F447322

General Info

Members Datasets Scaffolds Average Seq Length
454 278 453 181

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100008528|Ga0070690_1000085286
Length 192
Sequence MRTGLTLASAGASEWLFCATSVCALAPASAFAVDYLSAEQAAKLMFPDAESFDSRQIKLDSSQMQQLDSQGVQARSARWVVRTAQRGKTPLGFVVIDEVIGKFELITYAVGLGLDGAVKQVEILSYRESHGQEIRLPAWRKQFVGKTSASPIHVGDDIANISGATLSCKHVSDGVKRVVTVVDLARKNGALQ

Samples

Sample ID Description Type Environment
1 2818991436 Collimonas arenae 515 Isolate Unclassified
2 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
3 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
92 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
93 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
103 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
105 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
154 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
157 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
158 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
159 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
160 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
161 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
162 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
163 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
164 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
173 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
174 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
186 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
189 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
204 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
205 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
206 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
209 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
212 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
216 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
217 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
218 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
219 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
222 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
223 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
224 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
230 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
242 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
243 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
244 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
245 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
246 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
247 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
248 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
249 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
250 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
251 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
252 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
253 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
254 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
255 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
258 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
259 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
267 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
268 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
269 3300049542 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
277 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
278 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.66
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.96
Nodule 0
Rhizoplane 4.19
Rhizosphere 89.21
Stem 0
Stem Tuber 0
Unclassified 2.64

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000001 3300002737 Bacteria 740113
2 JGI25164J39214_1005291 3300002772 Bacteria 1410
3 JGI25165J46597_1000001 3300003214 Bacteria 1111887
4 rootH1_10097045 3300003316 Bacteria 3367
5 Ga0055538_1000001 3300003751 Bacteria 1111887
6 Ga0055539_1000001 3300003752 Bacteria 1111887
7 Ga0055533_1000003 3300003756 Bacteria 1111887
8 Ga0055525_1000003 3300003759 Bacteria 962094
9 Ga0055541_1000001 3300003841 Bacteria 1111887
10 Ga0070676_10007635 3300005328 Bacteria 5811
11 Ga0070683_100003129 3300005329 Bacteria 13332
12 Ga0070690_100008528 3300005330 Bacteria 5908
13 Ga0070670_100278932 3300005331 Bacteria 1459
14 Ga0068869_100041740 3300005334 Bacteria 3286
15 Ga0068869_100207019 3300005334 Unclassified 1549
16 Ga0068869_100586539 3300005334 Bacteria 940
17 Ga0070666_10068381 3300005335 Bacteria 2414
18 Ga0068868_100029570 3300005338 Bacteria 4196
19 Ga0068868_100129539 3300005338 Bacteria 2064
20 Ga0070689_100001907 3300005340 Bacteria 13473
21 Ga0070691_10057241 3300005341 Unclassified 1870
22 Ga0070661_100015973 3300005344 Bacteria 5299
23 Ga0070692_10065737 3300005345 Archaea 1921
24 Ga0070668_100023874 3300005347 Bacteria 4630
25 Ga0070669_100050381 3300005353 Bacteria 3041
26 Ga0070669_100057560 3300005353 Bacteria 2852
27 Ga0070675_100147633 3300005354 Bacteria 2014
28 Ga0070675_100166032 3300005354 Unclassified 1901
29 Ga0070671_100048217 3300005355 Bacteria 3542
30 Ga0070671_100188921 3300005355 Bacteria 1746
31 Ga0070674_100020245 3300005356 Bacteria 4245
32 Ga0070688_100078897 3300005365 Bacteria 2125
33 Ga0070659_100023425 3300005366 Bacteria 4724
34 Ga0070667_100001103 3300005367 Bacteria 24743
35 Ga0070667_100328665 3300005367 Bacteria 1381
36 Ga0070667_100431612 3300005367 Bacteria 1202
37 Ga0070703_10118101 3300005406 Unclassified 958
38 Ga0070701_10000209 3300005438 Bacteria 18356
39 Ga0070705_100253872 3300005440 Unclassified 1236
40 Ga0070700_100005465 3300005441 Bacteria 6740
41 Ga0070700_100026261 3300005441 Bacteria 3438
42 Ga0070694_100013681 3300005444 Bacteria 5071
43 Ga0070663_100000491 3300005455 Bacteria 20863
44 Ga0070663_100350346 3300005455 Archaea 1195
45 Ga0070678_100032604 3300005456 Bacteria 3607
46 Ga0070678_100091404 3300005456 Bacteria 2336
47 Ga0070678_100822152 3300005456 Bacteria 845
48 Ga0070662_100004646 3300005457 Bacteria 8707
49 Ga0068867_100000086 3300005459 Bacteria 58298
50 Ga0068867_100004032 3300005459 Bacteria 10331
51 Ga0068867_100399761 3300005459 Unclassified 1158
52 Ga0070706_100042991 3300005467 Bacteria 4175
53 Ga0070707_100489777 3300005468 Bacteria 1191
54 Ga0070684_100020799 3300005535 Bacteria 5445
55 Ga0068853_100006300 3300005539 Bacteria 9415
56 Ga0068853_100651868 3300005539 Bacteria 1002
57 Ga0070672_100021578 3300005543 Bacteria 4716
58 Ga0070686_100001022 3300005544 Bacteria 16090
59 Ga0070686_100140018 3300005544 Bacteria 1683
60 Ga0070695_100166206 3300005545 Unclassified 1553
61 Ga0070695_100394760 3300005545 Archaea 1047
62 Ga0070696_100008837 3300005546 Bacteria 6738
63 Ga0070693_100005116 3300005547 Bacteria 6269
64 Ga0070693_100011680 3300005547 Bacteria 4426
65 Ga0070704_100010941 3300005549 Bacteria 5535
66 Ga0068855_100100222 3300005563 Bacteria 3335
67 Ga0068855_100762571 3300005563 Bacteria 1031
68 Ga0070664_100017058 3300005564 Bacteria 5961
69 Ga0070664_100502521 3300005564 Archaea 1117
70 Ga0068854_100118039 3300005578 Bacteria 2009
71 Ga0068856_100027090 3300005614 Bacteria 5591
72 Ga0068856_101419833 3300005614 Bacteria 708
73 Ga0070702_100006277 3300005615 Bacteria 5614
74 Ga0070702_100290292 3300005615 Bacteria 1127
75 Ga0068852_100020764 3300005616 Bacteria 5226
76 Ga0068852_100175801 3300005616 Bacteria 2010
77 Ga0068859_101143909 3300005617 Bacteria 857
78 Ga0068864_100018314 3300005618 Bacteria 5848
79 Ga0068864_100094168 3300005618 Bacteria 2647
80 Ga0068866_10000537 3300005718 Bacteria 17337
81 Ga0068866_10007549 3300005718 Bacteria 4557
82 Ga0068866_10189794 3300005718 Bacteria 1220
83 Ga0068861_100007615 3300005719 Bacteria 7430
84 Ga0068861_100011432 3300005719 Bacteria 6172
85 Ga0068851_10008534 3300005834 Bacteria 4740
86 Ga0068863_100052616 3300005841 Bacteria 3859
87 Ga0068863_100228180 3300005841 Archaea 1795
88 Ga0068863_100525377 3300005841 Bacteria 1167
89 Ga0068863_100646175 3300005841 Bacteria 1049
90 Ga0068863_101538054 3300005841 Bacteria 674
91 Ga0068858_100022836 3300005842 Bacteria 5835
92 Ga0068858_100052992 3300005842 Bacteria 3754
93 Ga0068858_100822076 3300005842 Bacteria 907
94 Ga0068860_100001000 3300005843 Bacteria 31313
95 Ga0068862_100026260 3300005844 Bacteria 4895
96 Ga0068862_100197663 3300005844 Archaea 1812
97 Ga0075366_10003289 3300006195 Bacteria 8497
98 Ga0097621_100003289 3300006237 Bacteria 11115
99 Ga0068871_100083688 3300006358 Bacteria 2647
100 Ga0068865_100000609 3300006881 Bacteria 20055
101 Ga0068865_100018838 3300006881 Bacteria 4461
102 Ga0097620_101143822 3300006931 Bacteria 857
103 Ga0105245_10014330 3300009098 Bacteria 6907
104 Ga0105245_10023437 3300009098 Bacteria 5418
105 Ga0105245_10147756 3300009098 Bacteria 2219
106 Ga0114129_11151006 3300009147 Bacteria 969
107 Ga0105243_10004372 3300009148 Bacteria 11184
108 Ga0105243_10116096 3300009148 Bacteria 2248
109 Ga0105241_10481456 3300009174 Archaea 1103
110 Ga0105242_10005037 3300009176 Bacteria 10207
111 Ga0105248_10001017 3300009177 Bacteria 30997
112 Ga0105248_10031668 3300009177 Bacteria 5908
113 Ga0105248_10058187 3300009177 Bacteria 4340
114 Ga0105238_10025454 3300009551 Bacteria 6032
115 Ga0105238_10074807 3300009551 Bacteria 3380
116 Ga0105249_10014144 3300009553 Bacteria 7055
117 Ga0105249_10368416 3300009553 Bacteria 1460
118 Ga0105239_10021735 3300010375 Bacteria 7073
119 Ga0105246_10351145 3300011119 Unclassified 1208
120 Ga0157369_10054244 3300013105 Bacteria 4329
121 Ga0157374_10030904 3300013296 Bacteria 4864
122 Ga0157374_10117584 3300013296 Unclassified 2562
123 Ga0157374_10626057 3300013296 Bacteria 1087
124 Ga0157378_10003237 3300013297 Bacteria 14493
125 Ga0157378_10059239 3300013297 Bacteria 3416
126 Ga0163162_10003690 3300013306 Bacteria 14687
127 Ga0163162_10611361 3300013306 Unclassified 1216
128 Ga0157372_10027708 3300013307 Bacteria 6174
129 Ga0157372_10045730 3300013307 Bacteria 4858
130 Ga0157375_10157028 3300013308 Bacteria 2414
131 Ga0157375_10715549 3300013308 Archaea 1154
132 Ga0163163_10692790 3300014325 Bacteria 1082
133 Ga0157380_10004801 3300014326 Bacteria 9421
134 Ga0157380_10056711 3300014326 Bacteria 3117
135 Ga0182008_10150159 3300014497 Bacteria 1168
136 Ga0157377_10000039 3300014745 Bacteria 112711
137 Ga0157377_10002676 3300014745 Bacteria 7907
138 Ga0157379_10016795 3300014968 Bacteria 6442
139 Ga0157379_10029618 3300014968 Bacteria 4867
140 Ga0157379_10341207 3300014968 Bacteria 1370
141 Ga0157376_10434328 3300014969 Archaea 1277
142 Ga0157376_11332652 3300014969 Bacteria 748
143 Ga0182006_1085836 3300015261 Bacteria 1140
144 Ga0182007_10001680 3300015262 Bacteria 11717
145 Ga0182005_1000741 3300015265 Bacteria 14944
146 Ga0163161_10101383 3300017792 Bacteria 2143
147 Ga0163161_10180227 3300017792 Bacteria 1619
148 Ga0213872_10000550 3300021361 Bacteria 29141
149 Ga0213872_10001493 3300021361 Bacteria 15098
150 Ga0213872_10001896 3300021361 Bacteria 12853
151 Ga0213872_10003083 3300021361 Bacteria 9390
152 Ga0213872_10063732 3300021361 Bacteria 1665
153 Ga0213872_10087666 3300021361 Bacteria 1394
154 Ga0213876_10036866 3300021384 Bacteria 2580
155 Ga0209784_100004 3300025224 Bacteria 1378156
156 Ga0209566_100004 3300025225 Bacteria 1531866
157 Ga0209674_100006 3300025226 Bacteria 1531866
158 Ga0209563_100009 3300025230 Bacteria 1378156
159 Ga0207427_103876 3300025231 Bacteria 2825
160 Ga0209437_100004 3300025233 Bacteria 1378156
161 Ga0209677_100005 3300025253 Bacteria 1378156
162 Ga0209233_1000005 3300025261 Bacteria 1531866
163 Ga0207656_10058909 3300025321 Bacteria 1679
164 Ga0207642_10023761 3300025899 Bacteria 2454
165 Ga0207688_10166630 3300025901 Archaea 1309
166 Ga0207680_10105845 3300025903 Bacteria 1815
167 Ga0207645_10013129 3300025907 Bacteria 5596
168 Ga0207645_10027466 3300025907 Bacteria 3674
169 Ga0207643_10130630 3300025908 Unclassified 1494
170 Ga0207684_10292110 3300025910 Bacteria 1405
171 Ga0207654_10162030 3300025911 Bacteria 1446
172 Ga0207695_10676355 3300025913 Bacteria 913
173 Ga0207671_10437550 3300025914 Archaea 1041
174 Ga0207657_10020809 3300025919 Bacteria 6190
175 Ga0207649_10035346 3300025920 Bacteria 3002
176 Ga0207649_10199671 3300025920 Archaea 1412
177 Ga0207646_10966582 3300025922 Bacteria 754
178 Ga0207681_10007683 3300025923 Bacteria 6605
179 Ga0207694_10200328 3300025924 Bacteria 1624
180 Ga0207650_10853307 3300025925 Bacteria 773
181 Ga0207659_10014224 3300025926 Bacteria 5122
182 Ga0207687_10046938 3300025927 Bacteria 2992
183 Ga0207687_10099353 3300025927 Bacteria 2138
184 Ga0207644_10110140 3300025931 Bacteria 2081
185 Ga0207644_10179399 3300025931 Bacteria 1659
186 Ga0207644_10207470 3300025931 Bacteria 1548
187 Ga0207690_10023973 3300025932 Bacteria 3816
188 Ga0207706_10007155 3300025933 Bacteria 10320
189 Ga0207709_10000538 3300025935 Bacteria 32529
190 Ga0207669_10144375 3300025937 Unclassified 1657
191 Ga0207704_10001924 3300025938 Bacteria 9293
192 Ga0207704_10488266 3300025938 Unclassified 990
193 Ga0207665_10409993 3300025939 Bacteria 1033
194 Ga0207711_10017998 3300025941 Bacteria 5872
195 Ga0207711_10035227 3300025941 Bacteria 4242
196 Ga0207711_10217677 3300025941 Bacteria 1746
197 Ga0207689_10002393 3300025942 Bacteria 17493
198 Ga0207689_10007331 3300025942 Bacteria 9675
199 Ga0207661_10216564 3300025944 Bacteria 1690
200 Ga0207661_11014245 3300025944 Archaea 764
201 Ga0207679_10390340 3300025945 Bacteria 1222
202 Ga0207679_10450546 3300025945 Archaea 1141
203 Ga0207679_10689824 3300025945 Bacteria 926
204 Ga0207667_10070134 3300025949 Bacteria 3648
205 Ga0207667_10319798 3300025949 Bacteria 1585
206 Ga0207668_10064349 3300025972 Bacteria 2591
207 Ga0207640_10101904 3300025981 Bacteria 2016
208 Ga0207640_10122711 3300025981 Bacteria 1864
209 Ga0207658_10000856 3300025986 Bacteria 25445
210 Ga0207658_10054577 3300025986 Bacteria 2957
211 Ga0207658_10204995 3300025986 Bacteria 1649
212 Ga0207677_10032829 3300026023 Bacteria 3341
213 Ga0207677_10234422 3300026023 Bacteria 1481
214 Ga0207703_10023071 3300026035 Bacteria 4887
215 Ga0207703_10052798 3300026035 Bacteria 3302
216 Ga0207639_10347372 3300026041 Bacteria 1324
217 Ga0207639_10585464 3300026041 Bacteria 1028
218 Ga0207678_10001741 3300026067 Bacteria 19919
219 Ga0207678_10016001 3300026067 Bacteria 6589
220 Ga0207708_10001483 3300026075 Bacteria 17511
221 Ga0207708_10020486 3300026075 Bacteria 4987
222 Ga0207702_10473286 3300026078 Bacteria 1218
223 Ga0207702_11614112 3300026078 Bacteria 642
224 Ga0207641_10050079 3300026088 Bacteria 3533
225 Ga0207641_10511335 3300026088 Bacteria 1167
226 Ga0207641_10990044 3300026088 Bacteria 837
227 Ga0207641_11253117 3300026088 Bacteria 742
228 Ga0207648_10000053 3300026089 Bacteria 107516
229 Ga0207648_10002714 3300026089 Bacteria 18812
230 Ga0207648_10007859 3300026089 Bacteria 10408
231 Ga0207648_10078345 3300026089 Bacteria 2883
232 Ga0207648_10822423 3300026089 Unclassified 865
233 Ga0207676_10017686 3300026095 Bacteria 5171
234 Ga0207676_10048855 3300026095 Bacteria 3287
235 Ga0207674_10019273 3300026116 Bacteria 7394
236 Ga0207674_10039583 3300026116 Bacteria 4886
237 Ga0207675_100004700 3300026118 Bacteria 13141
238 Ga0207675_100008070 3300026118 Bacteria 9917
239 Ga0207683_10437464 3300026121 Bacteria 1205
240 Ga0207683_10784345 3300026121 Bacteria 884
241 Ga0207698_10019062 3300026142 Bacteria 4688
242 Ga0207698_10027797 3300026142 Bacteria 4021
243 Ga0207698_10081304 3300026142 Bacteria 2615
244 Ga0268265_11224282 3300028380 Archaea 749
245 Ga0268264_10000860 3300028381 Bacteria 32169
246 Ga0268264_10121192 3300028381 Bacteria 2305
247 Ga0268264_10416671 3300028381 Bacteria 1294
248 Ga0265319_1047674 3300028563 Bacteria 1425
249 Ga0307517_10070707 3300028786 Bacteria 3139
250 Ga0307515_10331554 3300028794 Bacteria 1180
251 Ga0265327_10000174 3300031251 Bacteria 138922
252 Ga0265316_10000349 3300031344 Bacteria 51876
253 Ga0307513_10129625 3300031456 Bacteria 2470
254 Ga0307509_10097768 3300031507 Bacteria 2983
255 Ga0307509_10372889 3300031507 Unclassified 1143
256 Ga0307408_100974478 3300031548 Bacteria 780
257 Ga0307516_10218819 3300031730 Bacteria 1615
258 Ga0373938_0025243 3300034957 Bacteria 1235
259 Ga0373926_0118676 3300035083 Bacteria 996
260 Ga0373932_0016066 3300035112 Bacteria 1906
261 Ga0373939_0033248 3300035114 Bacteria 1505
262 Ga0373943_0499795 3300035170 Bacteria 710
263 Ga0373955_0478398 3300035172 Unclassified 760
264 Ga0373931_0026051 3300035691 Bacteria 2972
265 Ga0373927_0021365 3300035695 Bacteria 4242
266 Ga0373947_0263675 3300035725 Bacteria 1142
267 Ga0373925_0271845 3300037068 Bacteria 1363
268 Ga0373925_0304957 3300037068 Bacteria 1286
269 Ga0395899_0000249 3300037312 Bacteria 71998
270 Ga0395899_0001858 3300037312 Bacteria 17464
271 Ga0395899_0004998 3300037312 Bacteria 10320
272 Ga0395899_0680344 3300037312 Bacteria 647
273 Ga0395900_0009597 3300037418 Bacteria 9922
274 Ga0395898_0000811 3300037466 Bacteria 52404
275 Ga0395905_0013556 3300037471 Bacteria 7810
276 Ga0395905_0089416 3300037471 Bacteria 2886
277 Ga0395905_0112501 3300037471 Bacteria 2557
278 Ga0395905_0553279 3300037471 Bacteria 1052
279 Ga0395905_0587612 3300037471 Bacteria 1015
280 Ga0395901_0137257 3300038443 Bacteria 2570
281 Ga0436365_1184142 3300039437 Bacteria 4445
282 Ga0436361_0099372 3300039447 Bacteria 18108
283 Ga0436361_0269741 3300039447 Bacteria 10162
284 Ga0436361_0317472 3300039447 Bacteria 1915
285 Ga0436361_0548371 3300039447 Bacteria 6237
286 Ga0436361_0554758 3300039447 Unclassified 857
287 Ga0436361_0568030 3300039447 Bacteria 3831
288 Ga0436361_0607078 3300039447 Bacteria 31051
289 Ga0436361_0801349 3300039447 Bacteria 4025
290 Ga0451577_0038376 3300042876 Bacteria 4309
291 Ga0466969_0093279 3300044656 Bacteria 1424
292 Ga0466972_0000060 3300044658 Bacteria 109789
293 Ga0466972_0049981 3300044658 Bacteria 2019
294 Ga0466972_0203327 3300044658 Unclassified 928
295 Ga0466965_0001324 3300044683 Bacteria 9898
296 Ga0466965_0014236 3300044683 Bacteria 3764
297 Ga0466965_0047480 3300044683 Bacteria 2126
298 Ga0466965_0109896 3300044683 Bacteria 1416
299 Ga0466966_0015316 3300044684 Bacteria 5070
300 Ga0466966_0115853 3300044684 Bacteria 1649
301 Ga0466961_0002147 3300044693 Bacteria 12260
302 Ga0466961_0046017 3300044693 Bacteria 2791
303 Ga0466963_0640116 3300044694 Bacteria 750
304 Ga0466964_0004251 3300044706 Bacteria 5274
305 Ga0466964_0007815 3300044706 Bacteria 4004
306 Ga0453684_0031135 3300044712 Bacteria 7508
307 Ga0466971_0006194 3300044719 Bacteria 5200
308 Ga0466971_0009918 3300044719 Bacteria 4160
309 Ga0466968_0001361 3300044735 Bacteria 8733
310 Ga0466968_0028810 3300044735 Bacteria 2292
311 Ga0466970_0001201 3300044765 Bacteria 12573
312 Ga0466970_0009105 3300044765 Bacteria 5010
313 Ga0466957_0006340 3300044842 Bacteria 6672
314 Ga0466957_0050946 3300044842 Bacteria 2520
315 Ga0466960_0086960 3300044901 Bacteria 1586
316 Ga0466960_0674774 3300044901 Unclassified 618
317 Ga0466959_0000041 3300045049 Bacteria 100097
318 Ga0466959_0018965 3300045049 Bacteria 5055
319 Ga0466959_0133774 3300045049 Bacteria 1756
320 Ga0466959_0198500 3300045049 Bacteria 1397
321 Ga0451576_0090440 3300045051 Bacteria 3184
322 Ga0466958_0858061 3300045836 Bacteria 592
323 Ga0466967_0179197 3300045976 Bacteria 1998
324 Ga0466967_1354673 3300045976 Bacteria 709
325 Ga0495603_0019251 3300046455 Bacteria 4133
326 Ga0495603_0223287 3300046455 Unclassified 1087
327 Ga0495629_0009630 3300046459 Bacteria 7057
328 Ga0495629_0318953 3300046459 Bacteria 1062
329 Ga0495651_0004269 3300046462 Bacteria 10961
330 Ga0495653_0208950 3300046463 Bacteria 1319
331 Ga0495580_0261496 3300046472 Bacteria 1183
332 Ga0495582_0143034 3300046473 Bacteria 1356
333 Ga0495605_0030061 3300046474 Unclassified 2788
334 Ga0495664_0296120 3300046477 Bacteria 977
335 Ga0495584_0098212 3300046491 Unclassified 1479
336 Ga0495585_0000447 3300046492 Bacteria 39452
337 Ga0495585_0052085 3300046492 Bacteria 2266
338 Ga0495594_0014849 3300046499 Bacteria 4086
339 Ga0495594_0035712 3300046499 Bacteria 2708
340 Ga0495594_0280986 3300046499 Bacteria 949
341 Ga0495596_0000835 3300046500 Bacteria 18636
342 Ga0495583_0000563 3300046506 Bacteria 51367
343 Ga0495583_0316105 3300046506 Bacteria 619
344 Ga0495608_0115249 3300046511 Bacteria 1725
345 Ga0495616_0262882 3300046513 Bacteria 738
346 Ga0495618_0092832 3300046514 Bacteria 1930
347 Ga0495628_0000137 3300046516 Bacteria 62400
348 Ga0495628_0061017 3300046516 Bacteria 2958
349 Ga0495628_0144250 3300046516 Bacteria 1816
350 Ga0495628_0257216 3300046516 Unclassified 1302
351 Ga0495630_0276627 3300046517 Bacteria 1282
352 Ga0495631_0003859 3300046518 Bacteria 8120
353 Ga0495643_0011354 3300046522 Bacteria 5429
354 Ga0495643_0033138 3300046522 Bacteria 2861
355 Ga0495644_0016615 3300046523 Bacteria 2816
356 Ga0495666_0050556 3300046526 Bacteria 1998
357 Ga0495666_0095681 3300046526 Bacteria 1400
358 Ga0495642_0001701 3300046528 Bacteria 9488
359 Ga0495642_0048997 3300046528 Bacteria 1734
360 Ga0495642_0116948 3300046528 Bacteria 1143
361 Ga0495642_0129907 3300046528 Bacteria 1084
362 Ga0495652_0002204 3300046529 Bacteria 20452
363 Ga0495652_0035412 3300046529 Bacteria 4345
364 Ga0495652_0061332 3300046529 Bacteria 3175
365 Ga0495665_0001201 3300046531 Bacteria 13802
366 Ga0495665_0108189 3300046531 Bacteria 1458
367 Ga0495586_0004416 3300046535 Bacteria 7509
368 Ga0495586_0202615 3300046535 Bacteria 1125
369 Ga0495609_0014353 3300046538 Bacteria 3726
370 Ga0495597_0000752 3300046542 Bacteria 25607
371 Ga0495597_0020524 3300046542 Bacteria 3076
372 Ga0495645_0368070 3300046543 Unclassified 922
373 Ga0495622_0001036 3300046557 Bacteria 14791
374 Ga0495622_0007623 3300046557 Bacteria 5026
375 Ga0495622_0037392 3300046557 Bacteria 2261
376 Ga0495656_0000082 3300046615 Bacteria 42150
377 Ga0495668_0169487 3300046616 Bacteria 1196
378 Ga0495611_0049375 3300046648 Unclassified 1893
379 Ga0495625_0012162 3300046660 Bacteria 6983
380 Ga0495625_0475465 3300046660 Bacteria 768
381 Ga0495635_0214626 3300046663 Bacteria 1303
382 Ga0495661_0000979 3300046665 Bacteria 25811
383 Ga0495661_0206789 3300046665 Bacteria 1024
384 Ga0495588_0101823 3300046674 Bacteria 1509
385 Ga0495588_0419875 3300046674 Bacteria 702
386 Ga0495657_0491298 3300046675 Bacteria 716
387 Ga0495623_0102959 3300046679 Bacteria 1737
388 Ga0495646_0004343 3300046680 Bacteria 8932
389 Ga0495646_0121582 3300046680 Bacteria 1477
390 Ga0495646_0174148 3300046680 Bacteria 1184
391 Ga0495647_0068810 3300046681 Bacteria 1413
392 Ga0495658_0129769 3300046683 Bacteria 1533
393 Ga0495613_0043217 3300046689 Bacteria 3333
394 Ga0495613_0257777 3300046689 Bacteria 1216
395 Ga0495624_0012037 3300046690 Bacteria 5928
396 Ga0495624_0064467 3300046690 Bacteria 2290
397 Ga0495670_0074567 3300046691 Bacteria 1721
398 Ga0495600_0008662 3300046809 Bacteria 6259
399 Ga0495581_0085854 3300047315 Bacteria 1824
400 Ga0495604_0035774 3300047317 Bacteria 3919
401 Ga0495636_0023203 3300047318 Bacteria 2510
402 Ga0495674_0139135 3300047319 Bacteria 2041
403 Ga0495674_0374951 3300047319 Bacteria 1152
404 Ga0495674_0516302 3300047319 Bacteria 954
405 Ga0495676_0057736 3300047321 Bacteria 3058
406 Ga0495676_0060682 3300047321 Bacteria 2962
407 Ga0495676_0094996 3300047321 Bacteria 2220
408 Ga0495676_0149591 3300047321 Bacteria 1663
409 Ga0495683_0193346 3300047323 Unclassified 922
410 Ga0495687_015797 3300047443 Bacteria 3823
411 Ga0495687_069360 3300047443 Bacteria 1419
412 Ga0495677_0075010 3300047445 Unclassified 1263
413 Ga0495673_0063614 3300047469 Unclassified 1572
414 Ga0495681_0130970 3300047470 Unclassified 1067
415 Ga0495602_0020316 3300048088 Bacteria 6565
416 Ga0495602_0159406 3300048088 Bacteria 1763
417 Ga0495614_0035602 3300048089 Bacteria 2139
418 Ga0495614_0081651 3300048089 Bacteria 1401
419 Ga0495626_0090992 3300048091 Bacteria 1341
420 Ga0495626_0273271 3300048091 Bacteria 673
421 Ga0496100_0203971 3300048903 Bacteria 1443
422 Ga0496106_0022865 3300048909 Bacteria 4643
423 Ga0496107_0032704 3300048910 Bacteria 3718
424 Ga0496108_0055699 3300048911 Bacteria 3321
425 Ga0496108_0188329 3300048911 Bacteria 1788
426 Ga0496109_0008620 3300048912 Bacteria 8681
427 Ga0496109_0061399 3300048912 Bacteria 3436
428 Ga0496110_0053450 3300048913 Bacteria 3551
429 Ga0496110_0320364 3300048913 Unclassified 1412
430 Ga0496110_0396953 3300048913 Bacteria 1257
431 Ga0496112_0026238 3300048915 Bacteria 5603
432 Ga0496112_0201533 3300048915 Bacteria 1949
433 Ga0496113_0440409 3300048916 Archaea 1047
434 Ga0496114_0038279 3300048917 Bacteria 3968
435 Ga0496115_0003150 3300048918 Bacteria 11862
436 Ga0496115_0016510 3300048918 Bacteria 5624
437 Ga0496115_0151021 3300048918 Bacteria 1918
438 Ga0496115_0173315 3300048918 Bacteria 1784
439 Ga0496115_0234398 3300048918 Bacteria 1513
440 Ga0496124_0673530 3300048927 Bacteria 660
441 Ga0496125_0021028 3300048928 Bacteria 6100
442 Ga0495682_0006249 3300049460 Bacteria 4841
443 Ga0501326_00161 3300049542 Unclassified 2319
444 Ga0501335_025300 3300049551 Bacteria 650
445 Ga0501336_001472 3300049552 Unclassified 1407
446 Ga0501034_0568912 3300049571 Bacteria 1041
447 Ga0501035_0919654 3300049822 Bacteria 692
448 nmdc:mga0k408_5045_c1 3300050493 Bacteria 6991
449 nmdc:mga0n895_1440822_c1 3300050512 Bacteria 656
450 Ga0495601_0240874 3300053077 Bacteria 1181
451 Ga0495619_0080498 3300053085 Bacteria 2192
452 Ga0466962_0005105 3300061719 Bacteria 6314
453 Ga0466962_0087866 3300061719 Bacteria 1489

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037471 Ga0395905_0587612 Ga0395905_0587612_158_643 161
2 3300005441 Ga0070700_100005465 Ga0070700_1000054654 163
3 3300049542 Ga0501326_00161 Ga0501326_00161_769_1305 163
4 3300049551 Ga0501335_025300 Ga0501335_025300_46_582 163
5 3300049552 Ga0501336_001472 Ga0501336_001472_485_1021 163
6 3300009098 Ga0105245_10014330 Ga0105245_100143307 164
7 3300009098 Ga0105245_10023437 Ga0105245_100234372 164
8 3300009148 Ga0105243_10004372 Ga0105243_100043725 164
9 3300009176 Ga0105242_10005037 Ga0105242_100050376 164
10 3300009177 Ga0105248_10058187 Ga0105248_100581874 164
11 3300011119 Ga0105246_10351145 Ga0105246_103511452 164
12 3300013297 Ga0157378_10003237 Ga0157378_1000323712 164
13 3300013306 Ga0163162_10611361 Ga0163162_106113612 164
14 3300014326 Ga0157380_10004801 Ga0157380_100048015 164
15 3300025927 Ga0207687_10099353 Ga0207687_100993532 164
16 3300003316 rootH1_10097045 rootH1_100970452 166
17 3300005331 Ga0070670_100278932 Ga0070670_1002789322 166
18 3300005334 Ga0068869_100586539 Ga0068869_1005865392 166
19 3300005367 Ga0070667_100328665 Ga0070667_1003286652 166
20 3300005456 Ga0070678_100822152 Ga0070678_1008221522 166
21 3300005618 Ga0068864_100094168 Ga0068864_1000941681 166
22 3300005841 Ga0068863_100052616 Ga0068863_1000526162 166
23 3300014325 Ga0163163_10692790 Ga0163163_106927902 166
24 3300014968 Ga0157379_10029618 Ga0157379_100296184 166
25 3300014969 Ga0157376_11332652 Ga0157376_113326522 166
26 3300025925 Ga0207650_10853307 Ga0207650_108533072 166
27 3300026023 Ga0207677_10234422 Ga0207677_102344222 166
28 3300026088 Ga0207641_10050079 Ga0207641_100500794 166
29 3300026095 Ga0207676_10048855 Ga0207676_100488551 166
30 3300026121 Ga0207683_10784345 Ga0207683_107843452 166
31 3300028381 Ga0268264_10416671 Ga0268264_104166712 166
32 3300035725 Ga0373947_0263675 Ga0373947_0263675_35_586 166
33 3300046675 Ga0495657_0491298 Ga0495657_0491298_147_698 166
34 3300047319 Ga0495674_0374951 Ga0495674_0374951_35_586 166
35 3300053085 Ga0495619_0080498 Ga0495619_0080498_758_1309 166
36 3300046492 Ga0495585_0000447 Ga0495585_0000447_30959_31513 167
37 3300046506 Ga0495583_0000563 Ga0495583_0000563_37168_37722 167
38 3300046615 Ga0495656_0000082 Ga0495656_0000082_32907_33461 167
39 3300049460 Ga0495682_0006249 Ga0495682_0006249_2815_3369 167
40 3300035170 Ga0373943_0499795 Ga0373943_0499795_105_656 168
41 3300044901 Ga0466960_0674774 Ga0466960_0674774_98_604 168
42 3300046516 Ga0495628_0144250 Ga0495628_0144250_499_1038 168
43 3300046529 Ga0495652_0035412 Ga0495652_0035412_647_1186 168
44 3300046680 Ga0495646_0004343 Ga0495646_0004343_4382_4921 168
45 3300046690 Ga0495624_0064467 Ga0495624_0064467_1327_1866 168
46 3300031251 Ga0265327_10000174 Ga0265327_10000174108 172
47 3300046660 Ga0495625_0012162 Ga0495625_0012162_4848_5369 172
48 3300010375 Ga0105239_10021735 Ga0105239_100217357 173
49 3300013296 Ga0157374_10030904 Ga0157374_100309044 173
50 3300013308 Ga0157375_10715549 Ga0157375_107155492 173
51 3300014745 Ga0157377_10002676 Ga0157377_100026767 173
52 3300014968 Ga0157379_10016795 Ga0157379_100167954 173
53 3300014969 Ga0157376_10434328 Ga0157376_104343282 173
54 3300025911 Ga0207654_10162030 Ga0207654_101620302 173
55 3300025933 Ga0207706_10007155 Ga0207706_100071558 173
56 3300025942 Ga0207689_10007331 Ga0207689_100073319 173
57 3300026035 Ga0207703_10052798 Ga0207703_100527983 173
58 3300026089 Ga0207648_10822423 Ga0207648_108224232 173
59 3300035691 Ga0373931_0026051 Ga0373931_0026051_63_602 173
60 3300042876 Ga0451577_0038376 Ga0451577_0038376_822_1376 173
61 3300044658 Ga0466972_0049981 Ga0466972_0049981_977_1525 173
62 3300044712 Ga0453684_0031135 Ga0453684_0031135_2940_3494 173
63 3300045051 Ga0451576_0090440 Ga0451576_0090440_1568_2107 173
64 3300048910 Ga0496107_0032704 Ga0496107_0032704_2507_3046 173
65 3300048913 Ga0496110_0396953 Ga0496110_0396953_342_887 173
66 3300048917 Ga0496114_0038279 Ga0496114_0038279_860_1399 173
67 3300006195 Ga0075366_10003289 Ga0075366_100032898 174
68 3300050493 nmdc:mga0k408_5045_c1 nmdc:mga0k408_5045_c1_2789_3328 174
69 iso_pu_bacteria 2818991436 2819542507 174
70 3300005367 Ga0070667_100001103 Ga0070667_10000110319 175
71 3300005467 Ga0070706_100042991 Ga0070706_1000429915 175
72 3300005468 Ga0070707_100489777 Ga0070707_1004897772 175
73 3300009147 Ga0114129_11151006 Ga0114129_111510062 175
74 3300025910 Ga0207684_10292110 Ga0207684_102921102 175
75 3300025986 Ga0207658_10000856 Ga0207658_100008562 175
76 3300031507 Ga0307509_10372889 Ga0307509_103728892 175
77 3300037068 Ga0373925_0304957 Ga0373925_0304957_288_833 175
78 3300046516 Ga0495628_0257216 Ga0495628_0257216_372_917 175
79 3300046543 Ga0495645_0368070 Ga0495645_0368070_231_776 175
80 3300047321 Ga0495676_0060682 Ga0495676_0060682_763_1293 175
81 3300048089 Ga0495614_0081651 Ga0495614_0081651_174_719 175
82 3300005328 Ga0070676_10007635 Ga0070676_100076352 176
83 3300005329 Ga0070683_100003129 Ga0070683_10000312913 176
84 3300005334 Ga0068869_100041740 Ga0068869_1000417403 176
85 3300005335 Ga0070666_10068381 Ga0070666_100683812 176
86 3300005338 Ga0068868_100029570 Ga0068868_1000295706 176
87 3300005344 Ga0070661_100015973 Ga0070661_1000159737 176
88 3300005345 Ga0070692_10065737 Ga0070692_100657373 176
89 3300005353 Ga0070669_100050381 Ga0070669_1000503815 176
90 3300005354 Ga0070675_100147633 Ga0070675_1001476332 176
91 3300005354 Ga0070675_100166032 Ga0070675_1001660322 176
92 3300005355 Ga0070671_100188921 Ga0070671_1001889212 176
93 3300005356 Ga0070674_100020245 Ga0070674_1000202452 176
94 3300005366 Ga0070659_100023425 Ga0070659_1000234254 176
95 3300005455 Ga0070663_100000491 Ga0070663_10000049116 176
96 3300005455 Ga0070663_100350346 Ga0070663_1003503462 176
97 3300005457 Ga0070662_100004646 Ga0070662_1000046464 176
98 3300005459 Ga0068867_100000086 Ga0068867_10000008638 176
99 3300005535 Ga0070684_100020799 Ga0070684_1000207992 176
100 3300005539 Ga0068853_100006300 Ga0068853_1000063009 176
101 3300005545 Ga0070695_100394760 Ga0070695_1003947602 176
102 3300005547 Ga0070693_100011680 Ga0070693_1000116803 176
103 3300005563 Ga0068855_100100222 Ga0068855_1001002223 176
104 3300005563 Ga0068855_100762571 Ga0068855_1007625712 176
105 3300005564 Ga0070664_100017058 Ga0070664_1000170585 176
106 3300005564 Ga0070664_100502521 Ga0070664_1005025212 176
107 3300005578 Ga0068854_100118039 Ga0068854_1001180392 176
108 3300005614 Ga0068856_100027090 Ga0068856_1000270903 176
109 3300005614 Ga0068856_101419833 Ga0068856_1014198332 176
110 3300005616 Ga0068852_100020764 Ga0068852_1000207642 176
111 3300005616 Ga0068852_100175801 Ga0068852_1001758012 176
112 3300005618 Ga0068864_100018314 Ga0068864_1000183142 176
113 3300005719 Ga0068861_100007615 Ga0068861_1000076159 176
114 3300005834 Ga0068851_10008534 Ga0068851_100085342 176
115 3300005841 Ga0068863_100228180 Ga0068863_1002281803 176
116 3300005842 Ga0068858_100052992 Ga0068858_1000529922 176
117 3300005844 Ga0068862_100197663 Ga0068862_1001976632 176
118 3300006358 Ga0068871_100083688 Ga0068871_1000836883 176
119 3300009098 Ga0105245_10147756 Ga0105245_101477562 176
120 3300009174 Ga0105241_10481456 Ga0105241_104814562 176
121 3300009177 Ga0105248_10031668 Ga0105248_100316682 176
122 3300009551 Ga0105238_10025454 Ga0105238_100254542 176
123 3300009551 Ga0105238_10074807 Ga0105238_100748072 176
124 3300013105 Ga0157369_10054244 Ga0157369_100542443 176
125 3300013296 Ga0157374_10117584 Ga0157374_101175843 176
126 3300013296 Ga0157374_10626057 Ga0157374_106260572 176
127 3300013307 Ga0157372_10027708 Ga0157372_100277085 176
128 3300013307 Ga0157372_10045730 Ga0157372_100457302 176
129 3300014745 Ga0157377_10000039 Ga0157377_100000393 176
130 3300017792 Ga0163161_10101383 Ga0163161_101013832 176
131 3300021384 Ga0213876_10036866 Ga0213876_100368664 176
132 3300025321 Ga0207656_10058909 Ga0207656_100589092 176
133 3300025901 Ga0207688_10166630 Ga0207688_101666302 176
134 3300025903 Ga0207680_10105845 Ga0207680_101058452 176
135 3300025907 Ga0207645_10013129 Ga0207645_100131295 176
136 3300025913 Ga0207695_10676355 Ga0207695_106763551 176
137 3300025914 Ga0207671_10437550 Ga0207671_104375502 176
138 3300025919 Ga0207657_10020809 Ga0207657_100208093 176
139 3300025920 Ga0207649_10035346 Ga0207649_100353463 176
140 3300025920 Ga0207649_10199671 Ga0207649_101996712 176
141 3300025923 Ga0207681_10007683 Ga0207681_100076835 176
142 3300025924 Ga0207694_10200328 Ga0207694_102003282 176
143 3300025926 Ga0207659_10014224 Ga0207659_100142243 176
144 3300025927 Ga0207687_10046938 Ga0207687_100469382 176
145 3300025931 Ga0207644_10179399 Ga0207644_101793993 176
146 3300025931 Ga0207644_10207470 Ga0207644_102074702 176
147 3300025932 Ga0207690_10023973 Ga0207690_100239732 176
148 3300025935 Ga0207709_10000538 Ga0207709_100005388 176
149 3300025937 Ga0207669_10144375 Ga0207669_101443752 176
150 3300025939 Ga0207665_10409993 Ga0207665_104099932 176
151 3300025941 Ga0207711_10017998 Ga0207711_100179984 176
152 3300025941 Ga0207711_10217677 Ga0207711_102176771 176
153 3300025944 Ga0207661_10216564 Ga0207661_102165642 176
154 3300025944 Ga0207661_11014245 Ga0207661_110142451 176
155 3300025945 Ga0207679_10390340 Ga0207679_103903401 176
156 3300025945 Ga0207679_10450546 Ga0207679_104505461 176
157 3300025945 Ga0207679_10689824 Ga0207679_106898242 176
158 3300025949 Ga0207667_10070134 Ga0207667_100701342 176
159 3300025949 Ga0207667_10319798 Ga0207667_103197982 176
160 3300025981 Ga0207640_10101904 Ga0207640_101019043 176
161 3300025981 Ga0207640_10122711 Ga0207640_101227112 176
162 3300025986 Ga0207658_10204995 Ga0207658_102049952 176
163 3300026023 Ga0207677_10032829 Ga0207677_100328292 176
164 3300026041 Ga0207639_10347372 Ga0207639_103473722 176
165 3300026067 Ga0207678_10001741 Ga0207678_100017414 176
166 3300026067 Ga0207678_10016001 Ga0207678_100160019 176
167 3300026078 Ga0207702_10473286 Ga0207702_104732861 176
168 3300026078 Ga0207702_11614112 Ga0207702_116141121 176
169 3300026088 Ga0207641_11253117 Ga0207641_112531171 176
170 3300026089 Ga0207648_10000053 Ga0207648_1000005369 176
171 3300026116 Ga0207674_10019273 Ga0207674_100192736 176
172 3300026116 Ga0207674_10039583 Ga0207674_100395832 176
173 3300026118 Ga0207675_100008070 Ga0207675_1000080709 176
174 3300026142 Ga0207698_10027797 Ga0207698_100277972 176
175 3300026142 Ga0207698_10081304 Ga0207698_100813042 176
176 3300028380 Ga0268265_11224282 Ga0268265_112242822 176
177 3300028381 Ga0268264_10121192 Ga0268264_101211922 176
178 3300028786 Ga0307517_10070707 Ga0307517_100707075 176
179 3300028794 Ga0307515_10331554 Ga0307515_103315542 176
180 3300031456 Ga0307513_10129625 Ga0307513_101296252 176
181 3300031548 Ga0307408_100974478 Ga0307408_1009744782 176
182 3300031730 Ga0307516_10218819 Ga0307516_102188192 176
183 3300034957 Ga0373938_0025243 Ga0373938_0025243_272_814 176
184 3300035112 Ga0373932_0016066 Ga0373932_0016066_323_871 176
185 3300035114 Ga0373939_0033248 Ga0373939_0033248_44_592 176
186 3300035172 Ga0373955_0478398 Ga0373955_0478398_140_691 176
187 3300037466 Ga0395898_0000811 Ga0395898_0000811_249_800 176
188 3300037471 Ga0395905_0013556 Ga0395905_0013556_3052_3594 176
189 3300037471 Ga0395905_0112501 Ga0395905_0112501_752_1297 176
190 3300039437 Ga0436365_1184142 Ga0436365_1184142_465_1016 176
191 3300039447 Ga0436361_0317472 Ga0436361_0317472_1185_1736 176
192 3300044656 Ga0466969_0093279 Ga0466969_0093279_376_921 176
193 3300044683 Ga0466965_0109896 Ga0466965_0109896_750_1295 176
194 3300044684 Ga0466966_0115853 Ga0466966_0115853_801_1346 176
195 3300044693 Ga0466961_0002147 Ga0466961_0002147_9985_10533 176
196 3300044693 Ga0466961_0046017 Ga0466961_0046017_775_1320 176
197 3300044694 Ga0466963_0640116 Ga0466963_0640116_63_611 176
198 3300044706 Ga0466964_0007815 Ga0466964_0007815_2181_2729 176
199 3300044719 Ga0466971_0006194 Ga0466971_0006194_708_1253 176
200 3300044719 Ga0466971_0009918 Ga0466971_0009918_2627_3175 176
201 3300044765 Ga0466970_0009105 Ga0466970_0009105_1837_2385 176
202 3300044842 Ga0466957_0050946 Ga0466957_0050946_595_1140 176
203 3300045049 Ga0466959_0000041 Ga0466959_0000041_3812_4360 176
204 3300045049 Ga0466959_0198500 Ga0466959_0198500_515_1060 176
205 3300045836 Ga0466958_0858061 Ga0466958_0858061_18_563 176
206 3300045976 Ga0466967_0179197 Ga0466967_0179197_1273_1818 176
207 3300046516 Ga0495628_0061017 Ga0495628_0061017_1196_1747 176
208 3300046680 Ga0495646_0121582 Ga0495646_0121582_818_1369 176
209 3300046681 Ga0495647_0068810 Ga0495647_0068810_813_1361 176
210 3300048909 Ga0496106_0022865 Ga0496106_0022865_270_818 176
211 3300048911 Ga0496108_0055699 Ga0496108_0055699_327_875 176
212 3300048913 Ga0496110_0053450 Ga0496110_0053450_2734_3282 176
213 3300048915 Ga0496112_0201533 Ga0496112_0201533_439_987 176
214 3300048916 Ga0496113_0440409 Ga0496113_0440409_383_931 176
215 3300048918 Ga0496115_0016510 Ga0496115_0016510_240_788 176
216 3300048928 Ga0496125_0021028 Ga0496125_0021028_2291_2836 176
217 3300050512 nmdc:mga0n895_1440822_c1 nmdc:mga0n895_1440822_c1_50_592 176
218 3300061719 Ga0466962_0005105 Ga0466962_0005105_4167_4715 176
219 3300005330 Ga0070690_100008528 Ga0070690_1000085286 177
220 3300005334 Ga0068869_100207019 Ga0068869_1002070192 177
221 3300005338 Ga0068868_100129539 Ga0068868_1001295392 177
222 3300005340 Ga0070689_100001907 Ga0070689_1000019072 177
223 3300005341 Ga0070691_10057241 Ga0070691_100572412 177
224 3300005347 Ga0070668_100023874 Ga0070668_1000238745 177
225 3300005353 Ga0070669_100057560 Ga0070669_1000575603 177
226 3300005355 Ga0070671_100048217 Ga0070671_1000482174 177
227 3300005365 Ga0070688_100078897 Ga0070688_1000788974 177
228 3300005367 Ga0070667_100431612 Ga0070667_1004316122 177
229 3300005406 Ga0070703_10118101 Ga0070703_101181012 177
230 3300005438 Ga0070701_10000209 Ga0070701_100002096 177
231 3300005440 Ga0070705_100253872 Ga0070705_1002538722 177
232 3300005441 Ga0070700_100026261 Ga0070700_1000262615 177
233 3300005444 Ga0070694_100013681 Ga0070694_1000136811 177
234 3300005456 Ga0070678_100032604 Ga0070678_1000326042 177
235 3300005456 Ga0070678_100091404 Ga0070678_1000914041 177
236 3300005459 Ga0068867_100004032 Ga0068867_1000040323 177
237 3300005459 Ga0068867_100399761 Ga0068867_1003997612 177
238 3300005539 Ga0068853_100651868 Ga0068853_1006518682 177
239 3300005543 Ga0070672_100021578 Ga0070672_1000215785 177
240 3300005544 Ga0070686_100001022 Ga0070686_1000010225 177
241 3300005544 Ga0070686_100140018 Ga0070686_1001400182 177
242 3300005545 Ga0070695_100166206 Ga0070695_1001662062 177
243 3300005546 Ga0070696_100008837 Ga0070696_1000088374 177
244 3300005547 Ga0070693_100005116 Ga0070693_1000051164 177
245 3300005549 Ga0070704_100010941 Ga0070704_1000109415 177
246 3300005615 Ga0070702_100006277 Ga0070702_1000062775 177
247 3300005615 Ga0070702_100290292 Ga0070702_1002902922 177
248 3300005617 Ga0068859_101143909 Ga0068859_1011439092 177
249 3300005718 Ga0068866_10000537 Ga0068866_1000053712 177
250 3300005718 Ga0068866_10007549 Ga0068866_100075492 177
251 3300005718 Ga0068866_10189794 Ga0068866_101897942 177
252 3300005719 Ga0068861_100011432 Ga0068861_1000114324 177
253 3300005841 Ga0068863_100525377 Ga0068863_1005253772 177
254 3300005841 Ga0068863_100646175 Ga0068863_1006461752 177
255 3300005841 Ga0068863_101538054 Ga0068863_1015380542 177
256 3300005842 Ga0068858_100022836 Ga0068858_1000228363 177
257 3300005842 Ga0068858_100822076 Ga0068858_1008220761 177
258 3300005843 Ga0068860_100001000 Ga0068860_10000100012 177
259 3300005844 Ga0068862_100026260 Ga0068862_1000262603 177
260 3300006237 Ga0097621_100003289 Ga0097621_1000032895 177
261 3300006881 Ga0068865_100000609 Ga0068865_1000006098 177
262 3300006881 Ga0068865_100018838 Ga0068865_1000188386 177
263 3300006931 Ga0097620_101143822 Ga0097620_1011438222 177
264 3300009148 Ga0105243_10116096 Ga0105243_101160962 177
265 3300009177 Ga0105248_10001017 Ga0105248_100010179 177
266 3300009553 Ga0105249_10014144 Ga0105249_100141447 177
267 3300009553 Ga0105249_10368416 Ga0105249_103684162 177
268 3300013297 Ga0157378_10059239 Ga0157378_100592393 177
269 3300013306 Ga0163162_10003690 Ga0163162_100036902 177
270 3300013308 Ga0157375_10157028 Ga0157375_101570282 177
271 3300014326 Ga0157380_10056711 Ga0157380_100567115 177
272 3300014968 Ga0157379_10341207 Ga0157379_103412071 177
273 3300017792 Ga0163161_10180227 Ga0163161_101802272 177
274 3300021361 Ga0213872_10000550 Ga0213872_100005507 177
275 3300021361 Ga0213872_10001493 Ga0213872_100014933 177
276 3300021361 Ga0213872_10003083 Ga0213872_100030835 177
277 3300021361 Ga0213872_10063732 Ga0213872_100637322 177
278 3300021361 Ga0213872_10087666 Ga0213872_100876662 177
279 3300025899 Ga0207642_10023761 Ga0207642_100237612 177
280 3300025907 Ga0207645_10027466 Ga0207645_100274663 177
281 3300025908 Ga0207643_10130630 Ga0207643_101306302 177
282 3300025931 Ga0207644_10110140 Ga0207644_101101402 177
283 3300025938 Ga0207704_10001924 Ga0207704_100019249 177
284 3300025938 Ga0207704_10488266 Ga0207704_104882661 177
285 3300025941 Ga0207711_10035227 Ga0207711_100352272 177
286 3300025942 Ga0207689_10002393 Ga0207689_100023935 177
287 3300025972 Ga0207668_10064349 Ga0207668_100643495 177
288 3300025986 Ga0207658_10054577 Ga0207658_100545775 177
289 3300026035 Ga0207703_10023071 Ga0207703_100230714 177
290 3300026041 Ga0207639_10585464 Ga0207639_105854642 177
291 3300026075 Ga0207708_10001483 Ga0207708_1000148311 177
292 3300026075 Ga0207708_10020486 Ga0207708_100204866 177
293 3300026088 Ga0207641_10511335 Ga0207641_105113352 177
294 3300026088 Ga0207641_10990044 Ga0207641_109900442 177
295 3300026089 Ga0207648_10002714 Ga0207648_1000271413 177
296 3300026089 Ga0207648_10007859 Ga0207648_100078593 177
297 3300026089 Ga0207648_10078345 Ga0207648_100783452 177
298 3300026095 Ga0207676_10017686 Ga0207676_100176862 177
299 3300026118 Ga0207675_100004700 Ga0207675_10000470012 177
300 3300026121 Ga0207683_10437464 Ga0207683_104374642 177
301 3300026142 Ga0207698_10019062 Ga0207698_100190625 177
302 3300028381 Ga0268264_10000860 Ga0268264_1000086019 177
303 3300028563 Ga0265319_1047674 Ga0265319_10476742 177
304 3300031344 Ga0265316_10000349 Ga0265316_1000034924 177
305 3300031507 Ga0307509_10097768 Ga0307509_100977682 177
306 3300035083 Ga0373926_0118676 Ga0373926_0118676_187_750 177
307 3300035695 Ga0373927_0021365 Ga0373927_0021365_800_1363 177
308 3300037068 Ga0373925_0271845 Ga0373925_0271845_38_601 177
309 3300037312 Ga0395899_0000249 Ga0395899_0000249_27989_28525 177
310 3300037312 Ga0395899_0004998 Ga0395899_0004998_5343_5903 177
311 3300037471 Ga0395905_0089416 Ga0395905_0089416_1484_2029 177
312 3300039447 Ga0436361_0269741 Ga0436361_0269741_6281_6817 177
313 3300039447 Ga0436361_0548371 Ga0436361_0548371_2813_3349 177
314 3300039447 Ga0436361_0554758 Ga0436361_0554758_212_751 177
315 3300039447 Ga0436361_0568030 Ga0436361_0568030_2912_3448 177
316 3300039447 Ga0436361_0607078 Ga0436361_0607078_23841_24377 177
317 3300039447 Ga0436361_0801349 Ga0436361_0801349_1436_1972 177
318 3300044683 Ga0466965_0014236 Ga0466965_0014236_1642_2178 177
319 3300044683 Ga0466965_0047480 Ga0466965_0047480_1052_1600 177
320 3300044684 Ga0466966_0015316 Ga0466966_0015316_756_1304 177
321 3300044735 Ga0466968_0028810 Ga0466968_0028810_1352_1888 177
322 3300044842 Ga0466957_0006340 Ga0466957_0006340_1143_1688 177
323 3300045049 Ga0466959_0133774 Ga0466959_0133774_545_1093 177
324 3300045976 Ga0466967_1354673 Ga0466967_1354673_47_583 177
325 3300046455 Ga0495603_0019251 Ga0495603_0019251_267_803 177
326 3300046455 Ga0495603_0223287 Ga0495603_0223287_47_583 177
327 3300046459 Ga0495629_0009630 Ga0495629_0009630_369_905 177
328 3300046459 Ga0495629_0318953 Ga0495629_0318953_395_931 177
329 3300046463 Ga0495653_0208950 Ga0495653_0208950_89_625 177
330 3300046472 Ga0495580_0261496 Ga0495580_0261496_368_904 177
331 3300046473 Ga0495582_0143034 Ga0495582_0143034_369_905 177
332 3300046474 Ga0495605_0030061 Ga0495605_0030061_516_1052 177
333 3300046477 Ga0495664_0296120 Ga0495664_0296120_179_742 177
334 3300046491 Ga0495584_0098212 Ga0495584_0098212_578_1114 177
335 3300046492 Ga0495585_0052085 Ga0495585_0052085_419_955 177
336 3300046499 Ga0495594_0014849 Ga0495594_0014849_1037_1573 177
337 3300046499 Ga0495594_0035712 Ga0495594_0035712_1037_1573 177
338 3300046499 Ga0495594_0280986 Ga0495594_0280986_211_747 177
339 3300046500 Ga0495596_0000835 Ga0495596_0000835_7386_7922 177
340 3300046506 Ga0495583_0316105 Ga0495583_0316105_25_558 177
341 3300046513 Ga0495616_0262882 Ga0495616_0262882_186_719 177
342 3300046517 Ga0495630_0276627 Ga0495630_0276627_82_618 177
343 3300046518 Ga0495631_0003859 Ga0495631_0003859_5124_5660 177
344 3300046522 Ga0495643_0011354 Ga0495643_0011354_1200_1733 177
345 3300046522 Ga0495643_0033138 Ga0495643_0033138_81_617 177
346 3300046523 Ga0495644_0016615 Ga0495644_0016615_655_1191 177
347 3300046526 Ga0495666_0050556 Ga0495666_0050556_611_1147 177
348 3300046526 Ga0495666_0095681 Ga0495666_0095681_549_1085 177
349 3300046528 Ga0495642_0001701 Ga0495642_0001701_5987_6520 177
350 3300046528 Ga0495642_0048997 Ga0495642_0048997_229_765 177
351 3300046528 Ga0495642_0116948 Ga0495642_0116948_402_938 177
352 3300046528 Ga0495642_0129907 Ga0495642_0129907_269_802 177
353 3300046529 Ga0495652_0061332 Ga0495652_0061332_88_624 177
354 3300046531 Ga0495665_0001201 Ga0495665_0001201_2847_3383 177
355 3300046531 Ga0495665_0108189 Ga0495665_0108189_115_651 177
356 3300046535 Ga0495586_0004416 Ga0495586_0004416_2016_2552 177
357 3300046535 Ga0495586_0202615 Ga0495586_0202615_450_1013 177
358 3300046538 Ga0495609_0014353 Ga0495609_0014353_678_1214 177
359 3300046542 Ga0495597_0000752 Ga0495597_0000752_18845_19381 177
360 3300046542 Ga0495597_0020524 Ga0495597_0020524_562_1095 177
361 3300046557 Ga0495622_0001036 Ga0495622_0001036_4217_4753 177
362 3300046557 Ga0495622_0007623 Ga0495622_0007623_3823_4359 177
363 3300046557 Ga0495622_0037392 Ga0495622_0037392_47_583 177
364 3300046616 Ga0495668_0169487 Ga0495668_0169487_230_766 177
365 3300046648 Ga0495611_0049375 Ga0495611_0049375_531_1067 177
366 3300046660 Ga0495625_0475465 Ga0495625_0475465_166_702 177
367 3300046663 Ga0495635_0214626 Ga0495635_0214626_471_1007 177
368 3300046665 Ga0495661_0000979 Ga0495661_0000979_2365_2898 177
369 3300046665 Ga0495661_0206789 Ga0495661_0206789_267_824 177
370 3300046674 Ga0495588_0101823 Ga0495588_0101823_831_1367 177
371 3300046674 Ga0495588_0419875 Ga0495588_0419875_74_613 177
372 3300046679 Ga0495623_0102959 Ga0495623_0102959_370_906 177
373 3300046680 Ga0495646_0174148 Ga0495646_0174148_339_875 177
374 3300046683 Ga0495658_0129769 Ga0495658_0129769_225_788 177
375 3300046689 Ga0495613_0043217 Ga0495613_0043217_2781_3317 177
376 3300046689 Ga0495613_0257777 Ga0495613_0257777_442_981 177
377 3300046690 Ga0495624_0012037 Ga0495624_0012037_2016_2552 177
378 3300046691 Ga0495670_0074567 Ga0495670_0074567_1167_1703 177
379 3300046809 Ga0495600_0008662 Ga0495600_0008662_3327_3863 177
380 3300047315 Ga0495581_0085854 Ga0495581_0085854_466_1002 177
381 3300047317 Ga0495604_0035774 Ga0495604_0035774_829_1365 177
382 3300047318 Ga0495636_0023203 Ga0495636_0023203_1556_2092 177
383 3300047319 Ga0495674_0139135 Ga0495674_0139135_1420_1956 177
384 3300047319 Ga0495674_0516302 Ga0495674_0516302_405_941 177
385 3300047321 Ga0495676_0057736 Ga0495676_0057736_37_573 177
386 3300047321 Ga0495676_0094996 Ga0495676_0094996_153_689 177
387 3300047321 Ga0495676_0149591 Ga0495676_0149591_514_1050 177
388 3300047323 Ga0495683_0193346 Ga0495683_0193346_164_700 177
389 3300047443 Ga0495687_015797 Ga0495687_015797_2514_3047 177
390 3300047443 Ga0495687_069360 Ga0495687_069360_189_722 177
391 3300047445 Ga0495677_0075010 Ga0495677_0075010_275_811 177
392 3300047469 Ga0495673_0063614 Ga0495673_0063614_689_1225 177
393 3300047470 Ga0495681_0130970 Ga0495681_0130970_407_943 177
394 3300048088 Ga0495602_0159406 Ga0495602_0159406_1105_1641 177
395 3300048089 Ga0495614_0035602 Ga0495614_0035602_1046_1582 177
396 3300048091 Ga0495626_0090992 Ga0495626_0090992_254_790 177
397 3300048091 Ga0495626_0273271 Ga0495626_0273271_126_659 177
398 3300048903 Ga0496100_0203971 Ga0496100_0203971_532_1089 177
399 3300048911 Ga0496108_0188329 Ga0496108_0188329_1182_1739 177
400 3300048912 Ga0496109_0008620 Ga0496109_0008620_6205_6771 177
401 3300048912 Ga0496109_0061399 Ga0496109_0061399_2447_3004 177
402 3300048913 Ga0496110_0320364 Ga0496110_0320364_236_802 177
403 3300048915 Ga0496112_0026238 Ga0496112_0026238_4820_5377 177
404 3300048918 Ga0496115_0003150 Ga0496115_0003150_6909_7445 177
405 3300048918 Ga0496115_0151021 Ga0496115_0151021_49_585 177
406 3300048918 Ga0496115_0173315 Ga0496115_0173315_914_1450 177
407 3300048918 Ga0496115_0234398 Ga0496115_0234398_828_1364 177
408 3300048927 Ga0496124_0673530 Ga0496124_0673530_80_637 177
409 3300061719 Ga0466962_0087866 Ga0466962_0087866_144_692 177
410 3300002737 JGI25162J39368_1000001 JGI25162J39368_10000019 178
411 3300002772 JGI25164J39214_1005291 JGI25164J39214_10052912 178
412 3300003214 JGI25165J46597_1000001 JGI25165J46597_10000018 178
413 3300003751 Ga0055538_1000001 Ga0055538_10000011025 178
414 3300003752 Ga0055539_1000001 Ga0055539_10000011025 178
415 3300003756 Ga0055533_1000003 Ga0055533_10000038 178
416 3300003759 Ga0055525_1000003 Ga0055525_10000038 178
417 3300003841 Ga0055541_1000001 Ga0055541_10000018 178
418 3300014497 Ga0182008_10150159 Ga0182008_101501592 178
419 3300015261 Ga0182006_1085836 Ga0182006_10858362 178
420 3300015262 Ga0182007_10001680 Ga0182007_1000168011 178
421 3300015265 Ga0182005_1000741 Ga0182005_100074112 178
422 3300021361 Ga0213872_10001896 Ga0213872_1000189612 178
423 3300025224 Ga0209784_100004 Ga0209784_1000048 178
424 3300025225 Ga0209566_100004 Ga0209566_100004165 178
425 3300025226 Ga0209674_100006 Ga0209674_100006165 178
426 3300025230 Ga0209563_100009 Ga0209563_1000098 178
427 3300025231 Ga0207427_103876 Ga0207427_1038762 178
428 3300025233 Ga0209437_100004 Ga0209437_1000048 178
429 3300025253 Ga0209677_100005 Ga0209677_1000058 178
430 3300025261 Ga0209233_1000005 Ga0209233_1000005165 178
431 3300025922 Ga0207646_10966582 Ga0207646_109665822 178
432 3300037312 Ga0395899_0001858 Ga0395899_0001858_15570_16109 178
433 3300037312 Ga0395899_0680344 Ga0395899_0680344_52_588 178
434 3300037418 Ga0395900_0009597 Ga0395900_0009597_5444_5983 178
435 3300037471 Ga0395905_0553279 Ga0395905_0553279_274_822 178
436 3300038443 Ga0395901_0137257 Ga0395901_0137257_814_1353 178
437 3300039447 Ga0436361_0099372 Ga0436361_0099372_11964_12521 178
438 3300044658 Ga0466972_0000060 Ga0466972_0000060_78634_79170 178
439 3300044658 Ga0466972_0203327 Ga0466972_0203327_13_549 178
440 3300044683 Ga0466965_0001324 Ga0466965_0001324_8850_9386 178
441 3300044706 Ga0466964_0004251 Ga0466964_0004251_4567_5103 178
442 3300044735 Ga0466968_0001361 Ga0466968_0001361_5916_6452 178
443 3300044765 Ga0466970_0001201 Ga0466970_0001201_11581_12117 178
444 3300044901 Ga0466960_0086960 Ga0466960_0086960_804_1340 178
445 3300045049 Ga0466959_0018965 Ga0466959_0018965_1816_2352 178
446 3300046462 Ga0495651_0004269 Ga0495651_0004269_5776_6312 178
447 3300046511 Ga0495608_0115249 Ga0495608_0115249_823_1359 178
448 3300046514 Ga0495618_0092832 Ga0495618_0092832_908_1444 178
449 3300046516 Ga0495628_0000137 Ga0495628_0000137_55749_56285 178
450 3300046529 Ga0495652_0002204 Ga0495652_0002204_1912_2448 178
451 3300048088 Ga0495602_0020316 Ga0495602_0020316_1030_1566 178
452 3300049571 Ga0501034_0568912 Ga0501034_0568912_217_756 178
453 3300049822 Ga0501035_0919654 Ga0501035_0919654_11_547 178
454 3300053077 Ga0495601_0240874 Ga0495601_0240874_481_1017 178

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04205

FMN_bind

FMN-binding domain

101

180

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zc6-assembly1.cif.gz_G na+ - translocating ferredoxin: nad+ reductase (rnf) of c. tetanomorphum 0.7322 27 177
4tvw-assembly2.cif.gz_B resorufin ligase with bound resorufin-amp analog 0.7307 82 135
8crj-assembly1.cif.gz_A crystal structure of lpla1 in complex with lipoyl-amp (listeria monocytogenes) 0.6652 77 135
8ahx-assembly1.cif.gz_G cryo-em structure of the nitrogen-fixation associated nadh:ferredoxin oxidoreductase rnf from azotobacter vinelandii 0.6633 39 165
1w9h-assembly1.cif.gz_A the structure of a piwi protein from archaeoglobus fulgidus. 0.6428 84 116
ID Description Score Start End Superfamily
af_P15081_4_110_3.90.1010.10 Alpha Beta;Alpha-Beta Complex;Sufe protein. Chain: A; 0.798 84 116 3.90.1010.10
af_Q2G147_253_340_3.30.390.50 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;CO dehydrogenase flavoprotein, C-terminal domain 0.6596 82 135 3.30.390.50
2bggB02 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.6587 84 114 3.30.420.10
4aybB04 Alpha Beta;Alpha-Beta Complex;Dna-directed Rna Polymerase Ii 140kd Polypeptide; Chain: B; domain 3;RNA polymerase Rpb2, domain 2 0.6326 69 113 3.90.1110.10
af_O60183_318_437_2.60.40.640 Mainly Beta;Sandwich;Immunoglobulin-like; 0.6178 71 110 2.60.40.640
ID Description Score Start End GO Terms
AF-H1SF73-F1-model_v4 Fmn-binding domain protein 0.9451 17 172 GO:0010181
GO:0016020
AF-A0A3S0CA15-F1-model_v4 FMN-binding protein 0.9425 25 175 GO:0005886
GO:0009055
GO:0010181
GO:0022900
AF-A0A2H0MMW8-F1-model_v4 FMN-binding domain-containing protein 0.9414 23 176 GO:0005886
GO:0009055
GO:0010181
GO:0022900
AF-A0A7C2PK41-F1-model_v4 FMN-binding protein 0.9402 20 178 GO:0005886
GO:0009055
GO:0010181
GO:0022900
AF-A0A523MWY0-F1-model_v4 FMN-binding protein 0.938 42 176 GO:0005886
GO:0009055
GO:0010181
GO:0022900

Feature Viewer

pLDDT pTM Quality
84.33 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map