F447335

General Info

Members Datasets Scaffolds Average Seq Length
454 213 908 327

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100000084|Ga0070714_10000008474
Length 368
Sequence MTIEESLAMPKRDYYEVLGVGKNASADEIKKAFRRQAVQHHPDRGGDEAKFKEINEAYEILKDPSKRQRYDQFGHAGVGSSAASDGNPFSGFGGFNTENVNFDFGDLGLGDIFSSFFGGEATGSSRRARNRGRDVETSIEISFEQAIFGTEVTLNLNMEDTCEHCKGTMAEPGYDLEKCVECKGSGQITKVTRTIFGNIQQATVCPKCHGRGSIPEKEVKRKSQNIGMKIPAGIDDGATIRLRERGEAISGGPKGDLYVNVRVKPHKKFTREGDLILSDEHISMVQAALGTEIEVDTVDGPVRMKIPIGTQSGTDFKLSGHGVPRLSGGLRGAHIVTVLVDTPTKMTSKQKSLLEQFAKESGKKGIFK

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
115 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
116 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
117 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
118 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
119 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
120 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
121 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
122 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
123 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
124 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
125 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
126 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
133 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
134 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
135 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
136 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
144 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
145 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
146 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
147 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
150 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
151 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
152 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
153 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
154 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
171 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
175 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
176 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
177 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
178 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
179 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
180 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
181 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
184 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
185 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
186 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
187 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
188 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
189 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
190 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
191 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
192 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
193 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
194 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
195 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
196 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
197 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
198 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
199 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
200 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
201 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
202 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
203 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
204 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
205 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
206 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
207 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
210 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
211 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
212 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.59
Nodule 0
Rhizoplane 0.88
Rhizosphere 75.77
Stem 0
Stem Tuber 0
Unclassified 6.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100000084 3300005435 Bacteria 80459
2 MBSR1b_contig_9791275 2162886012 Unclassified 2992
3 JGI24736J21556_1005959 3300001904 Bacteria 2059
4 JGI24741J21665_1000035 3300001915 Bacteria 32655
5 JGI24740J21852_10003430 3300001979 Bacteria 6971
6 JGI24737J22298_10000108 3300001990 Bacteria 25113
7 JGI24735J21928_10000053 3300002067 Bacteria 50333
8 rootH2_10000311 3300003320 Bacteria 277677
9 rootL2_10055982 3300003322 Bacteria 14224
10 rootH1_10073459 3300003323 Bacteria 13570
11 rootH1_10169515 3300003323 Bacteria 3424
12 Ga0065704_10103488 3300005289 Bacteria 2170
13 Ga0065715_10102498 3300005293 Unclassified 3109
14 Ga0070658_10000051 3300005327 Bacteria 118657
15 Ga0070658_10000110 3300005327 Bacteria 73137
16 Ga0070658_10000417 3300005327 Bacteria 36919
17 Ga0070658_10001073 3300005327 Bacteria 23367
18 Ga0070658_10005760 3300005327 Bacteria 10050
19 Ga0070658_10059874 3300005327 Unclassified 3101
20 Ga0070658_10086332 3300005327 Bacteria 2581
21 Ga0070676_10021304 3300005328 Bacteria 3628
22 Ga0070676_10031983 3300005328 Bacteria 3011
23 Ga0070683_100000183 3300005329 Bacteria 41586
24 Ga0070683_100378279 3300005329 Bacteria 1349
25 Ga0070690_100057049 3300005330 Bacteria 2506
26 Ga0070680_100223679 3300005336 Unclassified 1589
27 Ga0070682_100000500 3300005337 Bacteria 24620
28 Ga0070682_100001957 3300005337 Bacteria 11490
29 Ga0070660_100000599 3300005339 Bacteria 24067
30 Ga0070660_100012119 3300005339 Bacteria 6156
31 Ga0070691_10012175 3300005341 Bacteria 3939
32 Ga0070661_100053757 3300005344 Unclassified 2948
33 Ga0070692_10118089 3300005345 Bacteria 1475
34 Ga0070671_100012672 3300005355 Bacteria 6796
35 Ga0070671_100026638 3300005355 Bacteria 4754
36 Ga0070674_100077666 3300005356 Bacteria 2364
37 Ga0070673_100008812 3300005364 Bacteria 6735
38 Ga0070688_100147807 3300005365 Bacteria 1603
39 Ga0070659_100000739 3300005366 Bacteria 23764
40 Ga0070667_100000001 3300005367 Bacteria 1108638
41 Ga0070667_100009750 3300005367 Bacteria 7962
42 Ga0070667_100019776 3300005367 Bacteria 5586
43 Ga0070678_100000422 3300005456 Bacteria 20024
44 Ga0070678_100001931 3300005456 Bacteria 11179
45 Ga0070681_10001495 3300005458 Bacteria 20670
46 Ga0070681_10169673 3300005458 Bacteria 2104
47 Ga0070681_10226242 3300005458 Bacteria 1785
48 Ga0068867_100002667 3300005459 Bacteria 12591
49 Ga0070685_10000985 3300005466 Bacteria 15285
50 Ga0070685_10002385 3300005466 Bacteria 9670
51 Ga0070679_100001264 3300005530 Bacteria 22307
52 Ga0070679_100003682 3300005530 Bacteria 14036
53 Ga0070679_100006283 3300005530 Bacteria 11058
54 Ga0070679_100027027 3300005530 Bacteria 5643
55 Ga0070679_100033629 3300005530 Bacteria 5077
56 Ga0070679_100099792 3300005530 Bacteria 2890
57 Ga0070684_100000792 3300005535 Bacteria 21969
58 Ga0068853_100005203 3300005539 Bacteria 10174
59 Ga0068853_100026465 3300005539 Bacteria 4870
60 Ga0070672_100094479 3300005543 Bacteria 2417
61 Ga0070686_100101313 3300005544 Bacteria 1946
62 Ga0070693_100059401 3300005547 Bacteria 2216
63 Ga0070665_100395677 3300005548 Bacteria 1389
64 Ga0068855_100000001 3300005563 Bacteria 818777
65 Ga0068855_100000002 3300005563 Bacteria 616881
66 Ga0068855_100001916 3300005563 Bacteria 25818
67 Ga0068855_100002628 3300005563 Bacteria 22136
68 Ga0068855_100005940 3300005563 Bacteria 14885
69 Ga0068855_100160370 3300005563 Bacteria 2553
70 Ga0068855_100187968 3300005563 Bacteria 2332
71 Ga0068855_100309468 3300005563 Unclassified 1748
72 Ga0068855_100371768 3300005563 Bacteria 1571
73 Ga0068857_100000001 3300005577 Bacteria 254081
74 Ga0068857_100003777 3300005577 Bacteria 12729
75 Ga0068857_100035012 3300005577 Unclassified 4445
76 Ga0068857_100117302 3300005577 Bacteria 2395
77 Ga0068857_100124527 3300005577 Unclassified 2322
78 Ga0068857_100145782 3300005577 Bacteria 2142
79 Ga0068857_100218038 3300005577 Unclassified 1742
80 Ga0068859_100118426 3300005617 Bacteria 2714
81 Ga0068859_100347338 3300005617 Bacteria 1578
82 Ga0068863_100179614 3300005841 Bacteria 2032
83 Ga0068863_100306881 3300005841 Bacteria 1540
84 Ga0068858_100060544 3300005842 Bacteria 3499
85 Ga0068860_100012740 3300005843 Bacteria 8270
86 Ga0068860_100046013 3300005843 Bacteria 4161
87 Ga0068862_100030198 3300005844 Unclassified 4567
88 Ga0081455_10000001 3300005937 Bacteria 603871
89 Ga0081455_10000008 3300005937 Bacteria 256558
90 Ga0081539_10000789 3300005985 Bacteria 61661
91 Ga0075365_10000002 3300006038 Bacteria 226306
92 Ga0075365_10000016 3300006038 Bacteria 71640
93 Ga0075365_10001806 3300006038 Bacteria 9993
94 Ga0075365_10002512 3300006038 Bacteria 9039
95 Ga0075365_10020567 3300006038 Bacteria 4095
96 Ga0075365_10170518 3300006038 Unclassified 1519
97 Ga0075364_10000087 3300006051 Bacteria 36840
98 Ga0075364_10000371 3300006051 Bacteria 22078
99 Ga0075364_10021596 3300006051 Bacteria 4058
100 Ga0075364_10136520 3300006051 Bacteria 1648
101 Ga0075362_10000130 3300006177 Bacteria 20769
102 Ga0075362_10007981 3300006177 Bacteria 4032
103 Ga0075367_10000295 3300006178 Bacteria 17538
104 Ga0075369_10000006 3300006186 Bacteria 132271
105 Ga0075369_10000418 3300006186 Bacteria 12858
106 Ga0075366_10000002 3300006195 Bacteria 153795
107 Ga0075366_10000004 3300006195 Bacteria 111331
108 Ga0075366_10000007 3300006195 Bacteria 104412
109 Ga0075366_10000028 3300006195 Bacteria 50296
110 Ga0075366_10000223 3300006195 Bacteria 25208
111 Ga0097621_100000001 3300006237 Bacteria 632268
112 Ga0097621_100000005 3300006237 Bacteria 143888
113 Ga0097621_100037285 3300006237 Bacteria 3894
114 Ga0075370_10051349 3300006353 Unclassified 2339
115 Ga0075370_10070279 3300006353 Bacteria 2002
116 Ga0075370_10126103 3300006353 Bacteria 1492
117 Ga0068871_100000003 3300006358 Bacteria 141580
118 Ga0068871_100000008 3300006358 Bacteria 115827
119 Ga0075428_100001648 3300006844 Bacteria 23755
120 Ga0075428_100122939 3300006844 Bacteria 2825
121 Ga0075430_100047884 3300006846 Bacteria 3610
122 Ga0097620_100118423 3300006931 Bacteria 2714
123 Ga0097620_100347336 3300006931 Bacteria 1578
124 Ga0105240_10000003 3300009093 Bacteria 1183681
125 Ga0105240_10000048 3300009093 Bacteria 237451
126 Ga0105240_10002029 3300009093 Bacteria 33399
127 Ga0105240_10013194 3300009093 Bacteria 11366
128 Ga0105240_10097488 3300009093 Bacteria 3582
129 Ga0111539_10001364 3300009094 Bacteria 32516
130 Ga0105245_10000001 3300009098 Bacteria 939270
131 Ga0105245_10000007 3300009098 Bacteria 312285
132 Ga0105245_10000567 3300009098 Bacteria 33649
133 Ga0105243_10000001 3300009148 Bacteria 1156578
134 Ga0105242_10000001 3300009176 Bacteria 574039
135 Ga0105242_10255708 3300009176 Bacteria 1580
136 Ga0105237_10001685 3300009545 Bacteria 28614
137 Ga0105237_10017586 3300009545 Bacteria 7410
138 Ga0105238_10000042 3300009551 Bacteria 154892
139 Ga0105238_10002310 3300009551 Bacteria 19194
140 Ga0105238_10043957 3300009551 Bacteria 4519
141 Ga0105249_10000715 3300009553 Bacteria 30169
142 Ga0105249_10024069 3300009553 Bacteria 5470
143 Ga0105032_100291 3300009979 Bacteria 5146
144 Ga0105239_10005321 3300010375 Bacteria 15107
145 Ga0105239_10007340 3300010375 Bacteria 12659
146 Ga0105239_10014026 3300010375 Bacteria 8896
147 Ga0105239_10018237 3300010375 Bacteria 7758
148 Ga0157373_10038666 3300013100 Bacteria 3419
149 Ga0157371_10000181 3300013102 Bacteria 92599
150 Ga0157370_10043217 3300013104 Bacteria 4338
151 Ga0157370_10251419 3300013104 Bacteria 1635
152 Ga0157369_10000054 3300013105 Bacteria 162631
153 Ga0157369_10013211 3300013105 Bacteria 9345
154 Ga0157369_10027449 3300013105 Bacteria 6311
155 Ga0157369_10044269 3300013105 Bacteria 4846
156 Ga0157374_10000014 3300013296 Bacteria 396846
157 Ga0157374_10000133 3300013296 Bacteria 68141
158 Ga0157374_10007862 3300013296 Bacteria 9104
159 Ga0157374_10028990 3300013296 Bacteria 5005
160 Ga0157374_10099731 3300013296 Bacteria 2782
161 Ga0157378_10080772 3300013297 Bacteria 2938
162 Ga0157372_10000106 3300013307 Bacteria 87935
163 Ga0157372_10043791 3300013307 Bacteria 4958
164 Ga0157372_10054958 3300013307 Bacteria 4445
165 Ga0163163_10001499 3300014325 Bacteria 19769
166 Ga0163163_10288919 3300014325 Unclassified 1692
167 Ga0157377_10007873 3300014745 Bacteria 5168
168 Ga0157379_10012270 3300014968 Bacteria 7484
169 Ga0157376_10000001 3300014969 Bacteria 842910
170 Ga0207647_10001830 3300025904 Bacteria 16313
171 Ga0207645_10012949 3300025907 Bacteria 5642
172 Ga0207645_10052149 3300025907 Bacteria 2614
173 Ga0207705_10000019 3300025909 Bacteria 317770
174 Ga0207705_10000136 3300025909 Bacteria 79294
175 Ga0207705_10000227 3300025909 Bacteria 55933
176 Ga0207705_10001022 3300025909 Bacteria 22704
177 Ga0207705_10004891 3300025909 Bacteria 10050
178 Ga0207705_10033753 3300025909 Bacteria 3656
179 Ga0207705_10066995 3300025909 Bacteria 2598
180 Ga0207707_10062933 3300025912 Bacteria 3229
181 Ga0207707_10194562 3300025912 Bacteria 1769
182 Ga0207707_10211564 3300025912 Bacteria 1689
183 Ga0207695_10000005 3300025913 Bacteria 1196715
184 Ga0207695_10001072 3300025913 Bacteria 47825
185 Ga0207695_10006797 3300025913 Bacteria 14743
186 Ga0207695_10133754 3300025913 Bacteria 2435
187 Ga0207671_10000014 3300025914 Bacteria 461481
188 Ga0207671_10044737 3300025914 Bacteria 3274
189 Ga0207660_10002763 3300025917 Bacteria 11503
190 Ga0207657_10000588 3300025919 Bacteria 38480
191 Ga0207657_10004368 3300025919 Bacteria 14961
192 Ga0207649_10064608 3300025920 Unclassified 2314
193 Ga0207652_10002314 3300025921 Bacteria 16145
194 Ga0207652_10011098 3300025921 Bacteria 7262
195 Ga0207652_10011496 3300025921 Bacteria 7137
196 Ga0207652_10017839 3300025921 Bacteria 5815
197 Ga0207652_10026034 3300025921 Bacteria 4869
198 Ga0207652_10076580 3300025921 Bacteria 2918
199 Ga0207694_10000449 3300025924 Bacteria 38236
200 Ga0207694_10024332 3300025924 Bacteria 4598
201 Ga0207687_10000001 3300025927 Bacteria 1130810
202 Ga0207687_10000004 3300025927 Bacteria 841177
203 Ga0207687_10000008 3300025927 Bacteria 497738
204 Ga0207687_10002113 3300025927 Bacteria 13568
205 Ga0207664_10001316 3300025929 Bacteria 16373
206 Ga0207644_10057824 3300025931 Bacteria 2801
207 Ga0207644_10106792 3300025931 Bacteria 2111
208 Ga0207690_10023873 3300025932 Bacteria 3823
209 Ga0207686_10000001 3300025934 Bacteria 1169580
210 Ga0207709_10000002 3300025935 Bacteria 1171536
211 Ga0207669_10224710 3300025937 Bacteria 1380
212 Ga0207691_10112022 3300025940 Bacteria 2426
213 Ga0207661_10000908 3300025944 Bacteria 19423
214 Ga0207667_10000003 3300025949 Bacteria 822935
215 Ga0207667_10000005 3300025949 Bacteria 715503
216 Ga0207667_10000554 3300025949 Bacteria 48989
217 Ga0207667_10003411 3300025949 Bacteria 19620
218 Ga0207667_10003480 3300025949 Bacteria 19440
219 Ga0207667_10005275 3300025949 Bacteria 15765
220 Ga0207667_10395850 3300025949 Bacteria 1406
221 Ga0207651_10003726 3300025960 Bacteria 7539
222 Ga0207712_10000557 3300025961 Bacteria 30165
223 Ga0207712_10087297 3300025961 Unclassified 2287
224 Ga0207668_10086856 3300025972 Bacteria 2286
225 Ga0207658_10000003 3300025986 Bacteria 1151934
226 Ga0207639_10004725 3300026041 Bacteria 9175
227 Ga0207641_10052615 3300026088 Unclassified 3449
228 Ga0207648_10005496 3300026089 Bacteria 12773
229 Ga0207674_10000015 3300026116 Bacteria 183445
230 Ga0207674_10000636 3300026116 Bacteria 45638
231 Ga0207674_10059579 3300026116 Bacteria 3863
232 Ga0207674_10107923 3300026116 Bacteria 2761
233 Ga0207683_10002081 3300026121 Bacteria 17648
234 Ga0207698_10004308 3300026142 Bacteria 8665
235 Ga0268264_10014367 3300028381 Bacteria 6509
236 Ga0265337_1000055 3300028556 Bacteria 51887
237 Ga0265337_1000070 3300028556 Bacteria 47431
238 Ga0265337_1003675 3300028556 Bacteria 6571
239 Ga0265337_1004009 3300028556 Bacteria 6226
240 Ga0265337_1006914 3300028556 Unclassified 4308
241 Ga0265326_10000037 3300028558 Bacteria 89044
242 Ga0265326_10000335 3300028558 Bacteria 20011
243 Ga0265326_10002441 3300028558 Bacteria 6262
244 Ga0265326_10027186 3300028558 Bacteria 1631
245 Ga0265319_1004501 3300028563 Bacteria 6885
246 Ga0265334_10000004 3300028573 Bacteria 243436
247 Ga0265334_10000013 3300028573 Bacteria 155968
248 Ga0265334_10000461 3300028573 Bacteria 21106
249 Ga0265334_10001580 3300028573 Bacteria 10967
250 Ga0265334_10001607 3300028573 Bacteria 10852
251 Ga0265334_10002645 3300028573 Bacteria 8312
252 Ga0265334_10044947 3300028573 Unclassified 1712
253 Ga0265318_10032260 3300028577 Bacteria 2028
254 Ga0265322_10001424 3300028654 Bacteria 7870
255 Ga0265322_10004761 3300028654 Bacteria 4024
256 Ga0265322_10008131 3300028654 Bacteria 3058
257 Ga0265336_10000020 3300028666 Bacteria 213480
258 Ga0265336_10003145 3300028666 Bacteria 6571
259 Ga0265336_10003417 3300028666 Bacteria 6226
260 Ga0265338_10000003 3300028800 Bacteria 733923
261 Ga0265338_10000060 3300028800 Bacteria 197991
262 Ga0265338_10000074 3300028800 Bacteria 181183
263 Ga0265338_10000093 3300028800 Bacteria 168444
264 Ga0265338_10000189 3300028800 Bacteria 115979
265 Ga0265338_10000666 3300028800 Bacteria 59320
266 Ga0265338_10000807 3300028800 Bacteria 52873
267 Ga0265338_10001575 3300028800 Bacteria 36775
268 Ga0265338_10005876 3300028800 Bacteria 15827
269 Ga0265338_10006614 3300028800 Bacteria 14683
270 Ga0265338_10008124 3300028800 Bacteria 12815
271 Ga0265338_10010358 3300028800 Bacteria 10947
272 Ga0265338_10018507 3300028800 Bacteria 7455
273 Ga0265338_10020674 3300028800 Bacteria 6908
274 Ga0265338_10022246 3300028800 Bacteria 6571
275 Ga0265338_10022527 3300028800 Bacteria 6515
276 Ga0265338_10024111 3300028800 Bacteria 6226
277 Ga0265338_10029000 3300028800 Bacteria 5501
278 Ga0265338_10068537 3300028800 Bacteria 3056
279 Ga0265338_10075449 3300028800 Bacteria 2861
280 Ga0265338_10089244 3300028800 Bacteria 2555
281 Ga0265324_10000898 3300029957 Bacteria 18924
282 Ga0265324_10003553 3300029957 Bacteria 7347
283 Ga0265324_10008360 3300029957 Bacteria 4114
284 Ga0265324_10019242 3300029957 Bacteria 2460
285 Ga0316182_1168577 3300030745 Bacteria 16552
286 Ga0265332_10036659 3300031238 Unclassified 2128
287 Ga0265328_10015894 3300031239 Bacteria 2939
288 Ga0265320_10023892 3300031240 Unclassified 3244
289 Ga0265320_10044523 3300031240 Unclassified 2186
290 Ga0265320_10058406 3300031240 Bacteria 1847
291 Ga0265340_10000644 3300031247 Bacteria 19581
292 Ga0265340_10011105 3300031247 Bacteria 4800
293 Ga0265339_10009316 3300031249 Bacteria 6182
294 Ga0265331_10024589 3300031250 Bacteria 3045
295 Ga0265327_10000025 3300031251 Bacteria 380054
296 Ga0265327_10001503 3300031251 Bacteria 28901
297 Ga0265327_10003705 3300031251 Bacteria 14246
298 Ga0265327_10017151 3300031251 Bacteria 4558
299 Ga0265327_10028784 3300031251 Bacteria 3169
300 Ga0265316_10016454 3300031344 Bacteria 6413
301 Ga0265316_10107505 3300031344 Bacteria 2115
302 Ga0265313_10010800 3300031595 Bacteria 5736
303 Ga0265313_10013214 3300031595 Bacteria 4972
304 Ga0265313_10022421 3300031595 Bacteria 3425
305 Ga0265313_10026324 3300031595 Bacteria 3066
306 Ga0265313_10091900 3300031595 Bacteria 1361
307 Ga0265314_10086290 3300031711 Unclassified 2055
308 Ga0265342_10019604 3300031712 Unclassified 4356
309 Ga0307516_10000086 3300031730 Bacteria 102989
310 Ga0307516_10005329 3300031730 Bacteria 15462
311 Ga0307412_10017112 3300031911 Bacteria 4335
312 Ga0373941_0049480 3300035115 Bacteria 1331
313 Ga0395899_0003509 3300037312 Bacteria 12425
314 Ga0395899_0011298 3300037312 Bacteria 6838
315 Ga0395899_0011386 3300037312 Bacteria 6812
316 Ga0395900_0001098 3300037418 Bacteria 34408
317 Ga0395900_0001380 3300037418 Bacteria 29181
318 Ga0395900_0098177 3300037418 Bacteria 3009
319 Ga0395900_0130080 3300037418 Bacteria 2580
320 Ga0395900_0227673 3300037418 Unclassified 1877
321 Ga0395898_0006281 3300037466 Bacteria 12703
322 Ga0395898_0012317 3300037466 Bacteria 8843
323 Ga0395898_0117672 3300037466 Bacteria 2546
324 Ga0395905_0000406 3300037471 Bacteria 60907
325 Ga0395905_0075984 3300037471 Bacteria 3148
326 Ga0395905_0121419 3300037471 Bacteria 2456
327 Ga0395905_0233419 3300037471 Unclassified 1720
328 Ga0395905_0315629 3300037471 Bacteria 1452
329 Ga0395901_0016573 3300038443 Bacteria 7509
330 Ga0395901_0038955 3300038443 Bacteria 4917
331 Ga0395901_0043147 3300038443 Bacteria 4679
332 Ga0395901_0142342 3300038443 Bacteria 2520
333 Ga0395901_0375553 3300038443 Bacteria 1464
334 Ga0439445_0006502 3300042004 Bacteria 2688
335 Ga0439432_002425 3300042006 Bacteria 7019
336 Ga0450906_010825 3300042145 Bacteria 1715
337 Ga0439446_0000003 3300042156 Bacteria 158513
338 Ga0439434_0015191 3300042435 Bacteria 2295
339 Ga0466967_0051050 3300045976 Unclassified 3623
340 Ga0495638_0000061 3300046460 Bacteria 188551
341 Ga0495638_0000167 3300046460 Bacteria 102139
342 Ga0495588_0000169 3300046674 Bacteria 83978
343 Ga0495671_0078381 3300046692 Bacteria 1620
344 Ga0495660_0000005 3300046810 Bacteria 574567
345 Ga0495660_0003184 3300046810 Bacteria 10212
346 Ga0495672_0000010 3300047320 Bacteria 545038
347 Ga0496101_0218294 3300048904 Bacteria 1479
348 Ga0496112_0059243 3300048915 Bacteria 3772
349 Ga0496112_0386148 3300048915 Bacteria 1341
350 Ga0496115_0000001 3300048918 Bacteria 367230
351 Ga0496118_0086380 3300048921 Bacteria 2180
352 Ga0496124_0099520 3300048927 Unclassified 2358
353 Ga0501031_0002487 3300049568 Bacteria 11759
354 Ga0501032_0000176 3300049569 Bacteria 52456
355 Ga0501034_0000028 3300049571 Bacteria 255803
356 Ga0501034_0005037 3300049571 Bacteria 14518
357 Ga0501034_0339124 3300049571 Bacteria 1433
358 Ga0501037_0000138 3300049573 Bacteria 68040
359 Ga0501037_0146797 3300049573 Unclassified 1687
360 Ga0501038_0017922 3300049574 Bacteria 6397
361 Ga0501042_0054748 3300049578 Bacteria 2846
362 Ga0501043_0000062 3300049579 Bacteria 95664
363 Ga0501046_0000059 3300049580 Bacteria 126801
364 Ga0501047_0003402 3300049581 Bacteria 15065
365 Ga0501047_0013951 3300049581 Bacteria 7635
366 Ga0501048_0000001 3300049582 Bacteria 132132
367 Ga0501070_0050717 3300049586 Bacteria 3444
368 Ga0501070_0074351 3300049586 Bacteria 2813
369 Ga0501073_0007182 3300049589 Bacteria 8296
370 Ga0501073_0136464 3300049589 Bacteria 1700
371 Ga0501080_0000016 3300049742 Bacteria 96392
372 Ga0501080_0053864 3300049742 Bacteria 3747
373 Ga0501083_0063392 3300049744 Bacteria 2465
374 Ga0501035_0000872 3300049822 Bacteria 32043
375 Ga0501035_0024611 3300049822 Bacteria 5520
376 Ga0501044_0026114 3300049823 Bacteria 6185
377 nmdc:mga03683_187_c1 3300050489 Bacteria 20413
378 nmdc:mga03683_6384_c1 3300050489 Bacteria 4032
379 nmdc:mga00v17_10862_c1 3300050491 Bacteria 4988
380 nmdc:mga00v17_36450_c1 3300050491 Bacteria 2931
381 nmdc:mga00v17_562_c2 3300050491 Bacteria 9263
382 nmdc:mga00v17_5920_c1 3300050491 Bacteria 6463
383 nmdc:mga0yw44_15984_c1 3300050492 Bacteria 4040
384 nmdc:mga0yw44_31753_c1 3300050492 Unclassified 3073
385 nmdc:mga0yw44_3_c1 3300050492 Bacteria 561857
386 nmdc:mga0yw44_43738_c1 3300050492 Bacteria 2676
387 nmdc:mga0yw44_76_c1 3300050492 Bacteria 35478
388 nmdc:mga0yw44_8_c1 3300050492 Bacteria 237802
389 nmdc:mga0k408_1069_c1 3300050493 Bacteria 15067
390 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
391 nmdc:mga0k408_261_c1 3300050493 Bacteria 28772
392 nmdc:mga0k408_582_c1 3300050493 Bacteria 20230
393 nmdc:mga0k408_69_c2 3300050493 Bacteria 50340
394 nmdc:mga06z11_286_c1 3300050494 Bacteria 17566
395 nmdc:mga07m45_1678_c1 3300050496 Bacteria 10189
396 nmdc:mga07m45_26093_c1 3300050496 Bacteria 3209
397 nmdc:mga0qj67_136073_c1 3300050509 Bacteria 1991
398 nmdc:mga08y16_1493_c1 3300050511 Bacteria 22465
399 nmdc:mga0sz30_2_c1 3300050516 Bacteria 626403
400 nmdc:mga0sz30_3_c3 3300050516 Bacteria 21264
401 Ga0500610_0000081 3300053079 Bacteria 29103
402 Ga0500610_0021147 3300053079 Bacteria 3188
403 Ga0500643_000034 3300053087 Bacteria 185705
404 Ga0500643_000193 3300053087 Bacteria 58059
405 Ga0500643_004038 3300053087 Bacteria 6777
406 Ga0500643_004806 3300053087 Bacteria 5969
407 Ga0500644_0000519 3300053088 Bacteria 16372
408 Ga0500644_0002493 3300053088 Bacteria 4602
409 Ga0500644_0003271 3300053088 Bacteria 4005
410 Ga0500644_0010538 3300053088 Bacteria 2504
411 Ga0500646_0000005 3300053090 Bacteria 130895
412 Ga0500646_0000816 3300053090 Bacteria 8651
413 Ga0500583_0000040 3300053092 Bacteria 85274
414 Ga0500583_0000412 3300053092 Bacteria 13596
415 Ga0500583_0033736 3300053092 Bacteria 2268
416 Ga0500651_0000011 3300053093 Bacteria 246573
417 Ga0500651_0000025 3300053093 Bacteria 123745
418 Ga0500651_0008430 3300053093 Bacteria 6065
419 Ga0500641_0000001 3300053096 Bacteria 1115973
420 Ga0500650_0000001 3300053098 Bacteria 818797
421 Ga0500555_000001 3300053103 Bacteria 1353713
422 Ga0500555_000002 3300053103 Bacteria 1314346
423 Ga0500556_0000392 3300053104 Bacteria 32113
424 Ga0500562_000001 3300053108 Bacteria 1178987
425 Ga0500562_000002 3300053108 Bacteria 977234
426 Ga0500562_004663 3300053108 Bacteria 3460
427 Ga0500569_000001 3300053109 Bacteria 137852
428 Ga0500593_000001 3300053117 Bacteria 784404
429 Ga0500594_0000001 3300053118 Bacteria 1178472
430 Ga0500594_0000011 3300053118 Bacteria 87409
431 Ga0500594_0000382 3300053118 Bacteria 9918
432 Ga0500614_000001 3300053123 Bacteria 1274484
433 Ga0500614_009064 3300053123 Bacteria 2118
434 Ga0500621_011883 3300053126 Bacteria 3078
435 Ga0500628_000019 3300053129 Bacteria 82128
436 Ga0500628_000212 3300053129 Bacteria 11246
437 Ga0500628_003463 3300053129 Bacteria 2607
438 Ga0500642_0006261 3300053130 Bacteria 3903
439 Ga0500652_000001 3300053131 Bacteria 946868
440 Ga0500652_000009 3300053131 Bacteria 163737
441 Ga0500655_000275 3300053133 Bacteria 11921
442 Ga0500561_0000002 3300053137 Bacteria 394147
443 Ga0500577_0000784 3300053142 Bacteria 8181
444 Ga0500588_0000026 3300053146 Bacteria 35169
445 Ga0500589_000047 3300053147 Bacteria 26216
446 Ga0500616_0000005 3300053153 Bacteria 961725
447 Ga0500616_0000012 3300053153 Bacteria 681798
448 Ga0500622_0044367 3300053156 Bacteria 2304
449 Ga0500649_000003 3300053722 Bacteria 140482
450 Ga0500570_000170 3300053724 Bacteria 20309
451 Ga0500570_001270 3300053724 Bacteria 11425
452 Ga0500570_047087 3300053724 Bacteria 2201
453 Ga0500611_000181 3300053727 Bacteria 8563
454 Ga0501082_0196640 3300060353 Bacteria 1754
455 Ga0070714_100000084
456 MBSR1b_contig_9791275
457 JGI24736J21556_1005959
458 JGI24741J21665_1000035
459 JGI24740J21852_10003430
460 JGI24737J22298_10000108
461 JGI24735J21928_10000053
462 rootH2_10000311
463 rootL2_10055982
464 rootH1_10073459
465 rootH1_10169515
466 Ga0065704_10103488
467 Ga0065715_10102498
468 Ga0070658_10000051
469 Ga0070658_10000110
470 Ga0070658_10000417
471 Ga0070658_10001073
472 Ga0070658_10005760
473 Ga0070658_10059874
474 Ga0070658_10086332
475 Ga0070676_10021304
476 Ga0070676_10031983
477 Ga0070683_100000183
478 Ga0070683_100378279
479 Ga0070690_100057049
480 Ga0070680_100223679
481 Ga0070682_100000500
482 Ga0070682_100001957
483 Ga0070660_100000599
484 Ga0070660_100012119
485 Ga0070691_10012175
486 Ga0070661_100053757
487 Ga0070692_10118089
488 Ga0070671_100012672
489 Ga0070671_100026638
490 Ga0070674_100077666
491 Ga0070673_100008812
492 Ga0070688_100147807
493 Ga0070659_100000739
494 Ga0070667_100000001
495 Ga0070667_100009750
496 Ga0070667_100019776
497 Ga0070678_100000422
498 Ga0070678_100001931
499 Ga0070681_10001495
500 Ga0070681_10169673
501 Ga0070681_10226242
502 Ga0068867_100002667
503 Ga0070685_10000985
504 Ga0070685_10002385
505 Ga0070679_100001264
506 Ga0070679_100003682
507 Ga0070679_100006283
508 Ga0070679_100027027
509 Ga0070679_100033629
510 Ga0070679_100099792
511 Ga0070684_100000792
512 Ga0068853_100005203
513 Ga0068853_100026465
514 Ga0070672_100094479
515 Ga0070686_100101313
516 Ga0070693_100059401
517 Ga0070665_100395677
518 Ga0068855_100000001
519 Ga0068855_100000002
520 Ga0068855_100001916
521 Ga0068855_100002628
522 Ga0068855_100005940
523 Ga0068855_100160370
524 Ga0068855_100187968
525 Ga0068855_100309468
526 Ga0068855_100371768
527 Ga0068857_100000001
528 Ga0068857_100003777
529 Ga0068857_100035012
530 Ga0068857_100117302
531 Ga0068857_100124527
532 Ga0068857_100145782
533 Ga0068857_100218038
534 Ga0068859_100118426
535 Ga0068859_100347338
536 Ga0068863_100179614
537 Ga0068863_100306881
538 Ga0068858_100060544
539 Ga0068860_100012740
540 Ga0068860_100046013
541 Ga0068862_100030198
542 Ga0081455_10000001
543 Ga0081455_10000008
544 Ga0081539_10000789
545 Ga0075365_10000002
546 Ga0075365_10000016
547 Ga0075365_10001806
548 Ga0075365_10002512
549 Ga0075365_10020567
550 Ga0075365_10170518
551 Ga0075364_10000087
552 Ga0075364_10000371
553 Ga0075364_10021596
554 Ga0075364_10136520
555 Ga0075362_10000130
556 Ga0075362_10007981
557 Ga0075367_10000295
558 Ga0075369_10000006
559 Ga0075369_10000418
560 Ga0075366_10000002
561 Ga0075366_10000004
562 Ga0075366_10000007
563 Ga0075366_10000028
564 Ga0075366_10000223
565 Ga0097621_100000001
566 Ga0097621_100000005
567 Ga0097621_100037285
568 Ga0075370_10051349
569 Ga0075370_10070279
570 Ga0075370_10126103
571 Ga0068871_100000003
572 Ga0068871_100000008
573 Ga0075428_100001648
574 Ga0075428_100122939
575 Ga0075430_100047884
576 Ga0097620_100118423
577 Ga0097620_100347336
578 Ga0105240_10000003
579 Ga0105240_10000048
580 Ga0105240_10002029
581 Ga0105240_10013194
582 Ga0105240_10097488
583 Ga0111539_10001364
584 Ga0105245_10000001
585 Ga0105245_10000007
586 Ga0105245_10000567
587 Ga0105243_10000001
588 Ga0105242_10000001
589 Ga0105242_10255708
590 Ga0105237_10001685
591 Ga0105237_10017586
592 Ga0105238_10000042
593 Ga0105238_10002310
594 Ga0105238_10043957
595 Ga0105249_10000715
596 Ga0105249_10024069
597 Ga0105032_100291
598 Ga0105239_10005321
599 Ga0105239_10007340
600 Ga0105239_10014026
601 Ga0105239_10018237
602 Ga0157373_10038666
603 Ga0157371_10000181
604 Ga0157370_10043217
605 Ga0157370_10251419
606 Ga0157369_10000054
607 Ga0157369_10013211
608 Ga0157369_10027449
609 Ga0157369_10044269
610 Ga0157374_10000014
611 Ga0157374_10000133
612 Ga0157374_10007862
613 Ga0157374_10028990
614 Ga0157374_10099731
615 Ga0157378_10080772
616 Ga0157372_10000106
617 Ga0157372_10043791
618 Ga0157372_10054958
619 Ga0163163_10001499
620 Ga0163163_10288919
621 Ga0157377_10007873
622 Ga0157379_10012270
623 Ga0157376_10000001
624 Ga0207647_10001830
625 Ga0207645_10012949
626 Ga0207645_10052149
627 Ga0207705_10000019
628 Ga0207705_10000136
629 Ga0207705_10000227
630 Ga0207705_10001022
631 Ga0207705_10004891
632 Ga0207705_10033753
633 Ga0207705_10066995
634 Ga0207707_10062933
635 Ga0207707_10194562
636 Ga0207707_10211564
637 Ga0207695_10000005
638 Ga0207695_10001072
639 Ga0207695_10006797
640 Ga0207695_10133754
641 Ga0207671_10000014
642 Ga0207671_10044737
643 Ga0207660_10002763
644 Ga0207657_10000588
645 Ga0207657_10004368
646 Ga0207649_10064608
647 Ga0207652_10002314
648 Ga0207652_10011098
649 Ga0207652_10011496
650 Ga0207652_10017839
651 Ga0207652_10026034
652 Ga0207652_10076580
653 Ga0207694_10000449
654 Ga0207694_10024332
655 Ga0207687_10000001
656 Ga0207687_10000004
657 Ga0207687_10000008
658 Ga0207687_10002113
659 Ga0207664_10001316
660 Ga0207644_10057824
661 Ga0207644_10106792
662 Ga0207690_10023873
663 Ga0207686_10000001
664 Ga0207709_10000002
665 Ga0207669_10224710
666 Ga0207691_10112022
667 Ga0207661_10000908
668 Ga0207667_10000003
669 Ga0207667_10000005
670 Ga0207667_10000554
671 Ga0207667_10003411
672 Ga0207667_10003480
673 Ga0207667_10005275
674 Ga0207667_10395850
675 Ga0207651_10003726
676 Ga0207712_10000557
677 Ga0207712_10087297
678 Ga0207668_10086856
679 Ga0207658_10000003
680 Ga0207639_10004725
681 Ga0207641_10052615
682 Ga0207648_10005496
683 Ga0207674_10000015
684 Ga0207674_10000636
685 Ga0207674_10059579
686 Ga0207674_10107923
687 Ga0207683_10002081
688 Ga0207698_10004308
689 Ga0268264_10014367
690 Ga0265337_1000055
691 Ga0265337_1000070
692 Ga0265337_1003675
693 Ga0265337_1004009
694 Ga0265337_1006914
695 Ga0265326_10000037
696 Ga0265326_10000335
697 Ga0265326_10002441
698 Ga0265326_10027186
699 Ga0265319_1004501
700 Ga0265334_10000004
701 Ga0265334_10000013
702 Ga0265334_10000461
703 Ga0265334_10001580
704 Ga0265334_10001607
705 Ga0265334_10002645
706 Ga0265334_10044947
707 Ga0265318_10032260
708 Ga0265322_10001424
709 Ga0265322_10004761
710 Ga0265322_10008131
711 Ga0265336_10000020
712 Ga0265336_10003145
713 Ga0265336_10003417
714 Ga0265338_10000003
715 Ga0265338_10000060
716 Ga0265338_10000074
717 Ga0265338_10000093
718 Ga0265338_10000189
719 Ga0265338_10000666
720 Ga0265338_10000807
721 Ga0265338_10001575
722 Ga0265338_10005876
723 Ga0265338_10006614
724 Ga0265338_10008124
725 Ga0265338_10010358
726 Ga0265338_10018507
727 Ga0265338_10020674
728 Ga0265338_10022246
729 Ga0265338_10022527
730 Ga0265338_10024111
731 Ga0265338_10029000
732 Ga0265338_10068537
733 Ga0265338_10075449
734 Ga0265338_10089244
735 Ga0265324_10000898
736 Ga0265324_10003553
737 Ga0265324_10008360
738 Ga0265324_10019242
739 Ga0316182_1168577
740 Ga0265332_10036659
741 Ga0265328_10015894
742 Ga0265320_10023892
743 Ga0265320_10044523
744 Ga0265320_10058406
745 Ga0265340_10000644
746 Ga0265340_10011105
747 Ga0265339_10009316
748 Ga0265331_10024589
749 Ga0265327_10000025
750 Ga0265327_10001503
751 Ga0265327_10003705
752 Ga0265327_10017151
753 Ga0265327_10028784
754 Ga0265316_10016454
755 Ga0265316_10107505
756 Ga0265313_10010800
757 Ga0265313_10013214
758 Ga0265313_10022421
759 Ga0265313_10026324
760 Ga0265313_10091900
761 Ga0265314_10086290
762 Ga0265342_10019604
763 Ga0307516_10000086
764 Ga0307516_10005329
765 Ga0307412_10017112
766 Ga0373941_0049480
767 Ga0395899_0003509
768 Ga0395899_0011298
769 Ga0395899_0011386
770 Ga0395900_0001098
771 Ga0395900_0001380
772 Ga0395900_0098177
773 Ga0395900_0130080
774 Ga0395900_0227673
775 Ga0395898_0006281
776 Ga0395898_0012317
777 Ga0395898_0117672
778 Ga0395905_0000406
779 Ga0395905_0075984
780 Ga0395905_0121419
781 Ga0395905_0233419
782 Ga0395905_0315629
783 Ga0395901_0016573
784 Ga0395901_0038955
785 Ga0395901_0043147
786 Ga0395901_0142342
787 Ga0395901_0375553
788 Ga0439445_0006502
789 Ga0439432_002425
790 Ga0450906_010825
791 Ga0439446_0000003
792 Ga0439434_0015191
793 Ga0466967_0051050
794 Ga0495638_0000061
795 Ga0495638_0000167
796 Ga0495588_0000169
797 Ga0495671_0078381
798 Ga0495660_0000005
799 Ga0495660_0003184
800 Ga0495672_0000010
801 Ga0496101_0218294
802 Ga0496112_0059243
803 Ga0496112_0386148
804 Ga0496115_0000001
805 Ga0496118_0086380
806 Ga0496124_0099520
807 Ga0501031_0002487
808 Ga0501032_0000176
809 Ga0501034_0000028
810 Ga0501034_0005037
811 Ga0501034_0339124
812 Ga0501037_0000138
813 Ga0501037_0146797
814 Ga0501038_0017922
815 Ga0501042_0054748
816 Ga0501043_0000062
817 Ga0501046_0000059
818 Ga0501047_0003402
819 Ga0501047_0013951
820 Ga0501048_0000001
821 Ga0501070_0050717
822 Ga0501070_0074351
823 Ga0501073_0007182
824 Ga0501073_0136464
825 Ga0501080_0000016
826 Ga0501080_0053864
827 Ga0501083_0063392
828 Ga0501035_0000872
829 Ga0501035_0024611
830 Ga0501044_0026114
831 nmdc:mga03683_187_c1
832 nmdc:mga03683_6384_c1
833 nmdc:mga00v17_10862_c1
834 nmdc:mga00v17_36450_c1
835 nmdc:mga00v17_562_c2
836 nmdc:mga00v17_5920_c1
837 nmdc:mga0yw44_15984_c1
838 nmdc:mga0yw44_31753_c1
839 nmdc:mga0yw44_3_c1
840 nmdc:mga0yw44_43738_c1
841 nmdc:mga0yw44_76_c1
842 nmdc:mga0yw44_8_c1
843 nmdc:mga0k408_1069_c1
844 nmdc:mga0k408_1_c1
845 nmdc:mga0k408_261_c1
846 nmdc:mga0k408_582_c1
847 nmdc:mga0k408_69_c2
848 nmdc:mga06z11_286_c1
849 nmdc:mga07m45_1678_c1
850 nmdc:mga07m45_26093_c1
851 nmdc:mga0qj67_136073_c1
852 nmdc:mga08y16_1493_c1
853 nmdc:mga0sz30_2_c1
854 nmdc:mga0sz30_3_c3
855 Ga0500610_0000081
856 Ga0500610_0021147
857 Ga0500643_000034
858 Ga0500643_000193
859 Ga0500643_004038
860 Ga0500643_004806
861 Ga0500644_0000519
862 Ga0500644_0002493
863 Ga0500644_0003271
864 Ga0500644_0010538
865 Ga0500646_0000005
866 Ga0500646_0000816
867 Ga0500583_0000040
868 Ga0500583_0000412
869 Ga0500583_0033736
870 Ga0500651_0000011
871 Ga0500651_0000025
872 Ga0500651_0008430
873 Ga0500641_0000001
874 Ga0500650_0000001
875 Ga0500555_000001
876 Ga0500555_000002
877 Ga0500556_0000392
878 Ga0500562_000001
879 Ga0500562_000002
880 Ga0500562_004663
881 Ga0500569_000001
882 Ga0500593_000001
883 Ga0500594_0000001
884 Ga0500594_0000011
885 Ga0500594_0000382
886 Ga0500614_000001
887 Ga0500614_009064
888 Ga0500621_011883
889 Ga0500628_000019
890 Ga0500628_000212
891 Ga0500628_003463
892 Ga0500642_0006261
893 Ga0500652_000001
894 Ga0500652_000009
895 Ga0500655_000275
896 Ga0500561_0000002
897 Ga0500577_0000784
898 Ga0500588_0000026
899 Ga0500589_000047
900 Ga0500616_0000005
901 Ga0500616_0000012
902 Ga0500622_0044367
903 Ga0500649_000003
904 Ga0500570_000170
905 Ga0500570_001270
906 Ga0500570_047087
907 Ga0500611_000181
908 Ga0501082_0196640

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

13

71

0.98

PF01556

DnaJ_C

DnaJ C terminal domain

135

343

0.97

PF00684

DnaJ_CXXCXGXG

DnaJ central domain

162

222

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4rwu-assembly1.cif.gz_A j-domain of sis1 protein, hsp40 co-chaperone from saccharomyces cerevisiae 0.9369 6 59
2qsa-assembly1.cif.gz_A crystal structure of j-domain of dnaj homolog dnj-2 precursor from c.elegans. 0.9126 6 57
4j7z-assembly6.cif.gz_F thermus thermophilus dnaj j- and g/f-domains 0.9047 1 59
6d6x-assembly1.cif.gz_A hsp40 co-chaperone sis1 j-domain 0.904 6 59
3i38-assembly7.cif.gz_I structure of a putative chaperone protein dnaj from klebsiella pneumoniae subsp. pneumoniae mgh 78578 0.8946 209 297
ID Description Score Start End Superfamily
af_Q5A6A5_7_91_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9724 5 58 1.10.287.110
3i38I01 Mainly Beta;Sandwich;HSP40/DNAj peptide-binding domain;Urease metallochaperone UreE, N-terminal domain 0.9533 209 282 2.60.260.20
af_Q4DZ66_1_74_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9526 6 59 1.10.287.110
af_Q4DPJ4_61_139_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9519 6 54 1.10.287.110
af_A4HTA4_146_210_1.10.287.110 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;DnaJ domain 0.9517 6 55 1.10.287.110
ID Description Score Start End GO Terms
AF-A0A5N9GSS3-F1-model_v4 J domain-containing protein 0.9516 208 297 GO:0005737
GO:0042026
GO:0051082
GO:0051085
AF-A0A6L8ZA96-F1-model_v4 deleted 0.9496 166 297
AF-A0A496P2D3-F1-model_v4 Molecular chaperone DnaJ 0.949 204 297 GO:0005737
GO:0042026
GO:0051082
GO:0051085
AF-A0A4Y9J712-F1-model_v4 deleted 0.9389 168 291
AF-A0A7X7IP44-F1-model_v4 J domain-containing protein 0.9366 178 297 GO:0005829
GO:0051082
GO:0051085
GO:0051087

Map