Bacteria 22464
140 Ga0209256_1012899 3300025299 Bacteria 3147
141 Ga0209256_1030593 3300025299 Bacteria 1484
142 Ga0209051_1001229 3300025303 Bacteria 23028
143 Ga0209051_1018477 3300025303 Bacteria 3084
144 Ga0209257_1000177 3300025304 Bacteria 161069
145 Ga0209257_1002904 3300025304 Bacteria 15851
146 Ga0209257_1003668 3300025304 Bacteria 12861
147 Ga0209257_1012637 3300025304 Bacteria 3872
148 Ga0207655_1036411 3300025728 Bacteria 2182
149 Ga0207713_1001094 3300025735 Bacteria 23219
150 Ga0207713_1007090 3300025735 Bacteria 6705
151 Ga0207660_10407029 3300025917 Bacteria 1096
152 Ga0207657_10088666 3300025919 Bacteria 2585
153 Ga0207652_10467491 3300025921 Bacteria 1136
154 Ga0207681_10081906 3300025923 Bacteria 2280
155 Ga0207650_10004216 3300025925 Bacteria 9819
156 Ga0207664_10399833 3300025929 Bacteria 1222
157 Ga0207644_10011719 3300025931 Bacteria 5804
158 Ga0207644_10213746 3300025931 Bacteria 1526
159 Ga0207706_10496903 3300025933 Bacteria 1053
160 Ga0207686_10128983 3300025934 Bacteria 1732
161 Ga0207686_10179660 3300025934 Bacteria 1500
162 Ga0207709_10004945 3300025935 Bacteria 7628
163 Ga0207669_10043720 3300025937 Bacteria 2626
164 Ga0207691_10052571 3300025940 Bacteria 3720
165 Ga0207679_10783461 3300025945 Bacteria 869
166 Ga0207668_10005933 3300025972 Bacteria 7197
167 Ga0207668_10051063 3300025972 Bacteria 2854
168 Ga0207658_10389167 3300025986 Bacteria 1223
169 Ga0207683_10050168 3300026121 Bacteria 3654
170 Ga0209973_1016208 3300027252 Bacteria 948
171 Ga0209371_1000007 3300027312 Bacteria 1050654
172 Ga0209371_1000043 3300027312 Bacteria 331009
173 Ga0209969_1009644 3300027360 Bacteria 1377
174 Ga0209967_1007640 3300027364 Bacteria 1481
175 Ga0209981_1011502 3300027378 Bacteria 1220
176 Ga0209984_1003891 3300027424 Bacteria 1733
177 Ga0210000_1001273 3300027462 Bacteria 3547
178 Ga0209995_1040331 3300027471 Bacteria 788
179 Ga0209999_1008572 3300027543 Bacteria 1845
180 Ga0209982_1009860 3300027552 Bacteria 1414
181 Ga0209970_1033303 3300027614 Bacteria 901
182 Ga0209983_1002456 3300027665 Bacteria 4061
183 Ga0209971_1004124 3300027682 Bacteria 3442
184 Ga0209974_10011227 3300027876 Bacteria 3015
185 Ga0209974_10016927 3300027876 Bacteria 2420
186 Ga0209974_10048569 3300027876 Bacteria 1423
187 Ga0268266_10076388 3300028379 Bacteria 2911
188 Ga0268266_10121246 3300028379 Bacteria 2327
189 Ga0268266_10149749 3300028379 Bacteria 2102
190 Ga0268266_10302387 3300028379 Bacteria 1493
191 Ga0268256_1000008 3300030500 Bacteria 1050654
192 Ga0268256_1000044 3300030500 Bacteria 330997
193 Ga0316177_1175300 3300030731 Bacteria 1788
194 Ga0316176_1162259 3300030732 Bacteria 3629
195 Ga0314311_1000677 3300030733 Bacteria 6629
196 Ga0316183_1206264 3300030742 Bacteria 11216
197 Ga0316182_1019679 3300030745 Bacteria 982
198 Ga0316182_1362052 3300030745 Bacteria 830
199 Ga0307408_100023984 3300031548 Bacteria 4160
200 Ga0307408_100063368 3300031548 Bacteria 2704
201 Ga0307408_100273830 3300031548 Bacteria 1403
202 Ga0316579_10153153 3300031691 Bacteria 1113
203 Ga0307405_10508768 3300031731 Bacteria 967
204 Ga0307413_10034057 3300031824 Bacteria 2907
205 Ga0307413_10071304 3300031824 Bacteria 2189
206 Ga0307413_10092925 3300031824 Bacteria 1970
207 Ga0307413_10185595 3300031824 Bacteria 1488
208 Ga0307413_10213934 3300031824 Bacteria 1402
209 Ga0307410_10045344 3300031852 Bacteria 2927
210 Ga0307406_10019579 3300031901 Bacteria 3974
211 Ga0307406_10065325 3300031901 Bacteria 2364
212 Ga0307406_10099739 3300031901 Bacteria 1975
213 Ga0307412_11850244 3300031911 Bacteria 556
214 Ga0307409_100360604 3300031995 Bacteria 1375
215 Ga0307416_101444744 3300032002 Bacteria 793
216 Ga0307414_10068551 3300032004 Bacteria 2546
217 Ga0307414_10155474 3300032004 Bacteria 1809
218 Ga0307414_10155702 3300032004 Bacteria 1808
219 Ga0307414_10182223 3300032004 Bacteria 1690
220 Ga0307414_10257331 3300032004 Bacteria 1454
221 Ga0307414_10299799 3300032004 Bacteria 1359
222 Ga0307414_11203142 3300032004 Bacteria 701
223 Ga0307415_100484739 3300032126 Bacteria 1077
224 Ga0307415_100565125 3300032126 Bacteria 1006
225 Ga0307415_101540152 3300032126 Bacteria 637
226 Ga0316584_0461146 3300036712 Bacteria 897
227 Ga0395899_0090731 3300037312 Bacteria 2215
228 Ga0395900_0059445 3300037418 Bacteria 3935
229 Ga0395900_0119331 3300037418 Bacteria 2707
230 Ga0395900_1113651 3300037418 Bacteria 707
231 Ga0395898_0122644 3300037466 Bacteria 2490
232 Ga0395905_0000337 3300037471 Bacteria 67116
233 Ga0395905_0140970 3300037471 Bacteria 2267
234 Ga0395905_0250607 3300037471 Bacteria 1654
235 Ga0395905_0344163 3300037471 Bacteria 1382
236 Ga0395905_0346762 3300037471 Bacteria 1376
237 Ga0395905_0840195 3300037471 Bacteria 821
238 Ga0395901_0080345 3300038443 Bacteria 3404
239 Ga0395901_0591262 3300038443 Bacteria 1120
240 Ga0237819_00396 3300038705 Bacteria 15189
241 Ga0237819_13140 3300038705 Bacteria 1005
242 Ga0439436_0002225 3300041404 Bacteria 5810
243 Ga0439436_0007475 3300041404 Bacteria 3362
244 Ga0439439_0001774 3300041406 Bacteria 4405
245 Ga0439439_0029704 3300041406 Bacteria 1387
246 Ga0439447_000227 3300041407 Bacteria 19837
247 Ga0439447_046686 3300041407 Bacteria 1042
248 Ga0451789_0848378 3300041443 Bacteria 880
249 Ga0451791_0533041 3300041451 Bacteria 752
250 Ga0451791_1460006 3300041451 Bacteria 824
251 Ga0451793_0078272 3300041452 Bacteria 705
252 Ga0451793_1307872 3300041452 Bacteria 3444
253 Ga0451798_0925201 3300041458 Bacteria 1111
254 Ga0451800_0091515 3300041459 Bacteria 3212
255 Ga0451806_164866 3300041462 Bacteria 3715
256 Ga0451804_1174625 3300041463 Bacteria 3132
257 Ga0451807_1057439 3300041486 Bacteria 525
258 Ga0451807_1371999 3300041486 Bacteria 1399
259 Ga0451837_0813783 3300041494 Bacteria 586
260 Ga0451837_1425707 3300041494 Bacteria 1310
261 Ga0451837_1517053 3300041494 Bacteria 1312
262 Ga0451837_1576145 3300041494 Bacteria 768
263 Ga0451841_0983776 3300041498 Bacteria 1068
264 Ga0451843_0668074 3300041509 Bacteria 4548
265 Ga0451843_0794872 3300041509 Bacteria 1504
266 Ga0451843_1675506 3300041509 Bacteria 655
267 Ga0451853_0473773 3300041512 Bacteria 997
268 Ga0439445_0117468 3300042004 Bacteria 762
269 Ga0439432_006342 3300042006 Bacteria 4232
270 Ga0439432_007168 3300042006 Bacteria 3961
271 Ga0439449_0015477 3300042007 Bacteria 2866
272 Ga0439449_0030258 3300042007 Bacteria 2017
273 Ga0439462_0023620 3300042015 Bacteria 1612
274 Ga0450899_020705 3300042135 Bacteria 768
275 Ga0450905_002492 3300042142 Bacteria 2366
276 Ga0439434_0049454 3300042435 Bacteria 1302
277 Ga0450901_004280 3300042533 Bacteria 1478
278 Ga0466967_1639985 3300045976 Bacteria 640
279 Ga0495591_061334 3300046458 Bacteria 998
280 Ga0495638_0001816 3300046460 Bacteria 18521
281 Ga0495607_0014288 3300046501 Bacteria 5175
282 Ga0495583_0330608 3300046506 Bacteria 603
283 Ga0495606_0003699 3300046507 Bacteria 15988
284 Ga0495610_0006190 3300046512 Bacteria 8317
285 Ga0495616_0178097 3300046513 Bacteria 946
286 Ga0495616_0271243 3300046513 Bacteria 723
287 Ga0495631_0009026 3300046518 Bacteria 4997
288 Ga0495631_0353136 3300046518 Bacteria 626
289 Ga0495643_0001888 3300046522 Bacteria 17752
290 Ga0495663_0003944 3300046525 Bacteria 4225
291 Ga0495663_0010379 3300046525 Bacteria 2591
292 Ga0495663_0030665 3300046525 Bacteria 1594
293 Ga0495598_0001993 3300046537 Bacteria 4150
294 Ga0495621_0057296 3300046539 Bacteria 1407
295 Ga0495621_0059048 3300046539 Bacteria 1389
296 Ga0495622_0365959 3300046557 Bacteria 623
297 Ga0495633_0007055 3300046558 Bacteria 6541
298 Ga0495633_0021722 3300046558 Bacteria 3206
299 Ga0495633_0055952 3300046558 Bacteria 1854
300 Ga0495633_0133063 3300046558 Bacteria 1151
301 Ga0495633_0380898 3300046558 Bacteria 638
302 Ga0495668_0002539 3300046616 Bacteria 14886
303 Ga0495625_0436383 3300046660 Bacteria 811
304 Ga0495659_0016016 3300046664 Bacteria 2469
305 Ga0495659_0050925 3300046664 Bacteria 1507
306 Ga0495660_0014248 3300046810 Bacteria 4604
307 Ga0495660_0330836 3300046810 Bacteria 682
308 Ga0495636_0015757 3300047318 Bacteria 3013
309 Ga0495636_0017607 3300047318 Bacteria 2860
310 Ga0495672_0000720 3300047320 Bacteria 36381
311 Ga0495677_0275563 3300047445 Bacteria 660
312 Ga0495685_113430 3300047447 Bacteria 891
313 Ga0495673_0254046 3300047469 Bacteria 641
314 Ga0495686_0055548 3300047472 Bacteria 2475
315 Ga0495615_0067501 3300048090 Bacteria 957
316 Ga0496100_0461344 3300048903 Bacteria 975
317 Ga0496101_0124030 3300048904 Bacteria 1956
318 Ga0496105_0382718 3300048908 Bacteria 1119
319 Ga0496105_0598542 3300048908 Bacteria 856
320 Ga0496108_0344610 3300048911 Bacteria 1300
321 Ga0496109_0095371 3300048912 Bacteria 2754
322 Ga0496109_0290332 3300048912 Bacteria 1542
323 Ga0496112_0317481 3300048915 Bacteria 1502
324 Ga0496113_0159417 3300048916 Bacteria 1783
325 Ga0496114_0712628 3300048917 Bacteria 879
326 Ga0496116_0057663 3300048919 Bacteria 2537
327 Ga0496116_0065659 3300048919 Bacteria 2326
328 Ga0496116_0354654 3300048919 Bacteria 670
329 Ga0496117_0000854 3300048920 Bacteria 47114
330 Ga0496117_0001593 3300048920 Bacteria 32105
331 Ga0496117_0010036 3300048920 Bacteria 8700
332 Ga0496117_0126478 3300048920 Bacteria 1558
333 Ga0496118_0000383 3300048921 Bacteria 74507
334 Ga0496118_0002149 3300048921 Bacteria 27507
335 Ga0496118_0007017 3300048921 Bacteria 12131
336 Ga0496118_0010293 3300048921 Bacteria 9276
337 Ga0496118_0025694 3300048921 Bacteria 5040
338 Ga0496118_0092745 3300048921 Bacteria 2071
339 Ga0496118_0209519 3300048921 Bacteria 1145
340 Ga0496119_0000069 3300048922 Bacteria 155265
341 Ga0496119_0001338 3300048922 Bacteria 30220
342 Ga0496120_0000320 3300048923 Bacteria 79515
343 Ga0496120_0000884 3300048923 Bacteria 42219
344 Ga0496121_0012851 3300048924 Bacteria 9057
345 Ga0496121_0026661 3300048924 Bacteria 5434
346 Ga0496121_0027250 3300048924 Bacteria 5352
347 Ga0496122_0000315 3300048925 Bacteria 106323
348 Ga0496122_0000710 3300048925 Bacteria 65728
349 Ga0496122_0006173 3300048925 Bacteria 13927
350 Ga0496122_0007903 3300048925 Bacteria 11665
351 Ga0496122_0077200 3300048925 Bacteria 2340
352 Ga0496122_0143389 3300048925 Bacteria 1489
353 Ga0496122_0424514 3300048925 Bacteria 667
354 Ga0496123_0000104 3300048926 Bacteria 168230
355 Ga0496123_0000149 3300048926 Bacteria 142962
356 Ga0496123_0001416 3300048926 Bacteria 33518
357 Ga0496123_0027054 3300048926 Bacteria 4280
358 Ga0496124_0000403 3300048927 Bacteria 78615
359 Ga0496124_0000516 3300048927 Bacteria 66627
360 Ga0496124_0002024 3300048927 Bacteria 27560
361 Ga0496124_0004371 3300048927 Bacteria 16534
362 Ga0496124_0009110 3300048927 Bacteria 10260
363 Ga0496124_0076186 3300048927 Bacteria 2769
364 Ga0496124_0122623 3300048927 Bacteria 2074
365 Ga0496124_0244605 3300048927 Bacteria 1331
366 Ga0496124_0546657 3300048927 Bacteria 765
367 Ga0496125_0001475 3300048928 Bacteria 34001
368 Ga0496125_0009029 3300048928 Bacteria 10324
369 Ga0496125_0204109 3300048928 Bacteria 1290
370 Ga0496126_0000913 3300048929 Bacteria 51086
371 Ga0496126_0781598 3300048929 Bacteria 734
372 Ga0501031_0102351 3300049568 Bacteria 1869
373 Ga0501031_0280275 3300049568 Bacteria 1081
374 Ga0501032_0019800 3300049569 Bacteria 4699
375 Ga0501033_0002068 3300049570 Bacteria 17441
376 Ga0501033_0211860 3300049570 Bacteria 1381
377 Ga0501034_0039133 3300049571 Bacteria 4803
378 Ga0501034_0046067 3300049571 Bacteria 4406
379 Ga0501034_0343886 3300049571 Bacteria 1421
380 Ga0501037_0148575 3300049573 Bacteria 1676
381 Ga0501037_0293073 3300049573 Bacteria 1131
382 Ga0501038_0128179 3300049574 Bacteria 2086
383 Ga0501039_0286392 3300049575 Bacteria 1295
384 Ga0501070_0110402 3300049586 Bacteria 2273
385 Ga0501202_042641 3300049652 Bacteria 984
386 Ga0501216_011467 3300049660 Bacteria 1441
387 Ga0501239_068370 3300049672 Bacteria 548
388 Ga0501249_115252 3300049679 Bacteria 652
389 Ga0501257_074332 3300049686 Bacteria 871
390 Ga0501225_0020125 3300049705 Bacteria 1845
391 Ga0501080_0182798 3300049742 Bacteria 1929
392 Ga0501266_033642 3300049763 Bacteria 740
393 Ga0501268_045011 3300049765 Bacteria 841
394 Ga0501275_002503 3300049772 Bacteria 1695
395 Ga0501035_0361286 3300049822 Bacteria 1213
396 Ga0501044_0214339 3300049823 Bacteria 1878
397 nmdc:mga03n38_137534_c1 3300050490 Bacteria 1217
398 nmdc:mga00v17_150566_c1 3300050491 Bacteria 1495
399 nmdc:mga00v17_41_c2 3300050491 Bacteria 55060
400 nmdc:mga00v17_422044_c1 3300050491 Bacteria 866
401 Ga0500634_0028106 3300053161 Bacteria 3062
402 2941478898 2941475908 Bacteria 4145589
403 2547503280 2547132130 Bacteria 4660562
404 2572254984 2571042365 Bacteria 3289345
405 2578457140 2576861471 Bacteria 4648976
406 2643815419 2643221559 Bacteria 4424915
407 2643881901 2643221573 Bacteria 4784121
408 2643914882 2643221581 Bacteria 3893603
409 2643941292 2643221586 Bacteria 4446529
410 2643973737 2643221593 Bacteria 6296053
411 2644079644 2643221612 Bacteria 4361984
412 2644530703 2643221695 Bacteria 3441323
413 2644662943 2643221720 Bacteria 4694283
414 2644696206 2643221727 Bacteria 4415595
415 2644699899 2643221728 Bacteria 4797149
416 2747951245 2747842428 Bacteria 4689383
417 2748019566 2747842501 Bacteria 5293829
418 2765580350 2765235840 Bacteria 4663337
419 2816518612 2816332141 Bacteria 4436036
420 2819661146 2818991457 Bacteria 5323295
421 2842395491 2842391507 Bacteria 4486072
422 2842759118 2842757796 Bacteria 3981385
423 2852652281 2852649853 Bacteria 4036942
424 2852687002 2852684882 Bacteria 5463342
425 2857445720 2857442823 Bacteria 4562550
426 2874223028 2874220319 Bacteria 4594709
427 2895501805 2895498888 Bacteria 5283788
428 2895517645 2895511927 Bacteria 6802080
429 2895525209 2895522137 Bacteria 3284416
430 2895526153 2895525241 Bacteria 3388457
431 2919092937 2919089067 Bacteria 4560942
432 2919131213 2919130084 Bacteria 5301837
433 2919137377 2919134579 Bacteria 4480386
434 2928498924 2928496128 Bacteria 4631123
435 2929196453 2929195423 Bacteria 5325372
436 2931383510 2931380184 Bacteria 4455911
437 2937615008 2937610967 Bacteria 4618818
438 2939589669 2939589442 Bacteria 4214238
439 2939624260 2939622612 Bacteria 4698046
440 2939630647 2939626828 Bacteria 4695272
441 2941493852 2941489479 Bacteria 6313767
442 2961049793 2961047084 Bacteria 4594415
443 2961066524 2961064222 Bacteria 4749990
444 2974307776 2974307012 Bacteria 4172388
445 2977248495 2977247770 Bacteria 4160543
446 2984517018 2984514374 Bacteria 4172479
447 2987608625 2987605356 Bacteria 4187822
448 2995953218 2995948881 Bacteria 6358104
449 8002871056 8002869464 Bacteria 3588529
450 8003017032 8003014200 Bacteria 4059994
451 8021626281 8021622325 Bacteria 4844743
452 8021626738 8021626552 Bacteria 4665214
453 8021651340 8021648035 Bacteria 4772378
454 SwRhRL2b_contig_3082486
455 JGI25152J39213_1001190
456 JGI25150J39212_1000714
457 JGI25150J39212_1021101
458 JGI25151J46595_10000105
459 JGI25151J46595_10000116
460 JGI25153J46596_10000077
461 rootH2_10121715
462 JGI26145J50221_1015200
463 Ga0055526_1000316
464 Ga0055526_1001846
465 Ga0055537_1000238
466 Ga0055537_1000526
467 Ga0055524_1000074
468 Ga0055524_1007046
469 Ga0055524_1032907
470 Ga0055536_1001527
471 Ga0055536_1001898
472 Ga0055536_1005035
473 Ga0055534_1000121
474 Ga0055534_1000231
475 Ga0055528_1000028
476 Ga0055528_1000148
477 Ga0055530_10000618
478 Ga0055530_10001089
479 Ga0055530_10001387
480 Ga0055540_1024867
481 Ga0055540_1076471
482 Ga0055531_10002056
483 Ga0055531_10039059
484 Ga0055531_10039781
485 Ga0058692_1000013
486 Ga0058692_1000045
487 Ga0065714_10099633
488 Ga0065704_10001264
489 Ga0065704_10183855
490 Ga0065704_10255881
491 Ga0065715_10001279
492 Ga0065715_10012881
493 Ga0065715_10101061
494 Ga0065715_10356514
495 Ga0070658_11027595
496 Ga0070670_100006122
497 Ga0070670_100026589
498 Ga0070677_10324702
499 Ga0070680_100519123
500 Ga0070660_100841226
501 Ga0070668_100007597
502 Ga0070669_100261404
503 Ga0070669_100447744
504 Ga0070671_100163823
505 Ga0070671_100177377
506 Ga0070674_100025257
507 Ga0070659_100451916
508 Ga0070659_100839398
509 Ga0070667_100258096
510 Ga0070678_100049382
511 Ga0070662_100309568
512 Ga0070662_100492410
513 Ga0070679_100343741
514 Ga0070672_100061192
515 Ga0070665_100082364
516 Ga0070665_100164091
517 Ga0070665_100337924
518 Ga0070664_101267013
519 Ga0081539_10051143
520 Ga0075365_10106405
521 Ga0075363_100146322
522 Ga0075363_100163499
523 Ga0075364_10001855
524 Ga0075364_10098345
525 Ga0075364_10473735
526 Ga0075369_10278014
527 Ga0105251_10000350
528 Ga0105251_10007580
529 Ga0105251_10158209
530 Ga0105244_10019377
531 Ga0105244_10157951
532 Ga0105243_10140978
533 Ga0105242_10120837
534 Ga0105242_10620958
535 Ga0105248_10694102
536 Ga0157344_1008232
537 Ga0157326_1010732
538 Ga0157373_10158854
539 Ga0157373_10287536
540 Ga0157373_10403399
541 Ga0157371_10000184
542 Ga0157371_10100030
543 Ga0157371_11176772
544 Ga0157370_10004081
545 Ga0163162_10213689
546 Ga0163162_10309047
547 Ga0157372_10205487
548 Ga0157372_10431720
549 Ga0157375_10190473
550 Ga0157375_10324989
551 Ga0182008_10000939
552 Ga0182008_10015701
553 Ga0182006_1005214
554 Ga0182006_1006571
555 Ga0182006_1015640
556 Ga0182006_1033551
557 Ga0182006_1094828
558 Ga0182007_10000118
559 Ga0182005_1000268
560 Ga0182005_1002760
561 Ga0183360_10005
562 Ga0163161_10000766
563 Ga0163161_10020893
564 Ga0207425_1000045
565 Ga0207425_1001522
566 Ga0209129_1000057
567 Ga0209565_1000023
568 Ga0209565_1000034
569 Ga0209565_1003391
570 Ga0209673_1000039
571 Ga0209673_1000047
572 Ga0209130_1004089
573 Ga0209675_1000016
574 Ga0209675_1000023
575 Ga0209676_1000037
576 Ga0209676_1000160
577 Ga0209676_1000796
578 Ga0209676_1008927
579 Ga0209025_1000013
580 Ga0209025_1000023
581 Ga0209564_1000066
582 Ga0209564_1000194
583 Ga0209564_1005813
584 Ga0209564_1009492
585 Ga0209758_1000014
586 Ga0209758_1007000
587 Ga0209050_1000462
588 Ga0209050_1000971
589 Ga0209050_1002178
590 Ga0209050_1021158
591 Ga0209256_1000048
592 Ga0209256_1001572
593 Ga0209256_1012899
594 Ga0209256_1030593
595 Ga0209051_1001229
596 Ga0209051_1018477
597 Ga0209257_1000177
598 Ga0209257_1002904
599 Ga0209257_1003668
600 Ga0209257_1012637
601 Ga0207655_1036411
602 Ga0207713_1001094
603 Ga0207713_1007090
604 Ga0207660_10407029
605 Ga0207657_10088666
606 Ga0207652_10467491
607 Ga0207681_10081906
608 Ga0207650_10004216
609 Ga0207664_10399833
610 Ga0207644_10011719
611 Ga0207644_10213746
612 Ga0207706_10496903
613 Ga0207686_10128983
614 Ga0207686_10179660
615 Ga0207709_10004945
616 Ga0207669_10043720
617 Ga0207691_10052571
618 Ga0207679_10783461
619 Ga0207668_10005933
620 Ga0207668_10051063
621 Ga0207658_10389167
622 Ga0207683_10050168
623 Ga0209973_1016208
624 Ga0209371_1000007
625 Ga0209371_1000043
626 Ga0209969_1009644
627 Ga0209967_1007640
628 Ga0209981_1011502
629 Ga0209984_1003891
630 Ga0210000_1001273
631 Ga0209995_1040331
632 Ga0209999_1008572
633 Ga0209982_1009860
634 Ga0209970_1033303
635 Ga0209983_1002456
636 Ga0209971_1004124
637 Ga0209974_10011227
638 Ga0209974_10016927
639 Ga0209974_10048569
640 Ga0268266_10076388
641 Ga0268266_10121246
642 Ga0268266_10149749
643 Ga0268266_10302387
644 Ga0268256_1000008
645 Ga0268256_1000044
646 Ga0316177_1175300
647 Ga0316176_1162259
648 Ga0314311_1000677
649 Ga0316183_1206264
650 Ga0316182_1019679
651 Ga0316182_1362052
652 Ga0307408_100023984
653 Ga0307408_100063368
654 Ga0307408_100273830
655 Ga0316579_10153153
656 Ga0307405_10508768
657 Ga0307413_10034057
658 Ga0307413_10071304
659 Ga0307413_10092925
660 Ga0307413_10185595
661 Ga0307413_10213934
662 Ga0307410_10045344
663 Ga0307406_10019579
664 Ga0307406_10065325
665 Ga0307406_10099739
666 Ga0307412_11850244
667 Ga0307409_100360604
668 Ga0307416_101444744
669 Ga0307414_10068551
670 Ga0307414_10155474
671 Ga0307414_10155702
672 Ga0307414_10182223
673 Ga0307414_10257331
674 Ga0307414_10299799
675 Ga0307414_11203142
676 Ga0307415_100484739
677 Ga0307415_100565125
678 Ga0307415_101540152
679 Ga0316584_0461146
680 Ga0395899_0090731
681 Ga0395900_0059445
682 Ga0395900_0119331
683 Ga0395900_1113651
684 Ga0395898_0122644
685 Ga0395905_0000337
686 Ga0395905_0140970
687 Ga0395905_0250607
688 Ga0395905_0344163
689 Ga0395905_0346762
690 Ga0395905_0840195
691 Ga0395901_0080345
692 Ga0395901_0591262
693 Ga0237819_00396
694 Ga0237819_13140
695 Ga0439436_0002225
696 Ga0439436_0007475
697 Ga0439439_0001774
698 Ga0439439_0029704
699 Ga0439447_000227
700 Ga0439447_046686
701 Ga0451789_0848378
702 Ga0451791_0533041
703 Ga0451791_1460006
704 Ga0451793_0078272
705 Ga0451793_1307872
706 Ga0451798_0925201
707 Ga0451800_0091515
708 Ga0451806_164866
709 Ga0451804_1174625
710 Ga0451807_1057439
711 Ga0451807_1371999
712 Ga0451837_0813783
713 Ga0451837_1425707
714 Ga0451837_1517053
715 Ga0451837_1576145
716 Ga0451841_0983776
717 Ga0451843_0668074
718 Ga0451843_0794872
719 Ga0451843_1675506
720 Ga0451853_0473773
721 Ga0439445_0117468
722 Ga0439432_006342
723 Ga0439432_007168
724 Ga0439449_0015477
725 Ga0439449_0030258
726 Ga0439462_0023620
727 Ga0450899_020705
728 Ga0450905_002492
729 Ga0439434_0049454
730 Ga0450901_004280
731 Ga0466967_1639985
732 Ga0495591_061334
733 Ga0495638_0001816
734 Ga0495607_0014288
735 Ga0495583_0330608
736 Ga0495606_0003699
737 Ga0495610_0006190
738 Ga0495616_0178097
739 Ga0495616_0271243
740 Ga0495631_0009026
741 Ga0495631_0353136
742 Ga0495643_0001888
743 Ga0495663_0003944
744 Ga0495663_0010379
745 Ga0495663_0030665
746 Ga0495598_0001993
747 Ga0495621_0057296
748 Ga0495621_0059048
749 Ga0495622_0365959
750 Ga0495633_0007055
751 Ga0495633_0021722
752 Ga0495633_0055952
753 Ga0495633_0133063
754 Ga0495633_0380898
755 Ga0495668_0002539
756 Ga0495625_0436383
757 Ga0495659_0016016
758 Ga0495659_0050925
759 Ga0495660_0014248
760 Ga0495660_0330836
761 Ga0495636_0015757
762 Ga0495636_0017607
763 Ga0495672_0000720
764 Ga0495677_0275563
765 Ga0495685_113430
766 Ga0495673_0254046
767 Ga0495686_0055548
768 Ga0495615_0067501
769 Ga0496100_0461344
770 Ga0496101_0124030
771 Ga0496105_0382718
772 Ga0496105_0598542
773 Ga0496108_0344610
774 Ga0496109_0095371
775 Ga0496109_0290332
776 Ga0496112_0317481
777 Ga0496113_0159417
778 Ga0496114_0712628
779 Ga0496116_0057663
780 Ga0496116_0065659
781 Ga0496116_0354654
782 Ga0496117_0000854
783 Ga0496117_0001593
784 Ga0496117_0010036
785 Ga0496117_0126478
786 Ga0496118_0000383
787 Ga0496118_0002149
788 Ga0496118_0007017
789 Ga0496118_0010293
790 Ga0496118_0025694
791 Ga0496118_0092745
792 Ga0496118_0209519
793 Ga0496119_0000069
794 Ga0496119_0001338
795 Ga0496120_0000320
796 Ga0496120_0000884
797 Ga0496121_0012851
798 Ga0496121_0026661
799 Ga0496121_0027250
800 Ga0496122_0000315
801 Ga0496122_0000710
802 Ga0496122_0006173
803 Ga0496122_0007903
804 Ga0496122_0077200
805 Ga0496122_0143389
806 Ga0496122_0424514
807 Ga0496123_0000104
808 Ga0496123_0000149
809 Ga0496123_0001416
810 Ga0496123_0027054
811 Ga0496124_0000403
812 Ga0496124_0000516
813 Ga0496124_0002024
814 Ga0496124_0004371
815 Ga0496124_0009110
816 Ga0496124_0076186
817 Ga0496124_0122623
818 Ga0496124_0244605
819 Ga0496124_0546657
820 Ga0496125_0001475
821 Ga0496125_0009029
822 Ga0496125_0204109
823 Ga0496126_0000913
824 Ga0496126_0781598
825 Ga0501031_0102351
826 Ga0501031_0280275
827 Ga0501032_0019800
828 Ga0501033_0002068
829 Ga0501033_0211860
830 Ga0501034_0039133
831 Ga0501034_0046067
832 Ga0501034_0343886
833 Ga0501037_0148575
834 Ga0501037_0293073
835 Ga0501038_0128179
836 Ga0501039_0286392
837 Ga0501070_0110402
838 Ga0501202_042641
839 Ga0501216_011467
840 Ga0501239_068370
841 Ga0501249_115252
842 Ga0501257_074332
843 Ga0501225_0020125
844 Ga0501080_0182798
845 Ga0501266_033642
846 Ga0501268_045011
847 Ga0501275_002503
848 Ga0501035_0361286
849 Ga0501044_0214339
850 nmdc:mga03n38_137534_c1
851 nmdc:mga00v17_150566_c1
852 nmdc:mga00v17_41_c2
853 nmdc:mga00v17_422044_c1
854 Ga0500634_0028106
855 2941478898
856 2547503280
857 2572254984
858 2578457140
859 2643815419
860 2643881901
861 2643914882
862 2643941292
863 2643973737
864 2644079644
865 2644530703
866 2644662943
867 2644696206
868 2644699899
869 2747951245
870 2748019566
871 2765580350
872 2816518612
873 2819661146
874 2842395491
875 2842759118
876 2852652281
877 2852687002
878 2857445720
879 2874223028
880 2895501805
881 2895517645
882 2895525209
883 2895526153
884 2919092937
885 2919131213
886 2919137377
887 2928498924
888 2929196453
889 2931383510
890 2937615008
891 2939589669
892 2939624260
893 2939630647
894 2941493852
895 2961049793
896 2961066524
897 2974307776
898 2977248495
899 2984517018
900 2987608625
901 2995953218
902 8002871056
903 8003017032
904 8021626281
905 8021626738
906 8021651340

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01878

EVE

EVE domain

13

162

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2g2x-assembly3.cif.gz_C x-ray crystal structure protein q88ch6 from pseudomonas putida. northeast structural genomics consortium target ppr72. 0.9449 7 155
2eve-assembly1.cif.gz_A x-ray crystal structure of protein pspto5229 from pseudomonas syringae. northeast structural genomics consortium target psr62 0.9278 7 155
2g2x-assembly3.cif.gz_C x-ray crystal structure protein q88ch6 from pseudomonas putida. northeast structural genomics consortium target ppr72. 0.9207 7 155
2ar1-assembly1.cif.gz_A structure of hypothetical protein from leishmania major 0.9069 1 155
2eve-assembly1.cif.gz_A x-ray crystal structure of protein pspto5229 from pseudomonas syringae. northeast structural genomics consortium target psr62 0.9046 7 155
ID Description Score Start End Superfamily
2eveA00 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9258 7 155 3.10.590.10
af_A4ICC8_1_164_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9227 1 155 3.10.590.10
af_I1JAX2_1_77_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9168 1 77 3.10.590.10
af_O94645_8_177_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9075 5 155 3.10.590.10
af_I1JAX2_1_77_3.10.590.10 Alpha Beta;Roll;ph1033 like fold;ph1033 like domains 0.9058 1 77 3.10.590.10
ID Description Score Start End GO Terms
AF-A0A4V1S8E7-F1-model_v4 EVE domain-containing protein 0.9992 7 69
AF-A0A7Z9T9R3-F1-model_v4 EVE domain-containing protein 0.9892 4 73
AF-A0A7J4MH91-F1-model_v4 EVE domain-containing protein 0.9877 7 76
AF-Q9PBX1-F1-model_v4 EVE domain-containing protein 0.9854 10 156
AF-A0A516V570-F1-model_v4 EVE domain-containing protein 0.9788 2 156

Map