F447302

General Info

Members Datasets Scaffolds Average Seq Length
453 237 907 197

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2987605356|2987608624
Length 233
Sequence EKPGENRLHETAPVPSPQPLSRLRERGFAAGFRYPVSMTDDPRQRLRQQLRQRRRDIPAADRIAAAEALAAHLLALPFAHASGHVAGYWAMDGEIALHRWQMQLPPQQTYCLPVLHGKRLRFAPWRPGQPLVSNRYGIPEPAVDPSTALHPEEMALVVAPLVGFDPHGRRLGMGGGWYDRSFAFRQRQAAPPWLVGVGFSAQQVPSLPVEDWDVAVDAICTEQATLYPEPLNA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
3 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
10 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
11 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
12 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
13 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
14 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
15 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
16 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
17 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
34 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
39 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
40 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
41 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
44 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
45 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
46 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
47 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
48 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
49 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
50 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
51 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
52 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
53 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
54 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
55 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
56 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
57 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
59 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
84 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
85 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
86 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
87 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
88 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
89 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
90 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
91 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
92 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
97 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
98 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
99 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
100 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
101 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
102 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
103 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
104 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
105 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
106 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
107 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
108 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
109 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
110 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
111 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
112 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
113 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
114 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
115 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
116 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
117 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
118 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
119 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
120 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
121 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
122 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
123 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
124 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
127 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
130 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
131 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
132 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
133 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
134 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
135 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
136 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
137 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
138 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
139 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
140 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
141 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
142 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
143 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
144 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
145 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
148 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
149 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
150 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
151 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
152 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
153 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
154 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
155 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
156 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
157 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
158 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
159 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
160 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
161 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
162 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
163 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
176 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
182 3300053734 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 endosphere Metagenome Endosphere
183 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
184 2547132130 Stenotrophomonas maltophilia RR-10 Isolate Unclassified
185 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
186 2643221559 Lysobacter sp. Root559 Isolate Unclassified
187 2643221573 Lysobacter sp. Root604 Isolate Unclassified
188 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
189 2643221581 Pseudoxanthomonas sp. Root65 Isolate Unclassified
190 2643221586 Lysobacter sp. Root667 Isolate Unclassified
191 2643221593 Lysobacter sp. Root690 Isolate Unclassified
192 2643221612 Lysobacter sp. Root76 Isolate Unclassified
193 2643221720 Lysobacter sp. Root916 Isolate Unclassified
194 2643221727 Lysobacter sp. Root96 Isolate Unclassified
195 2643221728 Lysobacter sp. Root983 Isolate Unclassified
196 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
197 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
198 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
199 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
200 2818991457 Xanthomonas translucens 569 Isolate Unclassified
201 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
202 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
203 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
204 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
205 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
206 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
207 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
208 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
209 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
210 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
211 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
212 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
213 2919130084 Xanthomonas sp. 1678 Isolate Rhizosphere
214 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
215 2919513703 Luteimonas sp. 3794 Isolate Unclassified
216 2919675420 Luteimonas terrae 4099 Isolate Unclassified
217 2923516293 Pseudoxanthomonas mexicana SLBN-89 Isolate Rhizosphere
218 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
219 2929195423 Xanthomonas sp. R-73098 Hybrid assembly Isolate Unclassified
220 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
221 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
222 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
223 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
224 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
225 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
226 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
227 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
228 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
229 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
230 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
231 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
232 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
233 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
234 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
235 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
236 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
237 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.86
Metatranscriptomes 0
Isolates 12.14

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 24.5
Nodule 0.44
Rhizoplane 3.97
Rhizosphere 50.55
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1243823 2162886007 Bacteria 2071
2 JGI25152J39213_1001190 3300002773 Bacteria 11974
3 JGI25150J39212_1000714 3300002774 Bacteria 11902
4 JGI25150J39212_1034413 3300002774 Bacteria 682
5 JGI25151J46595_10000105 3300003187 Bacteria 113763
6 JGI25151J46595_10000116 3300003187 Bacteria 107172
7 JGI25151J46595_10040208 3300003187 Bacteria 1716
8 JGI25406J46586_10072868 3300003203 Bacteria 1072
9 JGI25153J46596_10000077 3300003215 Bacteria 113763
10 rootH2_10121715 3300003320 Bacteria 4556
11 rootH2_10141305 3300003320 Bacteria 1325
12 rootH1_10033719 3300003316 Bacteria 3762
13 rootH1_10033719 3300003323 Bacteria 3802
14 Ga0055526_1000316 3300003771 Bacteria 40300
15 Ga0055526_1058950 3300003771 Bacteria 828
16 Ga0055537_1000238 3300003773 Bacteria 40300
17 Ga0055537_1000526 3300003773 Bacteria 22324
18 Ga0055524_1000074 3300003775 Bacteria 122843
19 Ga0055524_1007046 3300003775 Bacteria 4826
20 Ga0055524_1011809 3300003775 Bacteria 3387
21 Ga0055524_1032907 3300003775 Bacteria 1460
22 Ga0055536_1001898 3300003781 Bacteria 12140
23 Ga0055536_1007501 3300003781 Bacteria 4866
24 Ga0055536_1008245 3300003781 Bacteria 4514
25 Ga0055536_1009818 3300003781 Bacteria 3896
26 Ga0055536_1037900 3300003781 Bacteria 1174
27 Ga0055536_1054706 3300003781 Bacteria 857
28 Ga0055534_1000121 3300003784 Bacteria 57849
29 Ga0055534_1000231 3300003784 Bacteria 40300
30 Ga0055528_1000028 3300003790 Bacteria 122843
31 Ga0055528_1000148 3300003790 Bacteria 57842
32 Ga0055530_10000618 3300003791 Bacteria 30889
33 Ga0055530_10001089 3300003791 Bacteria 21346
34 Ga0055530_10001387 3300003791 Bacteria 17936
35 Ga0055530_10036389 3300003791 Bacteria 1239
36 Ga0055531_10002056 3300003794 Bacteria 13876
37 Ga0055531_10008235 3300003794 Bacteria 5546
38 Ga0055531_10012741 3300003794 Bacteria 3929
39 Ga0055531_10013009 3300003794 Bacteria 3869
40 Ga0055531_10013189 3300003794 Bacteria 3830
41 Ga0055531_10018835 3300003794 Bacteria 2828
42 Ga0055531_10039059 3300003794 Bacteria 1415
43 Ga0055531_10039781 3300003794 Bacteria 1389
44 Ga0058692_1000013 3300003856 Bacteria 316299
45 Ga0058692_1000045 3300003856 Bacteria 115083
46 Ga0065704_10000819 3300005289 Bacteria 23112
47 Ga0065704_10001264 3300005289 Bacteria 8604
48 Ga0065715_10001279 3300005293 Bacteria 7063
49 Ga0070670_100006122 3300005331 Bacteria 10172
50 Ga0070660_100522633 3300005339 Bacteria 988
51 Ga0070692_10336052 3300005345 Bacteria 934
52 Ga0070668_100007597 3300005347 Bacteria 8047
53 Ga0070668_100058055 3300005347 Bacteria 2993
54 Ga0070669_100300131 3300005353 Bacteria 1292
55 Ga0070671_100163823 3300005355 Bacteria 1880
56 Ga0070674_100025257 3300005356 Bacteria 3866
57 Ga0070659_100753805 3300005366 Bacteria 844
58 Ga0070678_100049382 3300005456 Bacteria 3036
59 Ga0070678_100269628 3300005456 Bacteria 1435
60 Ga0068867_100276809 3300005459 Bacteria 1375
61 Ga0070665_100082364 3300005548 Bacteria 3223
62 Ga0070665_100164091 3300005548 Bacteria 2224
63 Ga0070665_100570378 3300005548 Bacteria 1144
64 Ga0068854_100552238 3300005578 Bacteria 977
65 Ga0081539_10051143 3300005985 Bacteria 2331
66 Ga0075364_10001855 3300006051 Bacteria 11727
67 Ga0075364_10027743 3300006051 Bacteria 3619
68 Ga0075364_10119950 3300006051 Bacteria 1760
69 Ga0075364_10146993 3300006051 Bacteria 1587
70 Ga0075364_10342142 3300006051 Bacteria 1019
71 Ga0075364_10424780 3300006051 Bacteria 907
72 Ga0099826_10235936 3300006948 Bacteria 974
73 Ga0105251_10000350 3300009011 Bacteria 45818
74 Ga0105251_10007580 3300009011 Bacteria 6661
75 Ga0105244_10019377 3300009036 Bacteria 3800
76 Ga0105243_10004100 3300009148 Bacteria 11593
77 Ga0105243_10140978 3300009148 Bacteria 2057
78 Ga0105032_101650 3300009979 Bacteria 2025
79 Ga0157373_10204357 3300013100 Bacteria 1393
80 Ga0157373_10287536 3300013100 Bacteria 1166
81 Ga0157373_10682606 3300013100 Bacteria 752
82 Ga0157373_10716800 3300013100 Bacteria 734
83 Ga0157371_10000184 3300013102 Bacteria 92100
84 Ga0157371_10100030 3300013102 Bacteria 2056
85 Ga0157371_10335194 3300013102 Bacteria 1099
86 Ga0157371_10491285 3300013102 Bacteria 906
87 Ga0157371_10918826 3300013102 Bacteria 664
88 Ga0157370_10004081 3300013104 Bacteria 16932
89 Ga0157370_10151240 3300013104 Bacteria 2160
90 Ga0157370_10606930 3300013104 Bacteria 1002
91 Ga0157369_10968707 3300013105 Bacteria 871
92 Ga0157375_10190473 3300013308 Bacteria 2206
93 Ga0157375_10324989 3300013308 Bacteria 1703
94 Ga0157380_10020180 3300014326 Bacteria 4979
95 Ga0182008_10000939 3300014497 Bacteria 20309
96 Ga0182008_10015701 3300014497 Bacteria 3948
97 Ga0182006_1005214 3300015261 Bacteria 6229
98 Ga0182006_1006571 3300015261 Bacteria 5390
99 Ga0182006_1033551 3300015261 Bacteria 2057
100 Ga0182006_1047513 3300015261 Bacteria 1663
101 Ga0182005_1000268 3300015265 Bacteria 32952
102 Ga0182005_1002760 3300015265 Bacteria 6124
103 Ga0183360_10005 3300015689 Bacteria 73748
104 Ga0183361_11862 3300016635 Bacteria 1113
105 Ga0163161_10000766 3300017792 Bacteria 25292
106 Ga0163161_10020893 3300017792 Bacteria 4598
107 Ga0207425_1000045 3300025245 Bacteria 194257
108 Ga0207425_1001522 3300025245 Bacteria 9524
109 Ga0207425_1031610 3300025245 Bacteria 1053
110 Ga0209129_1000057 3300025258 Bacteria 253632
111 Ga0209565_1000023 3300025263 Bacteria 388244
112 Ga0209565_1000034 3300025263 Bacteria 312950
113 Ga0209565_1003391 3300025263 Bacteria 5183
114 Ga0209673_1000039 3300025273 Bacteria 312950
115 Ga0209673_1000047 3300025273 Bacteria 289276
116 Ga0209673_1004508 3300025273 Bacteria 7419
117 Ga0209130_1004089 3300025284 Bacteria 5750
118 Ga0209130_1014827 3300025284 Bacteria 1942
119 Ga0209675_1000016 3300025291 Bacteria 391965
120 Ga0209675_1000023 3300025291 Bacteria 312950
121 Ga0209675_1022965 3300025291 Bacteria 1626
122 Ga0209675_1041762 3300025291 Bacteria 998
123 Ga0209676_1000027 3300025292 Bacteria 560222
124 Ga0209676_1000037 3300025292 Bacteria 457562
125 Ga0209676_1000160 3300025292 Bacteria 161069
126 Ga0209676_1000796 3300025292 Bacteria 41705
127 Ga0209676_1008927 3300025292 Bacteria 4401
128 Ga0209676_1009833 3300025292 Bacteria 4068
129 Ga0209676_1009939 3300025292 Bacteria 4030
130 Ga0209676_1010242 3300025292 Bacteria 3938
131 Ga0209676_1023833 3300025292 Bacteria 1995
132 Ga0209676_1029436 3300025292 Bacteria 1695
133 Ga0209025_1000013 3300025294 Bacteria 871757
134 Ga0209025_1000023 3300025294 Bacteria 541307
135 Ga0209025_1008851 3300025294 Bacteria 7140
136 Ga0209025_1030426 3300025294 Bacteria 2585
137 Ga0209025_1097119 3300025294 Bacteria 944
138 Ga0209564_1000066 3300025295 Bacteria 312899
139 Ga0209564_1000194 3300025295 Bacteria 141518
140 Ga0209564_1005813 3300025295 Bacteria 6880
141 Ga0209564_1009492 3300025295 Bacteria 4622
142 Ga0209758_1000014 3300025297 Bacteria 871757
143 Ga0209758_1007000 3300025297 Bacteria 7846
144 Ga0209050_1000462 3300025298 Bacteria 72638
145 Ga0209050_1000971 3300025298 Bacteria 36685
146 Ga0209050_1002178 3300025298 Bacteria 17699
147 Ga0209050_1021158 3300025298 Bacteria 2383
148 Ga0209050_1021847 3300025298 Bacteria 2315
149 Ga0209050_1023286 3300025298 Bacteria 2185
150 Ga0209256_1000048 3300025299 Bacteria 312899
151 Ga0209256_1000825 3300025299 Bacteria 39320
152 Ga0209256_1001572 3300025299 Bacteria 22464
153 Ga0209256_1012899 3300025299 Bacteria 3147
154 Ga0209256_1022158 3300025299 Bacteria 1930
155 Ga0209256_1030593 3300025299 Bacteria 1484
156 Ga0209051_1001229 3300025303 Bacteria 23028
157 Ga0209051_1018477 3300025303 Bacteria 3084
158 Ga0209257_1000046 3300025304 Bacteria 477765
159 Ga0209257_1000067 3300025304 Bacteria 342468
160 Ga0209257_1000177 3300025304 Bacteria 161069
161 Ga0209257_1000198 3300025304 Bacteria 149013
162 Ga0209257_1002904 3300025304 Bacteria 15851
163 Ga0209257_1003668 3300025304 Bacteria 12861
164 Ga0209257_1010645 3300025304 Bacteria 4606
165 Ga0209257_1012481 3300025304 Bacteria 3916
166 Ga0209257_1012637 3300025304 Bacteria 3872
167 Ga0207655_1036411 3300025728 Bacteria 2182
168 Ga0207713_1001094 3300025735 Bacteria 23219
169 Ga0207713_1007090 3300025735 Bacteria 6705
170 Ga0207688_10393020 3300025901 Bacteria 859
171 Ga0207657_10469328 3300025919 Bacteria 987
172 Ga0207649_10509601 3300025920 Bacteria 916
173 Ga0207681_10081906 3300025923 Bacteria 2280
174 Ga0207650_10004216 3300025925 Bacteria 9819
175 Ga0207650_10098513 3300025925 Bacteria 2246
176 Ga0207644_10012724 3300025931 Bacteria 5594
177 Ga0207709_10002468 3300025935 Bacteria 11593
178 Ga0207709_10004945 3300025935 Bacteria 7628
179 Ga0207669_10043720 3300025937 Bacteria 2626
180 Ga0207691_10052571 3300025940 Bacteria 3720
181 Ga0207711_10175487 3300025941 Bacteria 1947
182 Ga0207668_10023992 3300025972 Bacteria 3930
183 Ga0207668_10026923 3300025972 Bacteria 3740
184 Ga0207641_10519452 3300026088 Bacteria 1158
185 Ga0207648_10234166 3300026089 Bacteria 1634
186 Ga0207683_10050168 3300026121 Bacteria 3654
187 Ga0207683_10295249 3300026121 Bacteria 1482
188 Ga0209371_1000007 3300027312 Bacteria 1050654
189 Ga0209371_1000043 3300027312 Bacteria 331009
190 Ga0268266_10149749 3300028379 Bacteria 2102
191 Ga0307515_10257649 3300028794 Bacteria 1486
192 Ga0268256_1000008 3300030500 Bacteria 1050654
193 Ga0268256_1000044 3300030500 Bacteria 330997
194 Ga0316176_1162259 3300030732 Bacteria 3629
195 Ga0314311_1000677 3300030733 Bacteria 6629
196 Ga0314311_1232034 3300030733 Bacteria 2068
197 Ga0316178_1024833 3300030735 Bacteria 1795
198 Ga0316181_1089852 3300030744 Bacteria 755
199 Ga0307513_10129726 3300031456 Bacteria 2469
200 Ga0307408_100063368 3300031548 Bacteria 2704
201 Ga0307405_10043761 3300031731 Bacteria 2734
202 Ga0307405_10163706 3300031731 Bacteria 1579
203 Ga0307413_10019020 3300031824 Bacteria 3618
204 Ga0307413_10034057 3300031824 Bacteria 2907
205 Ga0307413_10065611 3300031824 Bacteria 2261
206 Ga0307413_10092925 3300031824 Bacteria 1970
207 Ga0307413_10197592 3300031824 Bacteria 1449
208 Ga0307413_10213934 3300031824 Bacteria 1402
209 Ga0307410_10403880 3300031852 Bacteria 1104
210 Ga0307406_10019579 3300031901 Bacteria 3974
211 Ga0307406_10065325 3300031901 Bacteria 2364
212 Ga0307406_10162120 3300031901 Bacteria 1608
213 Ga0307407_10344167 3300031903 Bacteria 1054
214 Ga0307412_10142543 3300031911 Bacteria 1757
215 Ga0307412_11199068 3300031911 Bacteria 679
216 Ga0307409_100341253 3300031995 Bacteria 1409
217 Ga0307409_100589902 3300031995 Bacteria 1097
218 Ga0307416_100833343 3300032002 Bacteria 1020
219 Ga0307414_10009427 3300032004 Bacteria 5608
220 Ga0307414_10096892 3300032004 Bacteria 2208
221 Ga0307414_10101919 3300032004 Bacteria 2162
222 Ga0307414_10261566 3300032004 Bacteria 1444
223 Ga0307414_10345491 3300032004 Bacteria 1275
224 Ga0307414_10472630 3300032004 Bacteria 1104
225 Ga0307414_10527982 3300032004 Bacteria 1048
226 Ga0307414_11048897 3300032004 Bacteria 751
227 Ga0307411_10095763 3300032005 Bacteria 2085
228 Ga0307411_10119378 3300032005 Bacteria 1904
229 Ga0307411_10199855 3300032005 Bacteria 1534
230 Ga0307411_10499098 3300032005 Bacteria 1028
231 Ga0307411_10660404 3300032005 Bacteria 906
232 Ga0395899_0090731 3300037312 Bacteria 2215
233 Ga0395900_0059445 3300037418 Bacteria 3935
234 Ga0395898_0125812 3300037466 Bacteria 2456
235 Ga0395898_0363603 3300037466 Bacteria 1380
236 Ga0395905_0000337 3300037471 Bacteria 67116
237 Ga0395905_0344163 3300037471 Bacteria 1382
238 Ga0237819_00396 3300038705 Bacteria 15189
239 Ga0439436_0007475 3300041404 Bacteria 3362
240 Ga0439436_0024671 3300041404 Bacteria 1773
241 Ga0439436_0027716 3300041404 Bacteria 1656
242 Ga0439436_0065148 3300041404 Bacteria 1018
243 Ga0439439_0001774 3300041406 Bacteria 4405
244 Ga0439447_000227 3300041407 Bacteria 19837
245 Ga0439465_0001488 3300041413 Bacteria 7601
246 Ga0439465_0001585 3300041413 Bacteria 7399
247 Ga0451791_0580728 3300041451 Bacteria 886
248 Ga0451793_0699908 3300041452 Bacteria 1378
249 Ga0451793_1307872 3300041452 Bacteria 3444
250 Ga0451798_0856894 3300041458 Bacteria 629
251 Ga0451802_0888962 3300041460 Bacteria 2206
252 Ga0451807_1002956 3300041486 Bacteria 2653
253 Ga0451807_1371999 3300041486 Bacteria 1399
254 Ga0451837_1065996 3300041494 Bacteria 1428
255 Ga0439433_0114252 3300041999 Bacteria 677
256 Ga0439445_0003037 3300042004 Bacteria 3757
257 Ga0439445_0060589 3300042004 Bacteria 1034
258 Ga0439432_080069 3300042006 Bacteria 990
259 Ga0439449_0000013 3300042007 Bacteria 51317
260 Ga0439449_0009784 3300042007 Bacteria 3628
261 Ga0439449_0024128 3300042007 Bacteria 2274
262 Ga0439449_0099543 3300042007 Bacteria 1074
263 Ga0439449_0103959 3300042007 Bacteria 1051
264 Ga0439449_0143547 3300042007 Bacteria 889
265 Ga0439452_027459 3300042010 Bacteria 1428
266 Ga0439462_0004790 3300042015 Bacteria 3317
267 Ga0450905_002492 3300042142 Bacteria 2366
268 Ga0450901_004280 3300042533 Bacteria 1478
269 Ga0495627_013810 3300046453 Bacteria 2835
270 Ga0495638_0001816 3300046460 Bacteria 18521
271 Ga0495638_0055134 3300046460 Bacteria 2469
272 Ga0495607_0014288 3300046501 Bacteria 5175
273 Ga0495606_0003699 3300046507 Bacteria 15988
274 Ga0495610_0006190 3300046512 Bacteria 8317
275 Ga0495631_0009026 3300046518 Bacteria 4997
276 Ga0495643_0001888 3300046522 Bacteria 17752
277 Ga0495663_0003944 3300046525 Bacteria 4225
278 Ga0495663_0010379 3300046525 Bacteria 2591
279 Ga0495663_0030665 3300046525 Bacteria 1594
280 Ga0495663_0091833 3300046525 Bacteria 990
281 Ga0495598_0001993 3300046537 Bacteria 4150
282 Ga0495621_0000437 3300046539 Bacteria 10313
283 Ga0495633_0007055 3300046558 Bacteria 6541
284 Ga0495633_0028534 3300046558 Bacteria 2719
285 Ga0495633_0221336 3300046558 Bacteria 866
286 Ga0495668_0002539 3300046616 Bacteria 14886
287 Ga0495659_0147653 3300046664 Bacteria 942
288 Ga0495670_0032491 3300046691 Bacteria 2596
289 Ga0495660_0014248 3300046810 Bacteria 4604
290 Ga0495636_0011259 3300047318 Bacteria 3539
291 Ga0495672_0000720 3300047320 Bacteria 36381
292 Ga0495681_0018507 3300047470 Bacteria 3836
293 Ga0495686_0024029 3300047472 Bacteria 4008
294 Ga0495686_0055548 3300047472 Bacteria 2475
295 Ga0496101_0124030 3300048904 Bacteria 1956
296 Ga0496102_0409840 3300048905 Bacteria 1273
297 Ga0496103_0073307 3300048906 Bacteria 2145
298 Ga0496106_0188636 3300048909 Bacteria 1638
299 Ga0496110_0106629 3300048913 Bacteria 2514
300 Ga0496110_0479722 3300048913 Bacteria 1133
301 Ga0496111_0038768 3300048914 Bacteria 3414
302 Ga0496112_0053999 3300048915 Bacteria 3947
303 Ga0496113_0159417 3300048916 Bacteria 1783
304 Ga0496114_0004841 3300048917 Bacteria 10491
305 Ga0496114_0141066 3300048917 Bacteria 2086
306 Ga0496116_0004506 3300048919 Bacteria 13260
307 Ga0496116_0057663 3300048919 Bacteria 2537
308 Ga0496116_0065659 3300048919 Bacteria 2326
309 Ga0496117_0001593 3300048920 Bacteria 32105
310 Ga0496117_0010036 3300048920 Bacteria 8700
311 Ga0496117_0057368 3300048920 Bacteria 2705
312 Ga0496117_0126478 3300048920 Bacteria 1558
313 Ga0496118_0000383 3300048921 Bacteria 74507
314 Ga0496118_0002149 3300048921 Bacteria 27507
315 Ga0496118_0007017 3300048921 Bacteria 12131
316 Ga0496118_0010293 3300048921 Bacteria 9276
317 Ga0496118_0025694 3300048921 Bacteria 5040
318 Ga0496118_0092745 3300048921 Bacteria 2071
319 Ga0496119_0000069 3300048922 Bacteria 155265
320 Ga0496119_0001338 3300048922 Bacteria 30220
321 Ga0496120_0000320 3300048923 Bacteria 79515
322 Ga0496120_0000884 3300048923 Bacteria 42219
323 Ga0496121_0012851 3300048924 Bacteria 9057
324 Ga0496121_0026661 3300048924 Bacteria 5434
325 Ga0496121_0027250 3300048924 Bacteria 5352
326 Ga0496121_0591253 3300048924 Bacteria 687
327 Ga0496122_0000315 3300048925 Bacteria 106323
328 Ga0496122_0000710 3300048925 Bacteria 65728
329 Ga0496122_0006173 3300048925 Bacteria 13927
330 Ga0496122_0007903 3300048925 Bacteria 11665
331 Ga0496122_0143389 3300048925 Bacteria 1489
332 Ga0496123_0000104 3300048926 Bacteria 168230
333 Ga0496123_0000149 3300048926 Bacteria 142962
334 Ga0496123_0001416 3300048926 Bacteria 33518
335 Ga0496123_0012089 3300048926 Bacteria 7401
336 Ga0496123_0027054 3300048926 Bacteria 4280
337 Ga0496123_0043980 3300048926 Bacteria 3059
338 Ga0496123_0243850 3300048926 Bacteria 890
339 Ga0496123_0295401 3300048926 Bacteria 776
340 Ga0496124_0000006 3300048927 Bacteria 904259
341 Ga0496124_0000403 3300048927 Bacteria 78615
342 Ga0496124_0000516 3300048927 Bacteria 66627
343 Ga0496124_0002024 3300048927 Bacteria 27560
344 Ga0496124_0009110 3300048927 Bacteria 10260
345 Ga0496124_0076186 3300048927 Bacteria 2769
346 Ga0496124_0122623 3300048927 Bacteria 2074
347 Ga0496124_0244605 3300048927 Bacteria 1331
348 Ga0496124_0346026 3300048927 Bacteria 1053
349 Ga0496124_0548081 3300048927 Bacteria 764
350 Ga0496124_0653378 3300048927 Bacteria 674
351 Ga0496125_0001475 3300048928 Bacteria 34001
352 Ga0496125_0009029 3300048928 Bacteria 10324
353 Ga0496125_0204109 3300048928 Bacteria 1290
354 Ga0496126_0000913 3300048929 Bacteria 51086
355 Ga0496126_0014986 3300048929 Bacteria 7816
356 Ga0496126_0153205 3300048929 Bacteria 1974
357 Ga0496126_0532701 3300048929 Bacteria 934
358 Ga0496126_0637346 3300048929 Bacteria 835
359 Ga0501031_0003470 3300049568 Bacteria 10118
360 Ga0501031_0567676 3300049568 Bacteria 730
361 Ga0501032_0019800 3300049569 Bacteria 4699
362 Ga0501032_0128957 3300049569 Bacteria 1669
363 Ga0501032_0303435 3300049569 Bacteria 1032
364 Ga0501032_0538376 3300049569 Bacteria 745
365 Ga0501033_0002068 3300049570 Bacteria 17441
366 Ga0501034_0001659 3300049571 Bacteria 28693
367 Ga0501034_0006335 3300049571 Bacteria 12743
368 Ga0501034_0039133 3300049571 Bacteria 4803
369 Ga0501034_0075701 3300049571 Bacteria 3372
370 Ga0501034_0298578 3300049571 Bacteria 1548
371 Ga0501034_0343886 3300049571 Bacteria 1421
372 Ga0501036_0003593 3300049572 Bacteria 12398
373 Ga0501037_0001197 3300049573 Bacteria 19151
374 Ga0501037_0148575 3300049573 Bacteria 1676
375 Ga0501038_0001241 3300049574 Bacteria 23114
376 Ga0501038_0128179 3300049574 Bacteria 2086
377 Ga0501039_0003604 3300049575 Bacteria 11607
378 Ga0501039_0286392 3300049575 Bacteria 1295
379 Ga0501043_0002746 3300049579 Bacteria 14723
380 Ga0501043_0024440 3300049579 Bacteria 4741
381 Ga0501047_0003107 3300049581 Bacteria 15756
382 Ga0501047_0088924 3300049581 Bacteria 2966
383 Ga0501068_0198919 3300049584 Bacteria 1271
384 Ga0501070_0003496 3300049586 Bacteria 13612
385 Ga0501070_0110402 3300049586 Bacteria 2273
386 Ga0501073_0027688 3300049589 Bacteria 4051
387 Ga0501235_037662 3300049669 Bacteria 1101
388 Ga0501080_0087953 3300049742 Bacteria 2886
389 Ga0501035_0002247 3300049822 Bacteria 19119
390 Ga0501035_0361286 3300049822 Bacteria 1213
391 Ga0501044_0002685 3300049823 Bacteria 20231
392 nmdc:mga00v17_102574_c1 3300050491 Bacteria 1807
393 nmdc:mga00v17_121041_c1 3300050491 Bacteria 1666
394 nmdc:mga00v17_130671_c1 3300050491 Bacteria 1605
395 nmdc:mga00v17_37422_c1 3300050491 Bacteria 2898
396 nmdc:mga00v17_41_c2 3300050491 Bacteria 55060
397 nmdc:mga00v17_51702_c1 3300050491 Bacteria 2499
398 Ga0500626_175798 3300053128 Bacteria 866
399 Ga0500565_004963 3300053734 Bacteria 1153
400 2987608624 2987605356 Bacteria 4187822
401 2547503281 2547132130 Bacteria 4660562
402 2578457141 2576861471 Bacteria 4648976
403 2643815420 2643221559 Bacteria 4424915
404 2643881900 2643221573 Bacteria 4784121
405 2643909268 2643221579 Bacteria 4443405
406 2643914883 2643221581 Bacteria 3893603
407 2643941291 2643221586 Bacteria 4446529
408 2643973738 2643221593 Bacteria 6296053
409 2644079645 2643221612 Bacteria 4361984
410 2644662944 2643221720 Bacteria 4694283
411 2644696205 2643221727 Bacteria 4415595
412 2644699898 2643221728 Bacteria 4797149
413 2747951244 2747842428 Bacteria 4689383
414 2748019565 2747842501 Bacteria 5293829
415 2765580349 2765235840 Bacteria 4663337
416 2816518613 2816332141 Bacteria 4436036
417 2819661145 2818991457 Bacteria 5323295
418 2842395492 2842391507 Bacteria 4486072
419 2842759119 2842757796 Bacteria 3981385
420 2842782231 2842780639 Bacteria 4337790
421 2852652282 2852649853 Bacteria 4036942
422 2852687001 2852684882 Bacteria 5463342
423 2857445721 2857442823 Bacteria 4562550
424 2874223027 2874220319 Bacteria 4594709
425 2895501804 2895498888 Bacteria 5283788
426 2895517646 2895511927 Bacteria 6802080
427 2895525210 2895522137 Bacteria 3284416
428 2895526154 2895525241 Bacteria 3388457
429 2919092936 2919089067 Bacteria 4560942
430 2919131214 2919130084 Bacteria 5301837
431 2919137378 2919134579 Bacteria 4480386
432 2919514999 2919513703 Bacteria 3844312
433 2919676380 2919675420 Bacteria 3969095
434 2923517316 2923516293 Bacteria 3716336
435 2928498923 2928496128 Bacteria 4631123
436 2929196454 2929195423 Bacteria 5325372
437 2931383511 2931380184 Bacteria 4455911
438 2937615007 2937610967 Bacteria 4618818
439 2939589668 2939589442 Bacteria 4214238
440 2939624261 2939622612 Bacteria 4698046
441 2939630646 2939626828 Bacteria 4695272
442 2941478899 2941475908 Bacteria 4145589
443 2941493851 2941489479 Bacteria 6313767
444 2961049792 2961047084 Bacteria 4594415
445 2961066525 2961064222 Bacteria 4749990
446 2974307777 2974307012 Bacteria 4172388
447 2977248496 2977247770 Bacteria 4160543
448 2984517017 2984514374 Bacteria 4172479
449 2995953217 2995948881 Bacteria 6358104
450 8002871057 8002869464 Bacteria 3588529
451 8003017031 8003014200 Bacteria 4059994
452 8021626280 8021622325 Bacteria 4844743
453 8021626737 8021626552 Bacteria 4665214
454 8021651339 8021648035 Bacteria 4772378
455 SwRhRL2b_contig_1243823
456 JGI25152J39213_1001190
457 JGI25150J39212_1000714
458 JGI25150J39212_1034413
459 JGI25151J46595_10000105
460 JGI25151J46595_10000116
461 JGI25151J46595_10040208
462 JGI25406J46586_10072868
463 JGI25153J46596_10000077
464 rootH2_10121715
465 rootH2_10141305
466 rootH1_10033719
467 Ga0055526_1000316
468 Ga0055526_1058950
469 Ga0055537_1000238
470 Ga0055537_1000526
471 Ga0055524_1000074
472 Ga0055524_1007046
473 Ga0055524_1011809
474 Ga0055524_1032907
475 Ga0055536_1001898
476 Ga0055536_1007501
477 Ga0055536_1008245
478 Ga0055536_1009818
479 Ga0055536_1037900
480 Ga0055536_1054706
481 Ga0055534_1000121
482 Ga0055534_1000231
483 Ga0055528_1000028
484 Ga0055528_1000148
485 Ga0055530_10000618
486 Ga0055530_10001089
487 Ga0055530_10001387
488 Ga0055530_10036389
489 Ga0055531_10002056
490 Ga0055531_10008235
491 Ga0055531_10012741
492 Ga0055531_10013009
493 Ga0055531_10013189
494 Ga0055531_10018835
495 Ga0055531_10039059
496 Ga0055531_10039781
497 Ga0058692_1000013
498 Ga0058692_1000045
499 Ga0065704_10000819
500 Ga0065704_10001264
501 Ga0065715_10001279
502 Ga0070670_100006122
503 Ga0070660_100522633
504 Ga0070692_10336052
505 Ga0070668_100007597
506 Ga0070668_100058055
507 Ga0070669_100300131
508 Ga0070671_100163823
509 Ga0070674_100025257
510 Ga0070659_100753805
511 Ga0070678_100049382
512 Ga0070678_100269628
513 Ga0068867_100276809
514 Ga0070665_100082364
515 Ga0070665_100164091
516 Ga0070665_100570378
517 Ga0068854_100552238
518 Ga0081539_10051143
519 Ga0075364_10001855
520 Ga0075364_10027743
521 Ga0075364_10119950
522 Ga0075364_10146993
523 Ga0075364_10342142
524 Ga0075364_10424780
525 Ga0099826_10235936
526 Ga0105251_10000350
527 Ga0105251_10007580
528 Ga0105244_10019377
529 Ga0105243_10004100
530 Ga0105243_10140978
531 Ga0105032_101650
532 Ga0157373_10204357
533 Ga0157373_10287536
534 Ga0157373_10682606
535 Ga0157373_10716800
536 Ga0157371_10000184
537 Ga0157371_10100030
538 Ga0157371_10335194
539 Ga0157371_10491285
540 Ga0157371_10918826
541 Ga0157370_10004081
542 Ga0157370_10151240
543 Ga0157370_10606930
544 Ga0157369_10968707
545 Ga0157375_10190473
546 Ga0157375_10324989
547 Ga0157380_10020180
548 Ga0182008_10000939
549 Ga0182008_10015701
550 Ga0182006_1005214
551 Ga0182006_1006571
552 Ga0182006_1033551
553 Ga0182006_1047513
554 Ga0182005_1000268
555 Ga0182005_1002760
556 Ga0183360_10005
557 Ga0183361_11862
558 Ga0163161_10000766
559 Ga0163161_10020893
560 Ga0207425_1000045
561 Ga0207425_1001522
562 Ga0207425_1031610
563 Ga0209129_1000057
564 Ga0209565_1000023
565 Ga0209565_1000034
566 Ga0209565_1003391
567 Ga0209673_1000039
568 Ga0209673_1000047
569 Ga0209673_1004508
570 Ga0209130_1004089
571 Ga0209130_1014827
572 Ga0209675_1000016
573 Ga0209675_1000023
574 Ga0209675_1022965
575 Ga0209675_1041762
576 Ga0209676_1000027
577 Ga0209676_1000037
578 Ga0209676_1000160
579 Ga0209676_1000796
580 Ga0209676_1008927
581 Ga0209676_1009833
582 Ga0209676_1009939
583 Ga0209676_1010242
584 Ga0209676_1023833
585 Ga0209676_1029436
586 Ga0209025_1000013
587 Ga0209025_1000023
588 Ga0209025_1008851
589 Ga0209025_1030426
590 Ga0209025_1097119
591 Ga0209564_1000066
592 Ga0209564_1000194
593 Ga0209564_1005813
594 Ga0209564_1009492
595 Ga0209758_1000014
596 Ga0209758_1007000
597 Ga0209050_1000462
598 Ga0209050_1000971
599 Ga0209050_1002178
600 Ga0209050_1021158
601 Ga0209050_1021847
602 Ga0209050_1023286
603 Ga0209256_1000048
604 Ga0209256_1000825
605 Ga0209256_1001572
606 Ga0209256_1012899
607 Ga0209256_1022158
608 Ga0209256_1030593
609 Ga0209051_1001229
610 Ga0209051_1018477
611 Ga0209257_1000046
612 Ga0209257_1000067
613 Ga0209257_1000177
614 Ga0209257_1000198
615 Ga0209257_1002904
616 Ga0209257_1003668
617 Ga0209257_1010645
618 Ga0209257_1012481
619 Ga0209257_1012637
620 Ga0207655_1036411
621 Ga0207713_1001094
622 Ga0207713_1007090
623 Ga0207688_10393020
624 Ga0207657_10469328
625 Ga0207649_10509601
626 Ga0207681_10081906
627 Ga0207650_10004216
628 Ga0207650_10098513
629 Ga0207644_10012724
630 Ga0207709_10002468
631 Ga0207709_10004945
632 Ga0207669_10043720
633 Ga0207691_10052571
634 Ga0207711_10175487
635 Ga0207668_10023992
636 Ga0207668_10026923
637 Ga0207641_10519452
638 Ga0207648_10234166
639 Ga0207683_10050168
640 Ga0207683_10295249
641 Ga0209371_1000007
642 Ga0209371_1000043
643 Ga0268266_10149749
644 Ga0307515_10257649
645 Ga0268256_1000008
646 Ga0268256_1000044
647 Ga0316176_1162259
648 Ga0314311_1000677
649 Ga0314311_1232034
650 Ga0316178_1024833
651 Ga0316181_1089852
652 Ga0307513_10129726
653 Ga0307408_100063368
654 Ga0307405_10043761
655 Ga0307405_10163706
656 Ga0307413_10019020
657 Ga0307413_10034057
658 Ga0307413_10065611
659 Ga0307413_10092925
660 Ga0307413_10197592
661 Ga0307413_10213934
662 Ga0307410_10403880
663 Ga0307406_10019579
664 Ga0307406_10065325
665 Ga0307406_10162120
666 Ga0307407_10344167
667 Ga0307412_10142543
668 Ga0307412_11199068
669 Ga0307409_100341253
670 Ga0307409_100589902
671 Ga0307416_100833343
672 Ga0307414_10009427
673 Ga0307414_10096892
674 Ga0307414_10101919
675 Ga0307414_10261566
676 Ga0307414_10345491
677 Ga0307414_10472630
678 Ga0307414_10527982
679 Ga0307414_11048897
680 Ga0307411_10095763
681 Ga0307411_10119378
682 Ga0307411_10199855
683 Ga0307411_10499098
684 Ga0307411_10660404
685 Ga0395899_0090731
686 Ga0395900_0059445
687 Ga0395898_0125812
688 Ga0395898_0363603
689 Ga0395905_0000337
690 Ga0395905_0344163
691 Ga0237819_00396
692 Ga0439436_0007475
693 Ga0439436_0024671
694 Ga0439436_0027716
695 Ga0439436_0065148
696 Ga0439439_0001774
697 Ga0439447_000227
698 Ga0439465_0001488
699 Ga0439465_0001585
700 Ga0451791_0580728
701 Ga0451793_0699908
702 Ga0451793_1307872
703 Ga0451798_0856894
704 Ga0451802_0888962
705 Ga0451807_1002956
706 Ga0451807_1371999
707 Ga0451837_1065996
708 Ga0439433_0114252
709 Ga0439445_0003037
710 Ga0439445_0060589
711 Ga0439432_080069
712 Ga0439449_0000013
713 Ga0439449_0009784
714 Ga0439449_0024128
715 Ga0439449_0099543
716 Ga0439449_0103959
717 Ga0439449_0143547
718 Ga0439452_027459
719 Ga0439462_0004790
720 Ga0450905_002492
721 Ga0450901_004280
722 Ga0495627_013810
723 Ga0495638_0001816
724 Ga0495638_0055134
725 Ga0495607_0014288
726 Ga0495606_0003699
727 Ga0495610_0006190
728 Ga0495631_0009026
729 Ga0495643_0001888
730 Ga0495663_0003944
731 Ga0495663_0010379
732 Ga0495663_0030665
733 Ga0495663_0091833
734 Ga0495598_0001993
735 Ga0495621_0000437
736 Ga0495633_0007055
737 Ga0495633_0028534
738 Ga0495633_0221336
739 Ga0495668_0002539
740 Ga0495659_0147653
741 Ga0495670_0032491
742 Ga0495660_0014248
743 Ga0495636_0011259
744 Ga0495672_0000720
745 Ga0495681_0018507
746 Ga0495686_0024029
747 Ga0495686_0055548
748 Ga0496101_0124030
749 Ga0496102_0409840
750 Ga0496103_0073307
751 Ga0496106_0188636
752 Ga0496110_0106629
753 Ga0496110_0479722
754 Ga0496111_0038768
755 Ga0496112_0053999
756 Ga0496113_0159417
757 Ga0496114_0004841
758 Ga0496114_0141066
759 Ga0496116_0004506
760 Ga0496116_0057663
761 Ga0496116_0065659
762 Ga0496117_0001593
763 Ga0496117_0010036
764 Ga0496117_0057368
765 Ga0496117_0126478
766 Ga0496118_0000383
767 Ga0496118_0002149
768 Ga0496118_0007017
769 Ga0496118_0010293
770 Ga0496118_0025694
771 Ga0496118_0092745
772 Ga0496119_0000069
773 Ga0496119_0001338
774 Ga0496120_0000320
775 Ga0496120_0000884
776 Ga0496121_0012851
777 Ga0496121_0026661
778 Ga0496121_0027250
779 Ga0496121_0591253
780 Ga0496122_0000315
781 Ga0496122_0000710
782 Ga0496122_0006173
783 Ga0496122_0007903
784 Ga0496122_0143389
785 Ga0496123_0000104
786 Ga0496123_0000149
787 Ga0496123_0001416
788 Ga0496123_0012089
789 Ga0496123_0027054
790 Ga0496123_0043980
791 Ga0496123_0243850
792 Ga0496123_0295401
793 Ga0496124_0000006
794 Ga0496124_0000403
795 Ga0496124_0000516
796 Ga0496124_0002024
797 Ga0496124_0009110
798 Ga0496124_0076186
799 Ga0496124_0122623
800 Ga0496124_0244605
801 Ga0496124_0346026
802 Ga0496124_0548081
803 Ga0496124_0653378
804 Ga0496125_0001475
805 Ga0496125_0009029
806 Ga0496125_0204109
807 Ga0496126_0000913
808 Ga0496126_0014986
809 Ga0496126_0153205
810 Ga0496126_0532701
811 Ga0496126_0637346
812 Ga0501031_0003470
813 Ga0501031_0567676
814 Ga0501032_0019800
815 Ga0501032_0128957
816 Ga0501032_0303435
817 Ga0501032_0538376
818 Ga0501033_0002068
819 Ga0501034_0001659
820 Ga0501034_0006335
821 Ga0501034_0039133
822 Ga0501034_0075701
823 Ga0501034_0298578
824 Ga0501034_0343886
825 Ga0501036_0003593
826 Ga0501037_0001197
827 Ga0501037_0148575
828 Ga0501038_0001241
829 Ga0501038_0128179
830 Ga0501039_0003604
831 Ga0501039_0286392
832 Ga0501043_0002746
833 Ga0501043_0024440
834 Ga0501047_0003107
835 Ga0501047_0088924
836 Ga0501068_0198919
837 Ga0501070_0003496
838 Ga0501070_0110402
839 Ga0501073_0027688
840 Ga0501235_037662
841 Ga0501080_0087953
842 Ga0501035_0002247
843 Ga0501035_0361286
844 Ga0501044_0002685
845 nmdc:mga00v17_102574_c1
846 nmdc:mga00v17_121041_c1
847 nmdc:mga00v17_130671_c1
848 nmdc:mga00v17_37422_c1
849 nmdc:mga00v17_41_c2
850 nmdc:mga00v17_51702_c1
851 Ga0500626_175798
852 Ga0500565_004963
853 2987608624
854 2547503281
855 2578457141
856 2643815420
857 2643881900
858 2643909268
859 2643914883
860 2643941291
861 2643973738
862 2644079645
863 2644662944
864 2644696205
865 2644699898
866 2747951244
867 2748019565
868 2765580349
869 2816518613
870 2819661145
871 2842395492
872 2842759119
873 2842782231
874 2852652282
875 2852687001
876 2857445721
877 2874223027
878 2895501804
879 2895517646
880 2895525210
881 2895526154
882 2919092936
883 2919131214
884 2919137378
885 2919514999
886 2919676380
887 2923517316
888 2928498923
889 2929196454
890 2931383511
891 2937615007
892 2939589668
893 2939624261
894 2939630646
895 2941478899
896 2941493851
897 2961049792
898 2961066525
899 2974307777
900 2977248496
901 2984517017
902 2995953217
903 8002871057
904 8003017031
905 8021626280
906 8021626737
907 8021651339

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01812

5-FTHF_cyc-lig

5-formyltetrahydrofolate cyclo-ligase family

43

222

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2jcb-assembly2.cif.gz_B the crystal structure of 5-formyl-tetrahydrofolate cycloligase from bacillus anthracis (ba4489) 0.8458 4 190
3hy6-assembly1.cif.gz_A structure of human mthfs with adp 0.8304 1 184
1wkc-assembly1.cif.gz_A crystal structure of a 5-formyltetrahydrofolate cycloligase-related protein from thermus thermophilus hb8 0.8298 5 194
1u3g-assembly1.cif.gz_A structural and functional characterization of a 5,10-methenyltetrahydrofolate synthetase from mycoplasma pneumoniae (gi: 13508087) 0.8223 5 185
2jcb-assembly2.cif.gz_B the crystal structure of 5-formyl-tetrahydrofolate cycloligase from bacillus anthracis (ba4489) 0.817 4 190
ID Description Score Start End Superfamily
af_P0AC28_1_181_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.9153 12 188 3.40.50.10420
af_P0AC28_1_181_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8914 12 188 3.40.50.10420
2jcbB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8458 4 190 3.40.50.10420
af_Q9P7W2_1_201_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8358 1 189 3.40.50.10420
af_A0A0G2L0J2_1_199_3.40.50.10420 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NagB/RpiA/CoA transferase-like 0.8334 3 187 3.40.50.10420
ID Description Score Start End GO Terms
AF-A0A2S7A7J3-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) 0.9736 1 190 GO:0005524
GO:0009396
GO:0030272
GO:0035999
GO:0046872
AF-A0A2W4XXH1-F1-model_v4 deleted 0.9692 4 194
AF-A0A2N1GKN3-F1-model_v4 deleted 0.9641 33 195
AF-A0A4V1SQG7-F1-model_v4 5-formyltetrahydrofolate cyclo-ligase (EC 6.3.3.2) 0.9608 70 195 GO:0005524
GO:0009396
GO:0030272
GO:0035999
GO:0046872
AF-M5CQD8-F1-model_v4 deleted 0.9586 5 198

Map