F447309

General Info

Members Datasets Scaffolds Average Seq Length
454 280 908 227

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10030102|rootH1_100301023
Length 262
Sequence MANPLVVAPSILSADFGRLAEEVRAVDTAGADWIHVDVMDGRFVPNITFGPVVIEAVRRATRKPLNVHLMMVEPERMLEDFVKAGADHLLVQCEPASTIHLHRVLSRIRELGAKAGVVIDPGSPVAFAEHVLHLCDVVLVMTVNPGFGGQKFLPEVLPKITALRRMCDTRGLNPYIEVDGGTSGDNAWQAVDAGADALVAGSAVFGSXVSVSASAHPRASFDTDQGRGDVLHRTVTNPGHNESIAGTEPAAYWAEPREPVTR

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
88 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
92 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
94 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
95 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
98 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
135 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
136 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
137 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
138 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
139 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
147 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
150 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
154 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
155 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
170 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
171 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
172 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
180 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
181 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
184 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
189 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
190 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
191 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
192 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
193 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
196 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
199 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
202 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
211 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
212 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
217 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
223 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
224 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
255 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
256 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
257 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
265 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
266 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
267 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
271 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
274 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
275 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
276 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
277 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
278 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
279 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
280 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.93
Nodule 0
Rhizoplane 4.85
Rhizosphere 82.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10030102 3300003316 Bacteria 6221
2 JGI25156J39149_1000342 3300002705 Bacteria 30277
3 JGI25156J39149_1000952 3300002705 Bacteria 13840
4 JGI25154J39366_1000850 3300002738 Bacteria 13249
5 JGI25157J39369_1000428 3300002741 Bacteria 27593
6 Ga0055539_1000284 3300003752 Bacteria 28851
7 Ga0055539_1000318 3300003752 Bacteria 24954
8 Ga0055533_1000008 3300003756 Bacteria 575861
9 Ga0055525_1001196 3300003759 Bacteria 5818
10 Ga0055535_1000073 3300003761 Bacteria 112778
11 Ga0055529_1000123 3300003763 Bacteria 112769
12 Ga0070658_10032998 3300005327 Bacteria 4163
13 Ga0070658_10039295 3300005327 Bacteria 3816
14 Ga0070658_10068047 3300005327 Bacteria 2911
15 Ga0070658_10235638 3300005327 Bacteria 1551
16 Ga0070658_10626773 3300005327 Bacteria 933
17 Ga0070683_100002857 3300005329 Bacteria 13831
18 Ga0068869_100196010 3300005334 Bacteria 1591
19 Ga0070680_100008540 3300005336 Bacteria 7845
20 Ga0070660_100009463 3300005339 Bacteria 6854
21 Ga0070660_100033439 3300005339 Bacteria 3876
22 Ga0070660_100090394 3300005339 Bacteria 2414
23 Ga0070660_100233873 3300005339 Bacteria 1495
24 Ga0070692_10280043 3300005345 Bacteria 1010
25 Ga0070671_100573305 3300005355 Bacteria 974
26 Ga0070673_100008947 3300005364 Bacteria 6695
27 Ga0070673_100140838 3300005364 Bacteria 2034
28 Ga0070659_100000111 3300005366 Bacteria 60284
29 Ga0070659_100044311 3300005366 Bacteria 3482
30 Ga0070659_100102658 3300005366 Bacteria 2302
31 Ga0070709_10019829 3300005434 Bacteria 3894
32 Ga0070709_10136406 3300005434 Bacteria 1681
33 Ga0070709_10404391 3300005434 Bacteria 1020
34 Ga0070714_100266734 3300005435 Bacteria 1587
35 Ga0070714_100279276 3300005435 Bacteria 1551
36 Ga0070714_100625785 3300005435 Bacteria 1035
37 Ga0070713_100013935 3300005436 Bacteria 5952
38 Ga0070713_100054018 3300005436 Bacteria 3331
39 Ga0070713_100115159 3300005436 Bacteria 2350
40 Ga0070711_100026134 3300005439 Bacteria 3824
41 Ga0070711_100033454 3300005439 Bacteria 3423
42 Ga0070711_100073675 3300005439 Bacteria 2413
43 Ga0070705_100005803 3300005440 Bacteria 6037
44 Ga0070694_100008388 3300005444 Bacteria 6321
45 Ga0070708_100468139 3300005445 Bacteria 1189
46 Ga0070678_100601232 3300005456 Bacteria 982
47 Ga0070662_100048281 3300005457 Bacteria 3066
48 Ga0070662_100255696 3300005457 Bacteria 1410
49 Ga0070681_10022933 3300005458 Bacteria 6273
50 Ga0070706_100123884 3300005467 Bacteria 2410
51 Ga0070679_100015809 3300005530 Bacteria 7260
52 Ga0070679_100137535 3300005530 Bacteria 2424
53 Ga0070684_100005741 3300005535 Bacteria 9537
54 Ga0068853_100122567 3300005539 Bacteria 2321
55 Ga0068853_100818641 3300005539 Bacteria 892
56 Ga0070695_100019945 3300005545 Bacteria 4088
57 Ga0070696_100000430 3300005546 Bacteria 26356
58 Ga0070696_100038373 3300005546 Bacteria 3306
59 Ga0070696_100346296 3300005546 Bacteria 1150
60 Ga0070696_100677268 3300005546 Bacteria 839
61 Ga0070693_100009513 3300005547 Bacteria 4835
62 Ga0070665_100041431 3300005548 Bacteria 4629
63 Ga0070704_100027656 3300005549 Bacteria 3764
64 Ga0070704_100286834 3300005549 Bacteria 1366
65 Ga0068855_100008009 3300005563 Bacteria 12765
66 Ga0068855_100017714 3300005563 Bacteria 8565
67 Ga0068855_100094705 3300005563 Bacteria 3443
68 Ga0068855_100115848 3300005563 Bacteria 3072
69 Ga0068855_100623993 3300005563 Bacteria 1160
70 Ga0068857_100000918 3300005577 Bacteria 22269
71 Ga0068854_100012591 3300005578 Bacteria 5541
72 Ga0068854_100034762 3300005578 Bacteria 3523
73 Ga0068856_100001645 3300005614 Bacteria 23430
74 Ga0068859_100572897 3300005617 Bacteria 1223
75 Ga0068861_100048083 3300005719 Bacteria 3223
76 Ga0068858_100461456 3300005842 Bacteria 1225
77 Ga0068860_100725811 3300005843 Bacteria 1004
78 Ga0081455_10010856 3300005937 Bacteria 9195
79 Ga0081455_10320471 3300005937 Bacteria 1104
80 Ga0081538_10097499 3300005981 Bacteria 1494
81 Ga0081540_1000066 3300005983 Bacteria 115420
82 Ga0081540_1000274 3300005983 Bacteria 53893
83 Ga0081539_10002582 3300005985 Bacteria 24995
84 Ga0070717_10007411 3300006028 Bacteria 8148
85 Ga0070717_10191845 3300006028 Bacteria 1785
86 Ga0070717_10456058 3300006028 Bacteria 1152
87 Ga0075364_10322016 3300006051 Bacteria 1053
88 Ga0070712_100001247 3300006175 Bacteria 15371
89 Ga0075362_10002695 3300006177 Bacteria 6039
90 Ga0075362_10251896 3300006177 Bacteria 868
91 Ga0075369_10000526 3300006186 Bacteria 12037
92 Ga0075366_10344160 3300006195 Bacteria 915
93 Ga0097621_100019447 3300006237 Bacteria 5212
94 Ga0075370_10013220 3300006353 Bacteria 4381
95 Ga0075370_10078397 3300006353 Bacteria 1897
96 Ga0068871_100041952 3300006358 Bacteria 3671
97 Ga0075428_100001007 3300006844 Bacteria 29880
98 Ga0075428_100537991 3300006844 Bacteria 1249
99 Ga0075430_100129971 3300006846 Bacteria 2099
100 Ga0075430_100271759 3300006846 Bacteria 1403
101 Ga0075431_100008154 3300006847 Bacteria 10469
102 Ga0075433_10003327 3300006852 Bacteria 12415
103 Ga0075433_10029716 3300006852 Bacteria 4659
104 Ga0075433_10041113 3300006852 Bacteria 4004
105 Ga0075434_100010219 3300006871 Bacteria 8791
106 Ga0075434_100329070 3300006871 Bacteria 1548
107 Ga0075434_100470731 3300006871 Bacteria 1278
108 Ga0075429_100051282 3300006880 Bacteria 3590
109 Ga0097620_100572868 3300006931 Bacteria 1223
110 Ga0075435_100020755 3300007076 Bacteria 5041
111 Ga0075435_100152218 3300007076 Bacteria 1945
112 Ga0075435_100299902 3300007076 Bacteria 1374
113 Ga0099795_10002970 3300007788 Bacteria 4118
114 Ga0099795_10057988 3300007788 Bacteria 1429
115 Ga0105240_10021393 3300009093 Bacteria 8604
116 Ga0105240_10175471 3300009093 Bacteria 2534
117 Ga0105240_10225296 3300009093 Bacteria 2182
118 Ga0111539_10042930 3300009094 Bacteria 5426
119 Ga0111539_10108847 3300009094 Bacteria 3252
120 Ga0105247_10221815 3300009101 Bacteria 1280
121 Ga0114129_10007519 3300009147 Bacteria 15520
122 Ga0114129_10140672 3300009147 Bacteria 3308
123 Ga0105243_10312843 3300009148 Bacteria 1428
124 Ga0105243_10350949 3300009148 Bacteria 1355
125 Ga0105241_10098847 3300009174 Bacteria 2316
126 Ga0105241_10100047 3300009174 Bacteria 2304
127 Ga0105242_10012890 3300009176 Bacteria 6443
128 Ga0105248_11185413 3300009177 Bacteria 863
129 Ga0105238_10002508 3300009551 Bacteria 18368
130 Ga0105238_10010930 3300009551 Bacteria 9127
131 Ga0105238_10021605 3300009551 Bacteria 6555
132 Ga0105238_10036150 3300009551 Bacteria 5020
133 Ga0105238_10176011 3300009551 Bacteria 2116
134 Ga0099796_10019907 3300010159 Bacteria 2042
135 Ga0105239_10027828 3300010375 Bacteria 6220
136 Ga0105239_10595812 3300010375 Bacteria 1260
137 Ga0157373_10030503 3300013100 Bacteria 3880
138 Ga0157370_10579161 3300013104 Bacteria 1028
139 Ga0157374_10465476 3300013296 Bacteria 1266
140 Ga0157374_10802567 3300013296 Bacteria 957
141 Ga0157378_10047241 3300013297 Bacteria 3826
142 Ga0157378_10094966 3300013297 Bacteria 2715
143 Ga0157378_10175061 3300013297 Bacteria 2015
144 Ga0163162_10210290 3300013306 Bacteria 2075
145 Ga0163162_10737042 3300013306 Bacteria 1105
146 Ga0157375_10005858 3300013308 Bacteria 10698
147 Ga0157375_10641430 3300013308 Bacteria 1219
148 Ga0163163_10384188 3300014325 Bacteria 1462
149 Ga0163163_10443574 3300014325 Bacteria 1358
150 Ga0163163_11037645 3300014325 Bacteria 883
151 Ga0157376_10012014 3300014969 Bacteria 6408
152 Ga0228598_1008620 3300024227 Bacteria 2054
153 Ga0209674_100015 3300025226 Bacteria 697299
154 Ga0209672_108049 3300025228 Bacteria 1585
155 Ga0209563_100017 3300025230 Bacteria 796449
156 Ga0207427_100263 3300025231 Bacteria 40656
157 Ga0209258_100171 3300025242 Bacteria 145035
158 Ga0209258_101199 3300025242 Bacteria 10315
159 Ga0209646_1000089 3300025246 Bacteria 189974
160 Ga0209026_1000028 3300025250 Bacteria 341399
161 Ga0209026_1013469 3300025250 Bacteria 1392
162 Ga0209677_100037 3300025253 Bacteria 286702
163 Ga0209677_100066 3300025253 Bacteria 149370
164 Ga0209148_1003599 3300025254 Bacteria 4169
165 Ga0209759_1000021 3300025256 Bacteria 341399
166 Ga0209759_1000432 3300025256 Bacteria 50212
167 Ga0209759_1001208 3300025256 Bacteria 16003
168 Ga0209759_1003135 3300025256 Bacteria 6757
169 Ga0209759_1011052 3300025256 Bacteria 2596
170 Ga0209455_1000148 3300025272 Bacteria 131958
171 Ga0209051_1016500 3300025303 Bacteria 3337
172 Ga0207699_10344747 3300025906 Bacteria 1050
173 Ga0207705_10009159 3300025909 Bacteria 7213
174 Ga0207705_10202371 3300025909 Bacteria 1505
175 Ga0207684_10109025 3300025910 Bacteria 2370
176 Ga0207684_10232914 3300025910 Bacteria 1589
177 Ga0207654_10014167 3300025911 Bacteria 4115
178 Ga0207707_10158030 3300025912 Bacteria 1982
179 Ga0207707_10274250 3300025912 Bacteria 1461
180 Ga0207695_10011140 3300025913 Bacteria 10911
181 Ga0207693_10002961 3300025915 Bacteria 14698
182 Ga0207693_10004267 3300025915 Bacteria 12118
183 Ga0207693_10306045 3300025915 Bacteria 1244
184 Ga0207663_10014102 3300025916 Bacteria 4366
185 Ga0207663_10018622 3300025916 Bacteria 3895
186 Ga0207663_10112510 3300025916 Bacteria 1849
187 Ga0207663_10144281 3300025916 Bacteria 1662
188 Ga0207660_10005645 3300025917 Bacteria 8119
189 Ga0207660_10153090 3300025917 Bacteria 1773
190 Ga0207657_10002765 3300025919 Bacteria 18890
191 Ga0207657_10004687 3300025919 Bacteria 14437
192 Ga0207657_10070878 3300025919 Bacteria 2953
193 Ga0207657_10118287 3300025919 Bacteria 2181
194 Ga0207657_10233045 3300025919 Bacteria 1472
195 Ga0207649_10098396 3300025920 Bacteria 1931
196 Ga0207652_10020739 3300025921 Bacteria 5415
197 Ga0207652_10456520 3300025921 Bacteria 1152
198 Ga0207694_10020953 3300025924 Bacteria 4949
199 Ga0207694_10030454 3300025924 Bacteria 4121
200 Ga0207694_10134555 3300025924 Bacteria 1984
201 Ga0207694_10348759 3300025924 Bacteria 1225
202 Ga0207700_10033288 3300025928 Bacteria 3687
203 Ga0207700_10173962 3300025928 Bacteria 1798
204 Ga0207700_10223132 3300025928 Bacteria 1599
205 Ga0207664_10155504 3300025929 Bacteria 1946
206 Ga0207664_10159510 3300025929 Bacteria 1923
207 Ga0207664_10685429 3300025929 Bacteria 921
208 Ga0207664_10707769 3300025929 Bacteria 906
209 Ga0207690_10000533 3300025932 Bacteria 24797
210 Ga0207690_10055013 3300025932 Bacteria 2678
211 Ga0207690_10092123 3300025932 Bacteria 2144
212 Ga0207706_10026304 3300025933 Bacteria 5208
213 Ga0207706_10126147 3300025933 Bacteria 2251
214 Ga0207686_10015091 3300025934 Bacteria 4313
215 Ga0207686_10049673 3300025934 Bacteria 2605
216 Ga0207665_10051875 3300025939 Bacteria 2762
217 Ga0207661_10000186 3300025944 Bacteria 40168
218 Ga0207661_10199704 3300025944 Bacteria 1758
219 Ga0207661_10786487 3300025944 Bacteria 876
220 Ga0207679_10574232 3300025945 Bacteria 1014
221 Ga0207667_10016711 3300025949 Bacteria 8278
222 Ga0207667_10118603 3300025949 Bacteria 2727
223 Ga0207667_10145326 3300025949 Bacteria 2441
224 Ga0207667_10223882 3300025949 Bacteria 1927
225 Ga0207667_10650158 3300025949 Bacteria 1060
226 Ga0207651_10000189 3300025960 Bacteria 26894
227 Ga0207640_10009497 3300025981 Bacteria 5448
228 Ga0207640_10046188 3300025981 Bacteria 2801
229 Ga0207703_10893255 3300026035 Bacteria 851
230 Ga0207702_10000972 3300026078 Bacteria 29353
231 Ga0207702_10077047 3300026078 Bacteria 2883
232 Ga0207702_10477014 3300026078 Bacteria 1213
233 Ga0207676_10362398 3300026095 Bacteria 1344
234 Ga0207674_10002598 3300026116 Bacteria 22710
235 Ga0207675_100030071 3300026118 Bacteria 5057
236 Ga0207683_10036402 3300026121 Bacteria 4286
237 Ga0207698_10276094 3300026142 Bacteria 1552
238 Ga0209588_1053934 3300027671 Bacteria 1300
239 Ga0207428_10000305 3300027907 Bacteria 65062
240 Ga0207428_10060233 3300027907 Bacteria 3008
241 Ga0207428_10338878 3300027907 Bacteria 1108
242 Ga0268266_10065879 3300028379 Bacteria 3132
243 Ga0265336_10000028 3300028666 Bacteria 179201
244 Ga0307517_10036708 3300028786 Bacteria 5501
245 Ga0307517_10068911 3300028786 Bacteria 3214
246 Ga0265324_10008854 3300029957 Bacteria 3967
247 Ga0307511_10065072 3300030521 Bacteria 2734
248 Ga0265328_10015842 3300031239 Bacteria 2946
249 Ga0265325_10154033 3300031241 Bacteria 1085
250 Ga0265340_10058893 3300031247 Bacteria 1843
251 Ga0265339_10112934 3300031249 Bacteria 1404
252 Ga0307513_10032030 3300031456 Bacteria 5939
253 Ga0307508_10262912 3300031616 Bacteria 1320
254 Ga0265314_10190462 3300031711 Bacteria 1221
255 Ga0307416_100107465 3300032002 Bacteria 2449
256 Ga0373928_0006077 3300035084 Bacteria 2316
257 Ga0373929_0022450 3300035085 Bacteria 1288
258 Ga0373934_0007000 3300035086 Bacteria 4184
259 Ga0373944_0116893 3300035089 Bacteria 916
260 Ga0373949_0002800 3300035090 Bacteria 4343
261 Ga0373923_0117918 3300035111 Bacteria 1183
262 Ga0373932_0028686 3300035112 Bacteria 1531
263 Ga0373932_0110634 3300035112 Bacteria 905
264 Ga0373945_0010518 3300035116 Bacteria 3048
265 Ga0373957_0075264 3300035120 Bacteria 1326
266 Ga0373960_0043560 3300035121 Bacteria 1307
267 Ga0373943_0188872 3300035170 Bacteria 1136
268 Ga0373961_0006255 3300035241 Bacteria 2862
269 Ga0373931_0006428 3300035691 Bacteria 5490
270 Ga0373931_0008100 3300035691 Bacteria 4977
271 Ga0373931_0132367 3300035691 Bacteria 1437
272 Ga0373931_0137802 3300035691 Bacteria 1410
273 Ga0373927_0142602 3300035695 Bacteria 1568
274 Ga0373927_0206452 3300035695 Bacteria 1290
275 Ga0373947_0235326 3300035725 Bacteria 1207
276 Ga0373925_0141950 3300037068 Bacteria 1880
277 Ga0373925_0253461 3300037068 Bacteria 1412
278 Ga0373925_0297458 3300037068 Bacteria 1303
279 Ga0373925_0389055 3300037068 Bacteria 1136
280 Ga0395899_0077317 3300037312 Bacteria 2427
281 Ga0395899_0170321 3300037312 Bacteria 1534
282 Ga0395900_0012223 3300037418 Bacteria 8778
283 Ga0395900_0086208 3300037418 Bacteria 3227
284 Ga0395898_0012384 3300037466 Bacteria 8817
285 Ga0395898_0015766 3300037466 Bacteria 7745
286 Ga0395898_0515391 3300037466 Bacteria 1137
287 Ga0395905_0002225 3300037471 Bacteria 21882
288 Ga0395905_0020529 3300037471 Bacteria 6257
289 Ga0395905_0126720 3300037471 Bacteria 2401
290 Ga0395905_0298300 3300037471 Bacteria 1499
291 Ga0395905_0441409 3300037471 Bacteria 1199
292 Ga0395901_0001403 3300038443 Bacteria 25166
293 Ga0395901_0017544 3300038443 Bacteria 7307
294 Ga0436365_0333014 3300039437 Bacteria 1541
295 Ga0436360_0410030 3300039438 Bacteria 1670
296 Ga0439436_0069377 3300041404 Bacteria 983
297 Ga0439432_062634 3300042006 Bacteria 1144
298 Ga0439449_0000498 3300042007 Bacteria 14738
299 Ga0466969_0010047 3300044656 Bacteria 5019
300 Ga0466965_0004575 3300044683 Bacteria 6158
301 Ga0466966_0027021 3300044684 Bacteria 3743
302 Ga0466961_0095334 3300044693 Bacteria 1876
303 Ga0466963_0097873 3300044694 Bacteria 2005
304 Ga0466964_0028962 3300044706 Bacteria 2184
305 Ga0466971_0001306 3300044719 Bacteria 10413
306 Ga0466968_0008956 3300044735 Bacteria 3844
307 Ga0466970_0010686 3300044765 Bacteria 4665
308 Ga0466957_0001344 3300044842 Bacteria 12832
309 Ga0466959_0005902 3300045049 Bacteria 8432
310 Ga0451576_0696042 3300045051 Bacteria 1068
311 Ga0466958_0072129 3300045836 Bacteria 2114
312 Ga0466967_0019603 3300045976 Bacteria 5444
313 Ga0466967_0095869 3300045976 Bacteria 2705
314 Ga0466967_0342576 3300045976 Bacteria 1446
315 Ga0466967_0534481 3300045976 Bacteria 1153
316 Ga0495592_0024276 3300046454 Bacteria 4609
317 Ga0495629_0019368 3300046459 Bacteria 4862
318 Ga0495650_0023347 3300046471 Bacteria 2946
319 Ga0495639_0009831 3300046475 Bacteria 4106
320 Ga0495664_0084851 3300046477 Bacteria 1901
321 Ga0495585_0090144 3300046492 Bacteria 1652
322 Ga0495594_0025861 3300046499 Bacteria 3156
323 Ga0495594_0038631 3300046499 Bacteria 2607
324 Ga0495583_0000276 3300046506 Bacteria 82963
325 Ga0495606_0000487 3300046507 Bacteria 64941
326 Ga0495606_0251898 3300046507 Bacteria 979
327 Ga0495618_0172879 3300046514 Bacteria 1374
328 Ga0495628_0019610 3300046516 Bacteria 5587
329 Ga0495628_0230470 3300046516 Bacteria 1388
330 Ga0495630_0279667 3300046517 Bacteria 1275
331 Ga0495637_0141995 3300046520 Bacteria 911
332 Ga0495652_0021416 3300046529 Bacteria 5748
333 Ga0495640_0083834 3300046533 Bacteria 2115
334 Ga0495645_0029916 3300046543 Bacteria 3966
335 Ga0495645_0115198 3300046543 Bacteria 1899
336 Ga0495622_0006396 3300046557 Bacteria 5468
337 Ga0495667_0179233 3300046559 Bacteria 1360
338 Ga0495625_0002958 3300046660 Bacteria 17693
339 Ga0495625_0152243 3300046660 Bacteria 1554
340 Ga0495635_0034985 3300046663 Bacteria 3484
341 Ga0495599_0048896 3300046678 Bacteria 2651
342 Ga0495623_0040725 3300046679 Bacteria 2965
343 Ga0495623_0247537 3300046679 Bacteria 1004
344 Ga0495646_0044445 3300046680 Bacteria 2716
345 Ga0495658_0100503 3300046683 Bacteria 1726
346 Ga0495658_0424332 3300046683 Bacteria 848
347 Ga0495669_0059018 3300046684 Bacteria 1732
348 Ga0495669_0086898 3300046684 Bacteria 1440
349 Ga0495649_0000651 3300046694 Bacteria 28258
350 Ga0495589_0006299 3300046794 Bacteria 6267
351 Ga0495600_0089735 3300046809 Bacteria 2005
352 Ga0495600_0200917 3300046809 Bacteria 1280
353 Ga0495604_0022984 3300047317 Bacteria 4975
354 Ga0495674_0089639 3300047319 Bacteria 2629
355 Ga0495674_0173660 3300047319 Bacteria 1797
356 Ga0495674_0212080 3300047319 Bacteria 1604
357 Ga0495674_0267463 3300047319 Bacteria 1404
358 Ga0495672_0191795 3300047320 Bacteria 1027
359 Ga0495680_0077623 3300047322 Bacteria 2515
360 Ga0495675_0018439 3300047444 Bacteria 4429
361 Ga0495675_0028083 3300047444 Bacteria 3586
362 Ga0495686_0043699 3300047472 Bacteria 2839
363 Ga0495602_0439584 3300048088 Bacteria 922
364 Ga0496100_0019093 3300048903 Bacteria 4082
365 Ga0496100_0474225 3300048903 Bacteria 962
366 Ga0496102_0092620 3300048905 Bacteria 2799
367 Ga0496102_0138646 3300048905 Bacteria 2280
368 Ga0496102_0266630 3300048905 Bacteria 1615
369 Ga0496104_0017024 3300048907 Bacteria 6613
370 Ga0496104_0220827 3300048907 Bacteria 1807
371 Ga0496104_0478422 3300048907 Bacteria 1157
372 Ga0496105_0039751 3300048908 Bacteria 3878
373 Ga0496106_0039334 3300048909 Bacteria 3542
374 Ga0496106_0547592 3300048909 Bacteria 928
375 Ga0496107_0025999 3300048910 Bacteria 4148
376 Ga0496108_0054393 3300048911 Bacteria 3359
377 Ga0496108_0279978 3300048911 Bacteria 1452
378 Ga0496108_0288551 3300048911 Bacteria 1429
379 Ga0496109_0054264 3300048912 Bacteria 3656
380 Ga0496111_0242369 3300048914 Bacteria 1339
381 Ga0496112_0064148 3300048915 Bacteria 3624
382 Ga0496112_0110045 3300048915 Bacteria 2725
383 Ga0496112_0130307 3300048915 Bacteria 2486
384 Ga0496113_0080703 3300048916 Bacteria 2492
385 Ga0496115_0121722 3300048918 Bacteria 2147
386 Ga0496120_0071985 3300048923 Bacteria 1896
387 Ga0496126_0050186 3300048929 Bacteria 3804
388 Ga0496126_0533108 3300048929 Bacteria 934
389 Ga0501033_0292566 3300049570 Bacteria 1148
390 Ga0501036_0079594 3300049572 Bacteria 2771
391 Ga0501036_0254123 3300049572 Bacteria 1472
392 Ga0501038_0043133 3300049574 Bacteria 3924
393 Ga0501040_0100955 3300049576 Bacteria 2012
394 Ga0501040_0104458 3300049576 Bacteria 1978
395 Ga0501041_0068770 3300049577 Bacteria 2171
396 Ga0501041_0148583 3300049577 Bacteria 1462
397 Ga0501042_0046231 3300049578 Bacteria 3103
398 Ga0501042_0103240 3300049578 Bacteria 2051
399 Ga0501046_0107489 3300049580 Bacteria 2134
400 Ga0501046_0189128 3300049580 Bacteria 1536
401 Ga0501048_0124620 3300049582 Bacteria 1821
402 Ga0501067_0205494 3300049583 Bacteria 1097
403 Ga0501068_0105130 3300049584 Bacteria 1752
404 Ga0501070_0129303 3300049586 Bacteria 2087
405 Ga0501071_0377152 3300049587 Bacteria 1081
406 Ga0501072_0056848 3300049588 Bacteria 3082
407 Ga0501075_0020696 3300049591 Bacteria 4787
408 Ga0501075_0036733 3300049591 Bacteria 3657
409 Ga0501076_0242862 3300049592 Bacteria 1473
410 Ga0501076_0276825 3300049592 Bacteria 1374
411 Ga0501079_0128285 3300049741 Bacteria 1973
412 Ga0501081_0231231 3300049743 Bacteria 1346
413 Ga0501035_0256061 3300049822 Bacteria 1485
414 Ga0501045_0030195 3300049824 Bacteria 3921
415 nmdc:mga03683_4110_c2 3300050489 Bacteria 3232
416 nmdc:mga0yw44_271982_c1 3300050492 Bacteria 1131
417 nmdc:mga0yw44_389878_c1 3300050492 Bacteria 941
418 nmdc:mga0k408_22190_c1 3300050493 Bacteria 3573
419 nmdc:mga07m45_5188_c1 3300050496 Bacteria 6460
420 nmdc:mga05p37_252510_c1 3300050507 Bacteria 2114
421 nmdc:mga05p37_4584_c1 3300050507 Bacteria 16160
422 nmdc:mga09592_9623_c1 3300050508 Bacteria 7852
423 nmdc:mga0qj67_262441_c1 3300050509 Bacteria 1401
424 nmdc:mga0qj67_292564_c1 3300050509 Bacteria 1320
425 nmdc:mga0qj67_300708_c1 3300050509 Bacteria 1300
426 nmdc:mga06r32_331827_c1 3300050510 Bacteria 1506
427 nmdc:mga06r32_8434_c1 3300050510 Bacteria 9286
428 nmdc:mga08y16_153974_c1 3300050511 Bacteria 2389
429 nmdc:mga08y16_33_c1 3300050511 Bacteria 172528
430 nmdc:mga0n895_176477_c1 3300050512 Bacteria 2167
431 nmdc:mga0n895_359782_c1 3300050512 Bacteria 1474
432 nmdc:mga0n895_45205_c1 3300050512 Bacteria 4296
433 nmdc:mga0rr50_225844_c1 3300050513 Bacteria 1548
434 nmdc:mga0rr50_22733_c1 3300050513 Bacteria 4309
435 nmdc:mga08x19_35965_c1 3300050514 Bacteria 3135
436 nmdc:mga0a205_123286_c1 3300050515 Bacteria 2491
437 nmdc:mga0a205_126326_c1 3300050515 Bacteria 2457
438 nmdc:mga0sz30_564_c1 3300050516 Bacteria 13864
439 Ga0495601_0034826 3300053077 Bacteria 3141
440 Ga0495601_0169970 3300053077 Bacteria 1425
441 Ga0495612_0011950 3300053078 Bacteria 3499
442 Ga0495612_0116324 3300053078 Bacteria 1148
443 Ga0500635_0000071 3300053080 Bacteria 67355
444 Ga0495595_0016391 3300053084 Bacteria 3169
445 Ga0495619_0014356 3300053085 Bacteria 5002
446 Ga0500652_130264 3300053131 Bacteria 1050
447 Ga0500559_0011584 3300053136 Bacteria 3766
448 Ga0500564_054609 3300053138 Bacteria 1822
449 Ga0500637_0001892 3300053178 Bacteria 9096
450 Ga0501084_0352023 3300054114 Bacteria 1244
451 Ga0500661_001901 3300055283 Bacteria 3940
452 Ga0466962_0026184 3300061719 Bacteria 2800
453 Ga0530510_0059781 3300061734 Bacteria 2757
454 Ga0530510_0331045 3300061734 Bacteria 1142
455 rootH1_10030102
456 JGI25156J39149_1000342
457 JGI25156J39149_1000952
458 JGI25154J39366_1000850
459 JGI25157J39369_1000428
460 Ga0055539_1000284
461 Ga0055539_1000318
462 Ga0055533_1000008
463 Ga0055525_1001196
464 Ga0055535_1000073
465 Ga0055529_1000123
466 Ga0070658_10032998
467 Ga0070658_10039295
468 Ga0070658_10068047
469 Ga0070658_10235638
470 Ga0070658_10626773
471 Ga0070683_100002857
472 Ga0068869_100196010
473 Ga0070680_100008540
474 Ga0070660_100009463
475 Ga0070660_100033439
476 Ga0070660_100090394
477 Ga0070660_100233873
478 Ga0070692_10280043
479 Ga0070671_100573305
480 Ga0070673_100008947
481 Ga0070673_100140838
482 Ga0070659_100000111
483 Ga0070659_100044311
484 Ga0070659_100102658
485 Ga0070709_10019829
486 Ga0070709_10136406
487 Ga0070709_10404391
488 Ga0070714_100266734
489 Ga0070714_100279276
490 Ga0070714_100625785
491 Ga0070713_100013935
492 Ga0070713_100054018
493 Ga0070713_100115159
494 Ga0070711_100026134
495 Ga0070711_100033454
496 Ga0070711_100073675
497 Ga0070705_100005803
498 Ga0070694_100008388
499 Ga0070708_100468139
500 Ga0070678_100601232
501 Ga0070662_100048281
502 Ga0070662_100255696
503 Ga0070681_10022933
504 Ga0070706_100123884
505 Ga0070679_100015809
506 Ga0070679_100137535
507 Ga0070684_100005741
508 Ga0068853_100122567
509 Ga0068853_100818641
510 Ga0070695_100019945
511 Ga0070696_100000430
512 Ga0070696_100038373
513 Ga0070696_100346296
514 Ga0070696_100677268
515 Ga0070693_100009513
516 Ga0070665_100041431
517 Ga0070704_100027656
518 Ga0070704_100286834
519 Ga0068855_100008009
520 Ga0068855_100017714
521 Ga0068855_100094705
522 Ga0068855_100115848
523 Ga0068855_100623993
524 Ga0068857_100000918
525 Ga0068854_100012591
526 Ga0068854_100034762
527 Ga0068856_100001645
528 Ga0068859_100572897
529 Ga0068861_100048083
530 Ga0068858_100461456
531 Ga0068860_100725811
532 Ga0081455_10010856
533 Ga0081455_10320471
534 Ga0081538_10097499
535 Ga0081540_1000066
536 Ga0081540_1000274
537 Ga0081539_10002582
538 Ga0070717_10007411
539 Ga0070717_10191845
540 Ga0070717_10456058
541 Ga0075364_10322016
542 Ga0070712_100001247
543 Ga0075362_10002695
544 Ga0075362_10251896
545 Ga0075369_10000526
546 Ga0075366_10344160
547 Ga0097621_100019447
548 Ga0075370_10013220
549 Ga0075370_10078397
550 Ga0068871_100041952
551 Ga0075428_100001007
552 Ga0075428_100537991
553 Ga0075430_100129971
554 Ga0075430_100271759
555 Ga0075431_100008154
556 Ga0075433_10003327
557 Ga0075433_10029716
558 Ga0075433_10041113
559 Ga0075434_100010219
560 Ga0075434_100329070
561 Ga0075434_100470731
562 Ga0075429_100051282
563 Ga0097620_100572868
564 Ga0075435_100020755
565 Ga0075435_100152218
566 Ga0075435_100299902
567 Ga0099795_10002970
568 Ga0099795_10057988
569 Ga0105240_10021393
570 Ga0105240_10175471
571 Ga0105240_10225296
572 Ga0111539_10042930
573 Ga0111539_10108847
574 Ga0105247_10221815
575 Ga0114129_10007519
576 Ga0114129_10140672
577 Ga0105243_10312843
578 Ga0105243_10350949
579 Ga0105241_10098847
580 Ga0105241_10100047
581 Ga0105242_10012890
582 Ga0105248_11185413
583 Ga0105238_10002508
584 Ga0105238_10010930
585 Ga0105238_10021605
586 Ga0105238_10036150
587 Ga0105238_10176011
588 Ga0099796_10019907
589 Ga0105239_10027828
590 Ga0105239_10595812
591 Ga0157373_10030503
592 Ga0157370_10579161
593 Ga0157374_10465476
594 Ga0157374_10802567
595 Ga0157378_10047241
596 Ga0157378_10094966
597 Ga0157378_10175061
598 Ga0163162_10210290
599 Ga0163162_10737042
600 Ga0157375_10005858
601 Ga0157375_10641430
602 Ga0163163_10384188
603 Ga0163163_10443574
604 Ga0163163_11037645
605 Ga0157376_10012014
606 Ga0228598_1008620
607 Ga0209674_100015
608 Ga0209672_108049
609 Ga0209563_100017
610 Ga0207427_100263
611 Ga0209258_100171
612 Ga0209258_101199
613 Ga0209646_1000089
614 Ga0209026_1000028
615 Ga0209026_1013469
616 Ga0209677_100037
617 Ga0209677_100066
618 Ga0209148_1003599
619 Ga0209759_1000021
620 Ga0209759_1000432
621 Ga0209759_1001208
622 Ga0209759_1003135
623 Ga0209759_1011052
624 Ga0209455_1000148
625 Ga0209051_1016500
626 Ga0207699_10344747
627 Ga0207705_10009159
628 Ga0207705_10202371
629 Ga0207684_10109025
630 Ga0207684_10232914
631 Ga0207654_10014167
632 Ga0207707_10158030
633 Ga0207707_10274250
634 Ga0207695_10011140
635 Ga0207693_10002961
636 Ga0207693_10004267
637 Ga0207693_10306045
638 Ga0207663_10014102
639 Ga0207663_10018622
640 Ga0207663_10112510
641 Ga0207663_10144281
642 Ga0207660_10005645
643 Ga0207660_10153090
644 Ga0207657_10002765
645 Ga0207657_10004687
646 Ga0207657_10070878
647 Ga0207657_10118287
648 Ga0207657_10233045
649 Ga0207649_10098396
650 Ga0207652_10020739
651 Ga0207652_10456520
652 Ga0207694_10020953
653 Ga0207694_10030454
654 Ga0207694_10134555
655 Ga0207694_10348759
656 Ga0207700_10033288
657 Ga0207700_10173962
658 Ga0207700_10223132
659 Ga0207664_10155504
660 Ga0207664_10159510
661 Ga0207664_10685429
662 Ga0207664_10707769
663 Ga0207690_10000533
664 Ga0207690_10055013
665 Ga0207690_10092123
666 Ga0207706_10026304
667 Ga0207706_10126147
668 Ga0207686_10015091
669 Ga0207686_10049673
670 Ga0207665_10051875
671 Ga0207661_10000186
672 Ga0207661_10199704
673 Ga0207661_10786487
674 Ga0207679_10574232
675 Ga0207667_10016711
676 Ga0207667_10118603
677 Ga0207667_10145326
678 Ga0207667_10223882
679 Ga0207667_10650158
680 Ga0207651_10000189
681 Ga0207640_10009497
682 Ga0207640_10046188
683 Ga0207703_10893255
684 Ga0207702_10000972
685 Ga0207702_10077047
686 Ga0207702_10477014
687 Ga0207676_10362398
688 Ga0207674_10002598
689 Ga0207675_100030071
690 Ga0207683_10036402
691 Ga0207698_10276094
692 Ga0209588_1053934
693 Ga0207428_10000305
694 Ga0207428_10060233
695 Ga0207428_10338878
696 Ga0268266_10065879
697 Ga0265336_10000028
698 Ga0307517_10036708
699 Ga0307517_10068911
700 Ga0265324_10008854
701 Ga0307511_10065072
702 Ga0265328_10015842
703 Ga0265325_10154033
704 Ga0265340_10058893
705 Ga0265339_10112934
706 Ga0307513_10032030
707 Ga0307508_10262912
708 Ga0265314_10190462
709 Ga0307416_100107465
710 Ga0373928_0006077
711 Ga0373929_0022450
712 Ga0373934_0007000
713 Ga0373944_0116893
714 Ga0373949_0002800
715 Ga0373923_0117918
716 Ga0373932_0028686
717 Ga0373932_0110634
718 Ga0373945_0010518
719 Ga0373957_0075264
720 Ga0373960_0043560
721 Ga0373943_0188872
722 Ga0373961_0006255
723 Ga0373931_0006428
724 Ga0373931_0008100
725 Ga0373931_0132367
726 Ga0373931_0137802
727 Ga0373927_0142602
728 Ga0373927_0206452
729 Ga0373947_0235326
730 Ga0373925_0141950
731 Ga0373925_0253461
732 Ga0373925_0297458
733 Ga0373925_0389055
734 Ga0395899_0077317
735 Ga0395899_0170321
736 Ga0395900_0012223
737 Ga0395900_0086208
738 Ga0395898_0012384
739 Ga0395898_0015766
740 Ga0395898_0515391
741 Ga0395905_0002225
742 Ga0395905_0020529
743 Ga0395905_0126720
744 Ga0395905_0298300
745 Ga0395905_0441409
746 Ga0395901_0001403
747 Ga0395901_0017544
748 Ga0436365_0333014
749 Ga0436360_0410030
750 Ga0439436_0069377
751 Ga0439432_062634
752 Ga0439449_0000498
753 Ga0466969_0010047
754 Ga0466965_0004575
755 Ga0466966_0027021
756 Ga0466961_0095334
757 Ga0466963_0097873
758 Ga0466964_0028962
759 Ga0466971_0001306
760 Ga0466968_0008956
761 Ga0466970_0010686
762 Ga0466957_0001344
763 Ga0466959_0005902
764 Ga0451576_0696042
765 Ga0466958_0072129
766 Ga0466967_0019603
767 Ga0466967_0095869
768 Ga0466967_0342576
769 Ga0466967_0534481
770 Ga0495592_0024276
771 Ga0495629_0019368
772 Ga0495650_0023347
773 Ga0495639_0009831
774 Ga0495664_0084851
775 Ga0495585_0090144
776 Ga0495594_0025861
777 Ga0495594_0038631
778 Ga0495583_0000276
779 Ga0495606_0000487
780 Ga0495606_0251898
781 Ga0495618_0172879
782 Ga0495628_0019610
783 Ga0495628_0230470
784 Ga0495630_0279667
785 Ga0495637_0141995
786 Ga0495652_0021416
787 Ga0495640_0083834
788 Ga0495645_0029916
789 Ga0495645_0115198
790 Ga0495622_0006396
791 Ga0495667_0179233
792 Ga0495625_0002958
793 Ga0495625_0152243
794 Ga0495635_0034985
795 Ga0495599_0048896
796 Ga0495623_0040725
797 Ga0495623_0247537
798 Ga0495646_0044445
799 Ga0495658_0100503
800 Ga0495658_0424332
801 Ga0495669_0059018
802 Ga0495669_0086898
803 Ga0495649_0000651
804 Ga0495589_0006299
805 Ga0495600_0089735
806 Ga0495600_0200917
807 Ga0495604_0022984
808 Ga0495674_0089639
809 Ga0495674_0173660
810 Ga0495674_0212080
811 Ga0495674_0267463
812 Ga0495672_0191795
813 Ga0495680_0077623
814 Ga0495675_0018439
815 Ga0495675_0028083
816 Ga0495686_0043699
817 Ga0495602_0439584
818 Ga0496100_0019093
819 Ga0496100_0474225
820 Ga0496102_0092620
821 Ga0496102_0138646
822 Ga0496102_0266630
823 Ga0496104_0017024
824 Ga0496104_0220827
825 Ga0496104_0478422
826 Ga0496105_0039751
827 Ga0496106_0039334
828 Ga0496106_0547592
829 Ga0496107_0025999
830 Ga0496108_0054393
831 Ga0496108_0279978
832 Ga0496108_0288551
833 Ga0496109_0054264
834 Ga0496111_0242369
835 Ga0496112_0064148
836 Ga0496112_0110045
837 Ga0496112_0130307
838 Ga0496113_0080703
839 Ga0496115_0121722
840 Ga0496120_0071985
841 Ga0496126_0050186
842 Ga0496126_0533108
843 Ga0501033_0292566
844 Ga0501036_0079594
845 Ga0501036_0254123
846 Ga0501038_0043133
847 Ga0501040_0100955
848 Ga0501040_0104458
849 Ga0501041_0068770
850 Ga0501041_0148583
851 Ga0501042_0046231
852 Ga0501042_0103240
853 Ga0501046_0107489
854 Ga0501046_0189128
855 Ga0501048_0124620
856 Ga0501067_0205494
857 Ga0501068_0105130
858 Ga0501070_0129303
859 Ga0501071_0377152
860 Ga0501072_0056848
861 Ga0501075_0020696
862 Ga0501075_0036733
863 Ga0501076_0242862
864 Ga0501076_0276825
865 Ga0501079_0128285
866 Ga0501081_0231231
867 Ga0501035_0256061
868 Ga0501045_0030195
869 nmdc:mga03683_4110_c2
870 nmdc:mga0yw44_271982_c1
871 nmdc:mga0yw44_389878_c1
872 nmdc:mga0k408_22190_c1
873 nmdc:mga07m45_5188_c1
874 nmdc:mga05p37_252510_c1
875 nmdc:mga05p37_4584_c1
876 nmdc:mga09592_9623_c1
877 nmdc:mga0qj67_262441_c1
878 nmdc:mga0qj67_292564_c1
879 nmdc:mga0qj67_300708_c1
880 nmdc:mga06r32_331827_c1
881 nmdc:mga06r32_8434_c1
882 nmdc:mga08y16_153974_c1
883 nmdc:mga08y16_33_c1
884 nmdc:mga0n895_176477_c1
885 nmdc:mga0n895_359782_c1
886 nmdc:mga0n895_45205_c1
887 nmdc:mga0rr50_225844_c1
888 nmdc:mga0rr50_22733_c1
889 nmdc:mga08x19_35965_c1
890 nmdc:mga0a205_123286_c1
891 nmdc:mga0a205_126326_c1
892 nmdc:mga0sz30_564_c1
893 Ga0495601_0034826
894 Ga0495601_0169970
895 Ga0495612_0011950
896 Ga0495612_0116324
897 Ga0500635_0000071
898 Ga0495595_0016391
899 Ga0495619_0014356
900 Ga0500652_130264
901 Ga0500559_0011584
902 Ga0500564_054609
903 Ga0500637_0001892
904 Ga0501084_0352023
905 Ga0500661_001901
906 Ga0466962_0026184
907 Ga0530510_0059781
908 Ga0530510_0331045

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00834

Ribul_P_3_epim

Ribulose-phosphate 3 epimerase family

6

205

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tqj-assembly1.cif.gz_F crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9779 5 223
1tqj-assembly1.cif.gz_D crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9763 5 223
1tqj-assembly1.cif.gz_E crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9739 5 223
1tqj-assembly1.cif.gz_B crystal structure of d-ribulose 5-phosphate 3-epimerase from synechocystis to 1.6 angstrom resolution 0.9716 5 224
7b1w-assembly2.cif.gz_K-3 crystal structure of plastidial ribulose epimerase rpe1 from the model alga chlamydomonas reinhardtii 0.9702 1 223
ID Description Score Start End Superfamily
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9763 5 223 3.20.20.70
2fliC00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9638 4 220 3.20.20.70
1tqjD00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9631 5 223 3.20.20.70
af_Q58093_1_217_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9587 5 220 3.20.20.70
af_P0AG07_1_223_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9565 5 220 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A7C3ES98-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9745 5 220 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A537RLM3-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9742 1 224 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A3A4WSM3-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9736 5 220 GO:0004750
GO:0006098
GO:0019323
GO:0046872
AF-A0A7S1THL5-F1-model_v4 Ribulose-phosphate 3-epimerase (EC 5.1.3.1) 0.9732 4 219 GO:0004750
GO:0005975
GO:0006098
GO:0046872
AF-A0A4D9A985-F1-model_v4 deleted 0.9725 5 218

Map