F447345

General Info

Members Datasets Scaffolds Average Seq Length
454 262 908 312

Family's Representative Sequence

Representative Sequence 3300005468|Ga0070707_100004177|Ga0070707_10000417716
Length 358
Sequence MRTLIAASGTSTSECVRLHSRPAVHAGHNNDVTNANRTTYAVYAEALVRHFNGSRAVDNVDLQIQAGEIYGFLGPNGAGKSTTVRMLCTLLAPTGGRAQVAGYDVATQAGQVRLRIGVALQDAALDPKQTGNELLRLQGRLYGLSGKAMARRLAELSELIELGDALDRQIGTYSGGMQRRLDLAAALVHNPQVLFLDEPTTGLDPASRARVWSEIRRLNQQLGMTIFLTTQYLEEADELAHRVGIIDRGRIVAEGTPVELKRSVGTDVIVARVVGDADAARPVLDAIPGVLGVETHGNELVIATANGAGAISHVAVALASSKMTVRDLTLRTPTLDDVFLELTGTHIERNNNTGEDRS

Samples

Sample ID Description Type Environment
1 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
153 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
154 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
158 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
166 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
167 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
171 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
172 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
173 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
174 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
175 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
176 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
179 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
186 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
202 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
203 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
204 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
209 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
212 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
215 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
226 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
234 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
235 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
236 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
237 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
238 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
239 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
240 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
241 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
253 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
254 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
255 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
256 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
260 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
261 2808606394 Promicromonospora sp. C35 Isolate Unclassified
262 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0.66
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.52
Nodule 0
Rhizoplane 6.61
Rhizosphere 86.34
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070707_100004177 3300005468 Bacteria 13533
2 JGI24743J22301_10002073 3300001991 Bacteria 2954
3 JGI24738J21930_10007689 3300002075 Bacteria 2476
4 JGI25407J50210_10016703 3300003373 Bacteria 1902
5 Ga0070658_10060869 3300005327 Bacteria 3075
6 Ga0070683_100027732 3300005329 Bacteria 5111
7 Ga0070683_100112232 3300005329 Bacteria 2572
8 Ga0070683_100199838 3300005329 Bacteria 1898
9 Ga0070690_100039161 3300005330 Bacteria 2994
10 Ga0070670_100084533 3300005331 Bacteria 2726
11 Ga0068869_100043803 3300005334 Bacteria 3216
12 Ga0070680_100100769 3300005336 Bacteria 2397
13 Ga0070680_100140003 3300005336 Bacteria 2029
14 Ga0070682_100000026 3300005337 Bacteria 191388
15 Ga0070682_100040946 3300005337 Bacteria 2853
16 Ga0070682_100044622 3300005337 Bacteria 2745
17 Ga0068868_100024062 3300005338 Bacteria 4616
18 Ga0070660_100010492 3300005339 Bacteria 6546
19 Ga0070660_100044189 3300005339 Bacteria 3407
20 Ga0070660_100255679 3300005339 Bacteria 1429
21 Ga0070689_100015926 3300005340 Bacteria 5494
22 Ga0070689_100110005 3300005340 Bacteria 2190
23 Ga0070691_10016718 3300005341 Bacteria 3373
24 Ga0070661_100048667 3300005344 Bacteria 3103
25 Ga0070661_100187239 3300005344 Bacteria 1577
26 Ga0070692_10006300 3300005345 Bacteria 5144
27 Ga0070668_100003538 3300005347 Bacteria 11519
28 Ga0070675_100077658 3300005354 Bacteria 2764
29 Ga0070675_100087078 3300005354 Bacteria 2611
30 Ga0070675_100159127 3300005354 Bacteria 1941
31 Ga0070671_100015451 3300005355 Bacteria 6166
32 Ga0070671_100022183 3300005355 Bacteria 5187
33 Ga0070674_100012058 3300005356 Bacteria 5295
34 Ga0070673_100016100 3300005364 Bacteria 5276
35 Ga0070688_100001975 3300005365 Bacteria 10319
36 Ga0070659_100025815 3300005366 Bacteria 4518
37 Ga0070659_100052030 3300005366 Bacteria 3220
38 Ga0070667_100286204 3300005367 Bacteria 1481
39 Ga0070709_10015386 3300005434 Bacteria 4352
40 Ga0070709_10016934 3300005434 Bacteria 4171
41 Ga0070701_10072506 3300005438 Bacteria 1844
42 Ga0070700_100101299 3300005441 Bacteria 1898
43 Ga0070700_100120151 3300005441 Bacteria 1759
44 Ga0070708_100014875 3300005445 Bacteria 6412
45 Ga0070708_100136156 3300005445 Bacteria 2275
46 Ga0070708_100200128 3300005445 Bacteria 1870
47 Ga0070663_100019615 3300005455 Bacteria 4462
48 Ga0070663_100073687 3300005455 Bacteria 2491
49 Ga0070678_100015299 3300005456 Bacteria 4872
50 Ga0070678_100081720 3300005456 Bacteria 2451
51 Ga0070662_100034134 3300005457 Bacteria 3586
52 Ga0070662_100060614 3300005457 Bacteria 2759
53 Ga0070681_10057213 3300005458 Bacteria 3880
54 Ga0070681_10146752 3300005458 Bacteria 2288
55 Ga0068867_100100746 3300005459 Bacteria 2206
56 Ga0070685_10018642 3300005466 Bacteria 3735
57 Ga0070706_100009402 3300005467 Bacteria 9102
58 Ga0070706_100011077 3300005467 Bacteria 8373
59 Ga0070706_100028025 3300005467 Bacteria 5182
60 Ga0070706_100044100 3300005467 Bacteria 4120
61 Ga0070707_100018775 3300005468 Bacteria 6509
62 Ga0070707_100060676 3300005468 Bacteria 3627
63 Ga0070707_100166808 3300005468 Bacteria 2146
64 Ga0070698_100054998 3300005471 Bacteria 4039
65 Ga0070698_100078532 3300005471 Bacteria 3299
66 Ga0070698_100329106 3300005471 Bacteria 1459
67 Ga0070699_100314900 3300005518 Bacteria 1405
68 Ga0070679_100182975 3300005530 Bacteria 2067
69 Ga0070679_100253362 3300005530 Bacteria 1716
70 Ga0070684_100041522 3300005535 Bacteria 3966
71 Ga0070684_100159311 3300005535 Bacteria 2047
72 Ga0068853_100021929 3300005539 Bacteria 5327
73 Ga0068853_100317441 3300005539 Bacteria 1444
74 Ga0070672_100059653 3300005543 Bacteria 3002
75 Ga0070686_100010299 3300005544 Bacteria 5268
76 Ga0070695_100063588 3300005545 Bacteria 2399
77 Ga0070693_100038753 3300005547 Bacteria 2666
78 Ga0070665_100084556 3300005548 Bacteria 3178
79 Ga0068855_100118735 3300005563 Bacteria 3028
80 Ga0068855_100273801 3300005563 Bacteria 1876
81 Ga0070664_100127073 3300005564 Bacteria 2237
82 Ga0070664_100139610 3300005564 Bacteria 2133
83 Ga0068857_100004671 3300005577 Bacteria 11601
84 Ga0068854_100000082 3300005578 Bacteria 68340
85 Ga0068854_100030811 3300005578 Bacteria 3723
86 Ga0068854_100084357 3300005578 Bacteria 2351
87 Ga0068854_100085914 3300005578 Bacteria 2331
88 Ga0070702_100115900 3300005615 Bacteria 1669
89 Ga0068852_100205526 3300005616 Bacteria 1865
90 Ga0068859_100229136 3300005617 Bacteria 1946
91 Ga0068866_10067288 3300005718 Bacteria 1880
92 Ga0068866_10080681 3300005718 Bacteria 1746
93 Ga0068861_100293881 3300005719 Bacteria 1404
94 Ga0068851_10040146 3300005834 Bacteria 2352
95 Ga0068870_10202043 3300005840 Bacteria 1205
96 Ga0068858_100015291 3300005842 Bacteria 7220
97 Ga0068858_100036468 3300005842 Bacteria 4560
98 Ga0068858_100053436 3300005842 Bacteria 3737
99 Ga0068860_100140688 3300005843 Bacteria 2319
100 Ga0068862_100001142 3300005844 Bacteria 25132
101 Ga0081455_10002376 3300005937 Bacteria 22485
102 Ga0081455_10005042 3300005937 Bacteria 14589
103 Ga0081455_10011122 3300005937 Bacteria 9059
104 Ga0081538_10000105 3300005981 Bacteria 83102
105 Ga0081538_10006122 3300005981 Bacteria 10683
106 Ga0081538_10013679 3300005981 Bacteria 6413
107 Ga0081538_10037636 3300005981 Bacteria 3134
108 Ga0081538_10039860 3300005981 Bacteria 3006
109 Ga0081539_10038494 3300005985 Bacteria 2834
110 Ga0070717_10148635 3300006028 Bacteria 2026
111 Ga0075365_10004563 3300006038 Bacteria 7360
112 Ga0075365_10032753 3300006038 Bacteria 3344
113 Ga0075365_10079480 3300006038 Bacteria 2219
114 Ga0075363_100009449 3300006048 Bacteria 4585
115 Ga0075364_10046718 3300006051 Bacteria 2819
116 Ga0075364_10141866 3300006051 Bacteria 1616
117 Ga0075362_10124556 3300006177 Bacteria 1222
118 Ga0068871_100117013 3300006358 Bacteria 2248
119 Ga0068871_100265361 3300006358 Bacteria 1499
120 Ga0075428_100028377 3300006844 Bacteria 6191
121 Ga0075428_100081073 3300006844 Bacteria 3541
122 Ga0075428_100438503 3300006844 Bacteria 1399
123 Ga0075430_100006829 3300006846 Bacteria 9619
124 Ga0075430_100015802 3300006846 Bacteria 6428
125 Ga0075431_100000056 3300006847 Bacteria 62721
126 Ga0075431_100011012 3300006847 Bacteria 9105
127 Ga0075434_100000356 3300006871 Bacteria 33159
128 Ga0075429_100005701 3300006880 Bacteria 10743
129 Ga0068865_100056787 3300006881 Bacteria 2729
130 Ga0075436_100006747 3300006914 Bacteria 7859
131 Ga0097620_100229135 3300006931 Bacteria 1946
132 Ga0105240_10543334 3300009093 Bacteria 1286
133 Ga0111539_10000449 3300009094 Bacteria 51659
134 Ga0111539_10017044 3300009094 Bacteria 8993
135 Ga0111539_10226151 3300009094 Bacteria 2179
136 Ga0105245_10010835 3300009098 Bacteria 7933
137 Ga0105245_10015151 3300009098 Bacteria 6717
138 Ga0105245_10187064 3300009098 Bacteria 1982
139 Ga0114129_10023233 3300009147 Bacteria 8796
140 Ga0114129_10074343 3300009147 Bacteria 4733
141 Ga0114129_10240984 3300009147 Bacteria 2431
142 Ga0105243_10032278 3300009148 Bacteria 4044
143 Ga0105243_10057881 3300009148 Bacteria 3088
144 Ga0105243_10072936 3300009148 Bacteria 2780
145 Ga0105241_10377633 3300009174 Bacteria 1237
146 Ga0105242_10017399 3300009176 Bacteria 5602
147 Ga0105242_10054296 3300009176 Bacteria 3274
148 Ga0105242_10243097 3300009176 Bacteria 1619
149 Ga0105238_10058177 3300009551 Bacteria 3875
150 Ga0105238_10499883 3300009551 Bacteria 1217
151 Ga0105249_10011399 3300009553 Bacteria 7807
152 Ga0105249_10079542 3300009553 Bacteria 3043
153 Ga0105249_10260326 3300009553 Bacteria 1723
154 Ga0105249_10401936 3300009553 Bacteria 1400
155 Ga0105249_10424915 3300009553 Bacteria 1363
156 Ga0105239_10124153 3300010375 Bacteria 2868
157 Ga0105239_10201435 3300010375 Bacteria 2230
158 Ga0105239_10777474 3300010375 Bacteria 1096
159 Ga0105246_10205460 3300011119 Bacteria 1534
160 Ga0157373_10189268 3300013100 Bacteria 1450
161 Ga0157371_10058092 3300013102 Bacteria 2744
162 Ga0157369_10295292 3300013105 Bacteria 1686
163 Ga0157374_10047926 3300013296 Bacteria 3963
164 Ga0157378_10031394 3300013297 Bacteria 4693
165 Ga0157378_10169152 3300013297 Bacteria 2048
166 Ga0157378_10329390 3300013297 Bacteria 1486
167 Ga0163162_10437071 3300013306 Bacteria 1441
168 Ga0163162_10930691 3300013306 Bacteria 981
169 Ga0157372_10149462 3300013307 Bacteria 2695
170 Ga0157380_10032839 3300014326 Bacteria 3994
171 Ga0157377_10055890 3300014745 Bacteria 2240
172 Ga0157377_10068675 3300014745 Bacteria 2043
173 Ga0157379_10019221 3300014968 Bacteria 6033
174 Ga0157379_10035466 3300014968 Bacteria 4447
175 Ga0206353_10842230 3300020082 Bacteria 1352
176 Ga0207656_10018733 3300025321 Bacteria 2729
177 Ga0207682_10009047 3300025893 Bacteria 3935
178 Ga0207642_10121463 3300025899 Bacteria 1348
179 Ga0207688_10043807 3300025901 Bacteria 2493
180 Ga0207688_10050275 3300025901 Bacteria 2333
181 Ga0207688_10239190 3300025901 Bacteria 1098
182 Ga0207647_10056000 3300025904 Bacteria 2420
183 Ga0207699_10178366 3300025906 Bacteria 1426
184 Ga0207645_10126115 3300025907 Bacteria 1664
185 Ga0207684_10126869 3300025910 Bacteria 2190
186 Ga0207707_10143129 3300025912 Bacteria 2090
187 Ga0207695_10400864 3300025913 Bacteria 1256
188 Ga0207660_10111470 3300025917 Bacteria 2059
189 Ga0207662_10028999 3300025918 Bacteria 3203
190 Ga0207657_10006124 3300025919 Bacteria 12503
191 Ga0207649_10042792 3300025920 Bacteria 2764
192 Ga0207649_10259685 3300025920 Bacteria 1255
193 Ga0207652_10349060 3300025921 Bacteria 1335
194 Ga0207646_10008785 3300025922 Bacteria 10082
195 Ga0207681_10229632 3300025923 Bacteria 1440
196 Ga0207659_10060913 3300025926 Bacteria 2718
197 Ga0207659_10385670 3300025926 Bacteria 1169
198 Ga0207687_10067672 3300025927 Bacteria 2542
199 Ga0207687_10202430 3300025927 Bacteria 1553
200 Ga0207664_10343621 3300025929 Bacteria 1320
201 Ga0207644_10017944 3300025931 Bacteria 4785
202 Ga0207644_10335360 3300025931 Bacteria 1225
203 Ga0207690_10010789 3300025932 Bacteria 5444
204 Ga0207690_10496902 3300025932 Bacteria 986
205 Ga0207706_10015361 3300025933 Bacteria 6917
206 Ga0207706_10022030 3300025933 Bacteria 5719
207 Ga0207706_10114478 3300025933 Bacteria 2372
208 Ga0207706_10271785 3300025933 Bacteria 1479
209 Ga0207686_10044923 3300025934 Bacteria 2715
210 Ga0207686_10112568 3300025934 Bacteria 1838
211 Ga0207709_10035394 3300025935 Bacteria 2952
212 Ga0207670_10158857 3300025936 Bacteria 1685
213 Ga0207670_10181180 3300025936 Bacteria 1587
214 Ga0207669_10054128 3300025937 Bacteria 2422
215 Ga0207704_10113350 3300025938 Bacteria 1838
216 Ga0207704_10232604 3300025938 Bacteria 1372
217 Ga0207704_10397815 3300025938 Bacteria 1086
218 Ga0207691_10068837 3300025940 Bacteria 3198
219 Ga0207691_10089799 3300025940 Bacteria 2755
220 Ga0207691_10143766 3300025940 Bacteria 2101
221 Ga0207711_10133998 3300025941 Bacteria 2223
222 Ga0207689_10064480 3300025942 Bacteria 3014
223 Ga0207661_10039621 3300025944 Bacteria 3699
224 Ga0207661_10093744 3300025944 Bacteria 2507
225 Ga0207679_10112977 3300025945 Bacteria 2148
226 Ga0207667_10107924 3300025949 Bacteria 2872
227 Ga0207712_10006637 3300025961 Bacteria 7305
228 Ga0207712_10213946 3300025961 Bacteria 1537
229 Ga0207668_10004720 3300025972 Bacteria 8016
230 Ga0207640_10045752 3300025981 Bacteria 2812
231 Ga0207640_10295970 3300025981 Bacteria 1278
232 Ga0207658_10001121 3300025986 Bacteria 21617
233 Ga0207658_10387882 3300025986 Bacteria 1225
234 Ga0207677_10064176 3300026023 Bacteria 2556
235 Ga0207703_10029846 3300026035 Bacteria 4305
236 Ga0207639_10336192 3300026041 Bacteria 1345
237 Ga0207678_10070491 3300026067 Bacteria 2997
238 Ga0207678_10158302 3300026067 Bacteria 1934
239 Ga0207708_10035451 3300026075 Bacteria 3796
240 Ga0207708_10167187 3300026075 Bacteria 1739
241 Ga0207641_10243443 3300026088 Bacteria 1677
242 Ga0207641_10407842 3300026088 Bacteria 1306
243 Ga0207648_10001336 3300026089 Bacteria 27386
244 Ga0207648_10045253 3300026089 Bacteria 3860
245 Ga0207676_10187137 3300026095 Bacteria 1818
246 Ga0207674_10003204 3300026116 Bacteria 20154
247 Ga0207675_100016689 3300026118 Bacteria 6856
248 Ga0207675_100245959 3300026118 Bacteria 1730
249 Ga0207675_100308164 3300026118 Bacteria 1543
250 Ga0207683_10021406 3300026121 Bacteria 5536
251 Ga0207683_10149314 3300026121 Bacteria 2109
252 Ga0207698_10052395 3300026142 Bacteria 3126
253 Ga0207698_10184626 3300026142 Bacteria 1851
254 Ga0207428_10005428 3300027907 Bacteria 11891
255 Ga0207428_10199232 3300027907 Bacteria 1507
256 Ga0268265_10015269 3300028380 Bacteria 5251
257 Ga0316576_10012576 3300031727 Bacteria 5597
258 Ga0316578_10012226 3300031728 Bacteria 4522
259 Ga0316577_10032465 3300031733 Bacteria 2918
260 Ga0307410_10004681 3300031852 Bacteria 7114
261 Ga0307416_100261983 3300032002 Bacteria 1690
262 Ga0307414_10566997 3300032004 Bacteria 1014
263 Ga0316586_1001030 3300033527 Bacteria 3010
264 Ga0316587_1011710 3300033529 Bacteria 1420
265 Ga0373954_0150642 3300035118 Bacteria 1136
266 Ga0316574_0071619 3300035398 Bacteria 2189
267 Ga0316574_0091003 3300035398 Bacteria 1945
268 Ga0373927_0014962 3300035695 Bacteria 5133
269 Ga0373937_0128490 3300036401 Bacteria 2365
270 Ga0373925_0006749 3300037068 Bacteria 8415
271 Ga0316581_0028614 3300037588 Bacteria 1671
272 Ga0400485_05720 3300038735 Bacteria 7707
273 Ga0400483_023354 3300039062 Bacteria 2500
274 Ga0400483_031601 3300039062 Bacteria 46159
275 Ga0400483_079531 3300039062 Bacteria 1448
276 Ga0400483_092270 3300039062 Bacteria 5903
277 Ga0400483_230433 3300039062 Bacteria 44690
278 Ga0436365_1777696 3300039437 Bacteria 977
279 Ga0436361_0072893 3300039447 Bacteria 7948
280 Ga0436362_0242738 3300039453 Bacteria 11388
281 Ga0439448_0003212 3300042005 Bacteria 4511
282 Ga0439450_000102 3300042008 Bacteria 8623
283 Ga0439463_001393 3300042016 Bacteria 6428
284 Ga0439464_0005057 3300042439 Bacteria 3392
285 Ga0439460_0001170 3300042461 Bacteria 6157
286 Ga0439440_0001759 3300042993 Bacteria 3993
287 Ga0466965_0000011 3300044683 Bacteria 107319
288 Ga0466961_0026662 3300044693 Bacteria 3715
289 Ga0466963_0075898 3300044694 Bacteria 2269
290 Ga0466958_0076449 3300045836 Bacteria 2055
291 Ga0466967_0109784 3300045976 Bacteria 2533
292 Ga0495592_0292385 3300046454 Bacteria 1062
293 Ga0495651_0005694 3300046462 Bacteria 9495
294 Ga0495653_0050072 3300046463 Bacteria 3214
295 Ga0495608_0109944 3300046511 Bacteria 1772
296 Ga0495610_0125615 3300046512 Bacteria 1119
297 Ga0495645_0152051 3300046543 Bacteria 1607
298 Ga0495667_0000038 3300046559 Bacteria 131349
299 Ga0495667_0011435 3300046559 Bacteria 6006
300 Ga0495657_0011500 3300046675 Bacteria 6615
301 Ga0495599_0182324 3300046678 Bacteria 1294
302 Ga0495600_0016607 3300046809 Bacteria 4676
303 Ga0495604_0030162 3300047317 Bacteria 4310
304 Ga0495672_0050259 3300047320 Bacteria 2463
305 Ga0495680_0057724 3300047322 Bacteria 3000
306 Ga0495680_0180118 3300047322 Bacteria 1526
307 Ga0495675_0054175 3300047444 Bacteria 2546
308 Ga0495686_0027464 3300047472 Bacteria 3716
309 Ga0495602_0094730 3300048088 Bacteria 2467
310 Ga0496100_0177806 3300048903 Bacteria 1537
311 Ga0496101_0038317 3300048904 Bacteria 3404
312 Ga0496101_0063830 3300048904 Bacteria 2682
313 Ga0496101_0151327 3300048904 Bacteria 1775
314 Ga0496102_0232067 3300048905 Bacteria 1740
315 Ga0496102_0386224 3300048905 Bacteria 1317
316 Ga0496104_0015518 3300048907 Bacteria 6900
317 Ga0496105_0094339 3300048908 Bacteria 2471
318 Ga0496106_0339460 3300048909 Bacteria 1206
319 Ga0496107_0027390 3300048910 Bacteria 4047
320 Ga0496108_0008807 3300048911 Bacteria 8179
321 Ga0496108_0013267 3300048911 Bacteria 6716
322 Ga0496108_0209230 3300048911 Bacteria 1693
323 Ga0496108_0285830 3300048911 Bacteria 1436
324 Ga0496109_0014549 3300048912 Bacteria 6845
325 Ga0496109_0187555 3300048912 Bacteria 1943
326 Ga0496110_0022374 3300048913 Bacteria 5367
327 Ga0496110_0022785 3300048913 Bacteria 5322
328 Ga0496110_0107834 3300048913 Bacteria 2500
329 Ga0496110_0470158 3300048913 Bacteria 1145
330 Ga0496112_0001298 3300048915 Bacteria 18986
331 Ga0496112_0022626 3300048915 Bacteria 5992
332 Ga0496112_0047242 3300048915 Bacteria 4223
333 Ga0496113_0000005 3300048916 Bacteria 105956
334 Ga0496113_0012392 3300048916 Bacteria 5729
335 Ga0496113_0417538 3300048916 Bacteria 1078
336 Ga0496114_0004863 3300048917 Bacteria 10465
337 Ga0496114_0005323 3300048917 Bacteria 10055
338 Ga0496114_0056187 3300048917 Bacteria 3284
339 Ga0496114_0194578 3300048917 Bacteria 1775
340 Ga0496117_0032919 3300048920 Bacteria 3929
341 Ga0496118_0002693 3300048921 Bacteria 23403
342 Ga0496118_0039780 3300048921 Bacteria 3747
343 Ga0496121_0167138 3300048924 Bacteria 1602
344 Ga0496125_0040136 3300048928 Bacteria 4019
345 Ga0496126_0004897 3300048929 Bacteria 15649
346 Ga0496126_0216570 3300048929 Bacteria 1610
347 Ga0501031_0008308 3300049568 Bacteria 6752
348 Ga0501031_0057883 3300049568 Bacteria 2525
349 Ga0501031_0096717 3300049568 Bacteria 1927
350 Ga0501032_0004371 3300049569 Bacteria 10664
351 Ga0501032_0054707 3300049569 Bacteria 2686
352 Ga0501033_0080413 3300049570 Bacteria 2391
353 Ga0501033_0175327 3300049570 Bacteria 1539
354 Ga0501034_0003237 3300049571 Bacteria 18617
355 Ga0501034_0233744 3300049571 Bacteria 1786
356 Ga0501034_0312504 3300049571 Bacteria 1505
357 Ga0501036_0013793 3300049572 Bacteria 6722
358 Ga0501036_0108970 3300049572 Bacteria 2341
359 Ga0501036_0269038 3300049572 Bacteria 1427
360 Ga0501037_0016735 3300049573 Bacteria 5395
361 Ga0501037_0108837 3300049573 Bacteria 1997
362 Ga0501038_0042830 3300049574 Bacteria 3941
363 Ga0501038_0052692 3300049574 Bacteria 3507
364 Ga0501040_0005712 3300049576 Bacteria 8048
365 Ga0501040_0037620 3300049576 Bacteria 3288
366 Ga0501040_0231292 3300049576 Bacteria 1316
367 Ga0501041_0116714 3300049577 Bacteria 1657
368 Ga0501042_0024553 3300049578 Bacteria 4229
369 Ga0501042_0101354 3300049578 Bacteria 2070
370 Ga0501043_0011646 3300049579 Bacteria 6884
371 Ga0501043_0013975 3300049579 Bacteria 6282
372 Ga0501043_0021854 3300049579 Bacteria 5017
373 Ga0501043_0147127 3300049579 Bacteria 1844
374 Ga0501048_0012311 3300049582 Bacteria 6366
375 Ga0501048_0045982 3300049582 Bacteria 3116
376 Ga0501048_0113313 3300049582 Bacteria 1916
377 Ga0501068_0006401 3300049584 Bacteria 6490
378 Ga0501070_0001370 3300049586 Bacteria 21785
379 Ga0501070_0019981 3300049586 Bacteria 5616
380 Ga0501070_0135131 3300049586 Bacteria 2036
381 Ga0501070_0166423 3300049586 Bacteria 1817
382 Ga0501071_0001822 3300049587 Bacteria 12626
383 Ga0501072_0026552 3300049588 Bacteria 4515
384 Ga0501072_0036909 3300049588 Bacteria 3833
385 Ga0501072_0062344 3300049588 Bacteria 2941
386 Ga0501072_0119123 3300049588 Bacteria 2103
387 Ga0501073_0127173 3300049589 Bacteria 1766
388 Ga0501073_0263834 3300049589 Bacteria 1188
389 Ga0501074_0043628 3300049590 Bacteria 3246
390 Ga0501074_0176942 3300049590 Bacteria 1522
391 Ga0501074_0263384 3300049590 Bacteria 1225
392 Ga0501075_0009320 3300049591 Bacteria 6869
393 Ga0501075_0010211 3300049591 Bacteria 6594
394 Ga0501075_0062536 3300049591 Bacteria 2806
395 Ga0501076_0004007 3300049592 Bacteria 10408
396 Ga0501076_0057377 3300049592 Bacteria 3091
397 Ga0501077_0010284 3300049593 Bacteria 5824
398 Ga0501077_0020656 3300049593 Bacteria 4169
399 Ga0501077_0062892 3300049593 Bacteria 2354
400 Ga0501079_0014887 3300049741 Bacteria 5929
401 Ga0501079_0038961 3300049741 Bacteria 3665
402 Ga0501080_0000056 3300049742 Bacteria 72834
403 Ga0501080_0027767 3300049742 Bacteria 5262
404 Ga0501080_0341414 3300049742 Bacteria 1353
405 Ga0501081_0007958 3300049743 Bacteria 6876
406 Ga0501081_0010230 3300049743 Bacteria 6123
407 Ga0501081_0011089 3300049743 Bacteria 5894
408 Ga0501083_0014853 3300049744 Bacteria 5446
409 Ga0501083_0126947 3300049744 Bacteria 1672
410 Ga0501035_0044711 3300049822 Bacteria 3986
411 Ga0501035_0145580 3300049822 Bacteria 2058
412 Ga0501044_0256921 3300049823 Bacteria 1686
413 Ga0501045_0009180 3300049824 Bacteria 6909
414 Ga0501045_0010967 3300049824 Bacteria 6347
415 Ga0501045_0070406 3300049824 Bacteria 2573
416 Ga0501045_0204753 3300049824 Bacteria 1470
417 nmdc:mga0yw44_104361_c1 3300050492 Bacteria 1809
418 nmdc:mga0yw44_30152_c1 3300050492 Bacteria 3139
419 nmdc:mga05p37_125645_c1 3300050507 Bacteria 3150
420 nmdc:mga05p37_662221_c1 3300050507 Bacteria 1167
421 nmdc:mga09592_10713_c1 3300050508 Bacteria 7463
422 nmdc:mga09592_12330_c1 3300050508 Bacteria 6962
423 nmdc:mga09592_21712_c1 3300050508 Bacteria 5292
424 nmdc:mga0qj67_217_c1 3300050509 Bacteria 39240
425 nmdc:mga06r32_11755_c1 3300050510 Bacteria 7882
426 nmdc:mga06r32_175317_c1 3300050510 Bacteria 2128
427 nmdc:mga06r32_445838_c1 3300050510 Bacteria 1274
428 nmdc:mga06r32_663_c1 3300050510 Bacteria 29946
429 nmdc:mga08y16_10571_c1 3300050511 Bacteria 9688
430 nmdc:mga08y16_354495_c1 3300050511 Bacteria 1507
431 nmdc:mga08y16_39028_c1 3300050511 Bacteria 4984
432 nmdc:mga08x19_14775_c1 3300050514 Bacteria 4742
433 nmdc:mga0a205_234276_c1 3300050515 Bacteria 1718
434 Ga0495595_0014378 3300053084 Bacteria 3357
435 Ga0495619_0000088 3300053085 Bacteria 69615
436 Ga0500595_012984 3300053119 Bacteria 3201
437 Ga0500658_0053207 3300053134 Bacteria 1660
438 Ga0500568_0003548 3300053139 Bacteria 8633
439 Ga0500568_0003588 3300053139 Bacteria 8572
440 Ga0500568_0004703 3300053139 Bacteria 7245
441 Ga0500616_0000151 3300053153 Bacteria 116796
442 Ga0500616_0001517 3300053153 Bacteria 21901
443 Ga0501084_0000104 3300054114 Bacteria 62893
444 Ga0501084_0044495 3300054114 Bacteria 3716
445 Ga0501084_0082224 3300054114 Bacteria 2702
446 Ga0501082_0008395 3300060353 Bacteria 8909
447 Ga0501082_0037333 3300060353 Bacteria 4187
448 Ga0501082_0065058 3300060353 Bacteria 3140
449 Ga0530510_0013739 3300061734 Bacteria 5699
450 Ga0530510_0024446 3300061734 Bacteria 4310
451 Ga0530510_0037338 3300061734 Bacteria 3502
452 Ga0530510_0069400 3300061734 Bacteria 2557
453 2809028160 2808606394 Bacteria 6248540
454 2857738109 2857737099 Bacteria 3104305
455 Ga0070707_100004177
456 JGI24743J22301_10002073
457 JGI24738J21930_10007689
458 JGI25407J50210_10016703
459 Ga0070658_10060869
460 Ga0070683_100027732
461 Ga0070683_100112232
462 Ga0070683_100199838
463 Ga0070690_100039161
464 Ga0070670_100084533
465 Ga0068869_100043803
466 Ga0070680_100100769
467 Ga0070680_100140003
468 Ga0070682_100000026
469 Ga0070682_100040946
470 Ga0070682_100044622
471 Ga0068868_100024062
472 Ga0070660_100010492
473 Ga0070660_100044189
474 Ga0070660_100255679
475 Ga0070689_100015926
476 Ga0070689_100110005
477 Ga0070691_10016718
478 Ga0070661_100048667
479 Ga0070661_100187239
480 Ga0070692_10006300
481 Ga0070668_100003538
482 Ga0070675_100077658
483 Ga0070675_100087078
484 Ga0070675_100159127
485 Ga0070671_100015451
486 Ga0070671_100022183
487 Ga0070674_100012058
488 Ga0070673_100016100
489 Ga0070688_100001975
490 Ga0070659_100025815
491 Ga0070659_100052030
492 Ga0070667_100286204
493 Ga0070709_10015386
494 Ga0070709_10016934
495 Ga0070701_10072506
496 Ga0070700_100101299
497 Ga0070700_100120151
498 Ga0070708_100014875
499 Ga0070708_100136156
500 Ga0070708_100200128
501 Ga0070663_100019615
502 Ga0070663_100073687
503 Ga0070678_100015299
504 Ga0070678_100081720
505 Ga0070662_100034134
506 Ga0070662_100060614
507 Ga0070681_10057213
508 Ga0070681_10146752
509 Ga0068867_100100746
510 Ga0070685_10018642
511 Ga0070706_100009402
512 Ga0070706_100011077
513 Ga0070706_100028025
514 Ga0070706_100044100
515 Ga0070707_100018775
516 Ga0070707_100060676
517 Ga0070707_100166808
518 Ga0070698_100054998
519 Ga0070698_100078532
520 Ga0070698_100329106
521 Ga0070699_100314900
522 Ga0070679_100182975
523 Ga0070679_100253362
524 Ga0070684_100041522
525 Ga0070684_100159311
526 Ga0068853_100021929
527 Ga0068853_100317441
528 Ga0070672_100059653
529 Ga0070686_100010299
530 Ga0070695_100063588
531 Ga0070693_100038753
532 Ga0070665_100084556
533 Ga0068855_100118735
534 Ga0068855_100273801
535 Ga0070664_100127073
536 Ga0070664_100139610
537 Ga0068857_100004671
538 Ga0068854_100000082
539 Ga0068854_100030811
540 Ga0068854_100084357
541 Ga0068854_100085914
542 Ga0070702_100115900
543 Ga0068852_100205526
544 Ga0068859_100229136
545 Ga0068866_10067288
546 Ga0068866_10080681
547 Ga0068861_100293881
548 Ga0068851_10040146
549 Ga0068870_10202043
550 Ga0068858_100015291
551 Ga0068858_100036468
552 Ga0068858_100053436
553 Ga0068860_100140688
554 Ga0068862_100001142
555 Ga0081455_10002376
556 Ga0081455_10005042
557 Ga0081455_10011122
558 Ga0081538_10000105
559 Ga0081538_10006122
560 Ga0081538_10013679
561 Ga0081538_10037636
562 Ga0081538_10039860
563 Ga0081539_10038494
564 Ga0070717_10148635
565 Ga0075365_10004563
566 Ga0075365_10032753
567 Ga0075365_10079480
568 Ga0075363_100009449
569 Ga0075364_10046718
570 Ga0075364_10141866
571 Ga0075362_10124556
572 Ga0068871_100117013
573 Ga0068871_100265361
574 Ga0075428_100028377
575 Ga0075428_100081073
576 Ga0075428_100438503
577 Ga0075430_100006829
578 Ga0075430_100015802
579 Ga0075431_100000056
580 Ga0075431_100011012
581 Ga0075434_100000356
582 Ga0075429_100005701
583 Ga0068865_100056787
584 Ga0075436_100006747
585 Ga0097620_100229135
586 Ga0105240_10543334
587 Ga0111539_10000449
588 Ga0111539_10017044
589 Ga0111539_10226151
590 Ga0105245_10010835
591 Ga0105245_10015151
592 Ga0105245_10187064
593 Ga0114129_10023233
594 Ga0114129_10074343
595 Ga0114129_10240984
596 Ga0105243_10032278
597 Ga0105243_10057881
598 Ga0105243_10072936
599 Ga0105241_10377633
600 Ga0105242_10017399
601 Ga0105242_10054296
602 Ga0105242_10243097
603 Ga0105238_10058177
604 Ga0105238_10499883
605 Ga0105249_10011399
606 Ga0105249_10079542
607 Ga0105249_10260326
608 Ga0105249_10401936
609 Ga0105249_10424915
610 Ga0105239_10124153
611 Ga0105239_10201435
612 Ga0105239_10777474
613 Ga0105246_10205460
614 Ga0157373_10189268
615 Ga0157371_10058092
616 Ga0157369_10295292
617 Ga0157374_10047926
618 Ga0157378_10031394
619 Ga0157378_10169152
620 Ga0157378_10329390
621 Ga0163162_10437071
622 Ga0163162_10930691
623 Ga0157372_10149462
624 Ga0157380_10032839
625 Ga0157377_10055890
626 Ga0157377_10068675
627 Ga0157379_10019221
628 Ga0157379_10035466
629 Ga0206353_10842230
630 Ga0207656_10018733
631 Ga0207682_10009047
632 Ga0207642_10121463
633 Ga0207688_10043807
634 Ga0207688_10050275
635 Ga0207688_10239190
636 Ga0207647_10056000
637 Ga0207699_10178366
638 Ga0207645_10126115
639 Ga0207684_10126869
640 Ga0207707_10143129
641 Ga0207695_10400864
642 Ga0207660_10111470
643 Ga0207662_10028999
644 Ga0207657_10006124
645 Ga0207649_10042792
646 Ga0207649_10259685
647 Ga0207652_10349060
648 Ga0207646_10008785
649 Ga0207681_10229632
650 Ga0207659_10060913
651 Ga0207659_10385670
652 Ga0207687_10067672
653 Ga0207687_10202430
654 Ga0207664_10343621
655 Ga0207644_10017944
656 Ga0207644_10335360
657 Ga0207690_10010789
658 Ga0207690_10496902
659 Ga0207706_10015361
660 Ga0207706_10022030
661 Ga0207706_10114478
662 Ga0207706_10271785
663 Ga0207686_10044923
664 Ga0207686_10112568
665 Ga0207709_10035394
666 Ga0207670_10158857
667 Ga0207670_10181180
668 Ga0207669_10054128
669 Ga0207704_10113350
670 Ga0207704_10232604
671 Ga0207704_10397815
672 Ga0207691_10068837
673 Ga0207691_10089799
674 Ga0207691_10143766
675 Ga0207711_10133998
676 Ga0207689_10064480
677 Ga0207661_10039621
678 Ga0207661_10093744
679 Ga0207679_10112977
680 Ga0207667_10107924
681 Ga0207712_10006637
682 Ga0207712_10213946
683 Ga0207668_10004720
684 Ga0207640_10045752
685 Ga0207640_10295970
686 Ga0207658_10001121
687 Ga0207658_10387882
688 Ga0207677_10064176
689 Ga0207703_10029846
690 Ga0207639_10336192
691 Ga0207678_10070491
692 Ga0207678_10158302
693 Ga0207708_10035451
694 Ga0207708_10167187
695 Ga0207641_10243443
696 Ga0207641_10407842
697 Ga0207648_10001336
698 Ga0207648_10045253
699 Ga0207676_10187137
700 Ga0207674_10003204
701 Ga0207675_100016689
702 Ga0207675_100245959
703 Ga0207675_100308164
704 Ga0207683_10021406
705 Ga0207683_10149314
706 Ga0207698_10052395
707 Ga0207698_10184626
708 Ga0207428_10005428
709 Ga0207428_10199232
710 Ga0268265_10015269
711 Ga0316576_10012576
712 Ga0316578_10012226
713 Ga0316577_10032465
714 Ga0307410_10004681
715 Ga0307416_100261983
716 Ga0307414_10566997
717 Ga0316586_1001030
718 Ga0316587_1011710
719 Ga0373954_0150642
720 Ga0316574_0071619
721 Ga0316574_0091003
722 Ga0373927_0014962
723 Ga0373937_0128490
724 Ga0373925_0006749
725 Ga0316581_0028614
726 Ga0400485_05720
727 Ga0400483_023354
728 Ga0400483_031601
729 Ga0400483_079531
730 Ga0400483_092270
731 Ga0400483_230433
732 Ga0436365_1777696
733 Ga0436361_0072893
734 Ga0436362_0242738
735 Ga0439448_0003212
736 Ga0439450_000102
737 Ga0439463_001393
738 Ga0439464_0005057
739 Ga0439460_0001170
740 Ga0439440_0001759
741 Ga0466965_0000011
742 Ga0466961_0026662
743 Ga0466963_0075898
744 Ga0466958_0076449
745 Ga0466967_0109784
746 Ga0495592_0292385
747 Ga0495651_0005694
748 Ga0495653_0050072
749 Ga0495608_0109944
750 Ga0495610_0125615
751 Ga0495645_0152051
752 Ga0495667_0000038
753 Ga0495667_0011435
754 Ga0495657_0011500
755 Ga0495599_0182324
756 Ga0495600_0016607
757 Ga0495604_0030162
758 Ga0495672_0050259
759 Ga0495680_0057724
760 Ga0495680_0180118
761 Ga0495675_0054175
762 Ga0495686_0027464
763 Ga0495602_0094730
764 Ga0496100_0177806
765 Ga0496101_0038317
766 Ga0496101_0063830
767 Ga0496101_0151327
768 Ga0496102_0232067
769 Ga0496102_0386224
770 Ga0496104_0015518
771 Ga0496105_0094339
772 Ga0496106_0339460
773 Ga0496107_0027390
774 Ga0496108_0008807
775 Ga0496108_0013267
776 Ga0496108_0209230
777 Ga0496108_0285830
778 Ga0496109_0014549
779 Ga0496109_0187555
780 Ga0496110_0022374
781 Ga0496110_0022785
782 Ga0496110_0107834
783 Ga0496110_0470158
784 Ga0496112_0001298
785 Ga0496112_0022626
786 Ga0496112_0047242
787 Ga0496113_0000005
788 Ga0496113_0012392
789 Ga0496113_0417538
790 Ga0496114_0004863
791 Ga0496114_0005323
792 Ga0496114_0056187
793 Ga0496114_0194578
794 Ga0496117_0032919
795 Ga0496118_0002693
796 Ga0496118_0039780
797 Ga0496121_0167138
798 Ga0496125_0040136
799 Ga0496126_0004897
800 Ga0496126_0216570
801 Ga0501031_0008308
802 Ga0501031_0057883
803 Ga0501031_0096717
804 Ga0501032_0004371
805 Ga0501032_0054707
806 Ga0501033_0080413
807 Ga0501033_0175327
808 Ga0501034_0003237
809 Ga0501034_0233744
810 Ga0501034_0312504
811 Ga0501036_0013793
812 Ga0501036_0108970
813 Ga0501036_0269038
814 Ga0501037_0016735
815 Ga0501037_0108837
816 Ga0501038_0042830
817 Ga0501038_0052692
818 Ga0501040_0005712
819 Ga0501040_0037620
820 Ga0501040_0231292
821 Ga0501041_0116714
822 Ga0501042_0024553
823 Ga0501042_0101354
824 Ga0501043_0011646
825 Ga0501043_0013975
826 Ga0501043_0021854
827 Ga0501043_0147127
828 Ga0501048_0012311
829 Ga0501048_0045982
830 Ga0501048_0113313
831 Ga0501068_0006401
832 Ga0501070_0001370
833 Ga0501070_0019981
834 Ga0501070_0135131
835 Ga0501070_0166423
836 Ga0501071_0001822
837 Ga0501072_0026552
838 Ga0501072_0036909
839 Ga0501072_0062344
840 Ga0501072_0119123
841 Ga0501073_0127173
842 Ga0501073_0263834
843 Ga0501074_0043628
844 Ga0501074_0176942
845 Ga0501074_0263384
846 Ga0501075_0009320
847 Ga0501075_0010211
848 Ga0501075_0062536
849 Ga0501076_0004007
850 Ga0501076_0057377
851 Ga0501077_0010284
852 Ga0501077_0020656
853 Ga0501077_0062892
854 Ga0501079_0014887
855 Ga0501079_0038961
856 Ga0501080_0000056
857 Ga0501080_0027767
858 Ga0501080_0341414
859 Ga0501081_0007958
860 Ga0501081_0010230
861 Ga0501081_0011089
862 Ga0501083_0014853
863 Ga0501083_0126947
864 Ga0501035_0044711
865 Ga0501035_0145580
866 Ga0501044_0256921
867 Ga0501045_0009180
868 Ga0501045_0010967
869 Ga0501045_0070406
870 Ga0501045_0204753
871 nmdc:mga0yw44_104361_c1
872 nmdc:mga0yw44_30152_c1
873 nmdc:mga05p37_125645_c1
874 nmdc:mga05p37_662221_c1
875 nmdc:mga09592_10713_c1
876 nmdc:mga09592_12330_c1
877 nmdc:mga09592_21712_c1
878 nmdc:mga0qj67_217_c1
879 nmdc:mga06r32_11755_c1
880 nmdc:mga06r32_175317_c1
881 nmdc:mga06r32_445838_c1
882 nmdc:mga06r32_663_c1
883 nmdc:mga08y16_10571_c1
884 nmdc:mga08y16_354495_c1
885 nmdc:mga08y16_39028_c1
886 nmdc:mga08x19_14775_c1
887 nmdc:mga0a205_234276_c1
888 Ga0495595_0014378
889 Ga0495619_0000088
890 Ga0500595_012984
891 Ga0500658_0053207
892 Ga0500568_0003548
893 Ga0500568_0003588
894 Ga0500568_0004703
895 Ga0500616_0000151
896 Ga0500616_0001517
897 Ga0501084_0000104
898 Ga0501084_0044495
899 Ga0501084_0082224
900 Ga0501082_0008395
901 Ga0501082_0037333
902 Ga0501082_0065058
903 Ga0530510_0013739
904 Ga0530510_0024446
905 Ga0530510_0037338
906 Ga0530510_0069400
907 2809028160
908 2857738109

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

57

201

0.98

PF13732

DUF4162

Domain of unknown function (DUF4162)

255

343

0.87

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

112

235

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
8eop-assembly1.cif.gz_A cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state 0.9316 1 220
7ahd-assembly1.cif.gz_D opua (e190q) occluded 0.9296 6 217
6xgz-assembly3.cif.gz_E crystal structure of e. coli mlafb abc transport subunits in the monomeric state 0.9245 1 218
7v8i-assembly1.cif.gz_F lolcd(e171q)e with bound amppnp in nanodiscs 0.9244 4 213
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9239 6 219
ID Description Score Start End Superfamily
af_O86311_2_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9561 4 220 3.40.50.300
af_Q0E8Q7_1247_1483_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9483 4 221 3.40.50.300
af_O33189_10_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9463 2 221 3.40.50.300
af_Q9VRG3_1356_1574_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9436 2 212 3.40.50.300
af_Q9TXV8_581_832_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9431 4 220 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A328VDH5-F1-model_v4 ABC transporter domain-containing protein 0.9553 4 213 GO:0005524
GO:0016887
AF-A0A7X7K1P0-F1-model_v4 ABC transporter ATP-binding protein 0.9545 4 221 GO:0005524
GO:0016887
AF-A0A520NVZ7-F1-model_v4 ABC transporter ATP-binding protein 0.9542 1 220 GO:0005524
GO:0016887
AF-A0A4Q3AX05-F1-model_v4 ATP-binding cassette domain-containing protein 0.9536 4 206 GO:0005524
GO:0016887
AF-D9SS60-F1-model_v4 ABC transporter related 0.95 4 220 GO:0005524
GO:0016887

Map