F447348

General Info

Members Datasets Scaffolds Average Seq Length
454 204 436 195

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100295609|Ga0068856_1002956092
Length 214
Sequence VGFVAQADAPAATVECVTQRPHHRPLTPGDRFFSGLDSGDDPVLLAEAADRAAELLVRGARASGDDQVAERVLHLADTEGIEVIAQAWAHRPADSVAGCLWRLYLLRSWVYADPVGVAREFDAGRRQAAVDDVVAGVADPPGPDELRDMVDQVLRGIAVGDFADVLLRAAAFARVVATGRALLADTDALAAARIQSVAEQLGRAARLELAGELT

Samples

Sample ID Description Type Environment
1 2643221561 Nocardioides sp. Root151 Isolate Unclassified
2 2643221576 Nocardioides sp. Root614 Isolate Unclassified
3 2643221590 Nocardioides sp. Root682 Isolate Unclassified
4 2643221604 Nocardioides sp. Root190 Isolate Unclassified
5 2643221617 Nocardioides sp. Root79 Isolate Unclassified
6 2643221620 Nocardioides sp. Root240 Isolate Unclassified
7 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
8 2643221696 Nocardioides sp. Root140 Isolate Unclassified
9 2738541305 Nocardioides sp. CF167 Isolate Unclassified
10 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
11 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
12 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
13 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
14 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
15 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
16 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
17 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
18 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
19 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
20 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
21 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
120 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
121 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
124 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
125 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
126 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
127 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
128 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
129 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
130 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
131 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
132 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
137 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
138 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
139 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
144 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
145 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
146 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
149 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
150 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
151 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
152 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
153 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
154 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
155 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
156 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
157 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
178 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
185 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
192 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
195 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
196 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
197 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
198 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
201 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
202 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
203 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.37
Metatranscriptomes 0.66
Isolates 3.96

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 9.91
Nodule 0
Rhizoplane 9.69
Rhizosphere 75.33
Stem 0
Stem Tuber 0
Unclassified 4.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1006953 3300000549 Bacteria 1397
2 rootH1_10079093 3300003323 Bacteria 1780
3 Ga0006562J51391_1037182 3300003578 Bacteria 2869
4 Ga0070683_100001398 3300005329 Bacteria 18519
5 Ga0070683_100150793 3300005329 Bacteria 2204
6 Ga0068869_100435849 3300005334 Bacteria 1084
7 Ga0070666_10236497 3300005335 Bacteria 1291
8 Ga0070680_100314985 3300005336 Bacteria 1328
9 Ga0070682_100018966 3300005337 Bacteria 4029
10 Ga0070660_100058030 3300005339 Bacteria 3000
11 Ga0070660_100066788 3300005339 Bacteria 2801
12 Ga0070691_10384559 3300005341 Bacteria 787
13 Ga0070687_100068695 3300005343 Bacteria 1895
14 Ga0070661_100631715 3300005344 Bacteria 868
15 Ga0070692_10155485 3300005345 Bacteria 1306
16 Ga0070675_100155199 3300005354 Bacteria 1965
17 Ga0070659_100021202 3300005366 Bacteria 4943
18 Ga0070659_100647619 3300005366 Bacteria 911
19 Ga0070667_100062525 3300005367 Bacteria 3154
20 Ga0070701_10374024 3300005438 Bacteria 896
21 Ga0070678_101082663 3300005456 Bacteria 740
22 Ga0068867_100366674 3300005459 Bacteria 1206
23 Ga0070685_10071066 3300005466 Bacteria 2062
24 Ga0070698_100090068 3300005471 Bacteria 3051
25 Ga0070679_100079275 3300005530 Bacteria 3274
26 Ga0070679_100393636 3300005530 Bacteria 1332
27 Ga0070684_100000859 3300005535 Bacteria 21453
28 Ga0070684_100060898 3300005535 Bacteria 3303
29 Ga0070684_100162741 3300005535 Bacteria 2025
30 Ga0068853_100289074 3300005539 Bacteria 1513
31 Ga0070696_100087805 3300005546 Bacteria 2209
32 Ga0070693_100557956 3300005547 Bacteria 821
33 Ga0070665_100000606 3300005548 Bacteria 49390
34 Ga0070665_100090593 3300005548 Bacteria 3064
35 Ga0068855_100065608 3300005563 Bacteria 4232
36 Ga0070664_100080676 3300005564 Bacteria 2803
37 Ga0068857_100016723 3300005577 Bacteria 6426
38 Ga0068857_100552718 3300005577 Bacteria 1085
39 Ga0068856_100295609 3300005614 Bacteria 1637
40 Ga0068861_100127866 3300005719 Bacteria 2058
41 Ga0068858_100218406 3300005842 Bacteria 1805
42 Ga0068862_100869884 3300005844 Bacteria 884
43 Ga0075365_10000585 3300006038 Bacteria 14182
44 Ga0075365_10009628 3300006038 Bacteria 5573
45 Ga0075365_10041611 3300006038 Bacteria 3003
46 Ga0075365_10059655 3300006038 Bacteria 2544
47 Ga0075365_10076826 3300006038 Bacteria 2255
48 Ga0075365_10148386 3300006038 Bacteria 1631
49 Ga0075365_10216784 3300006038 Bacteria 1342
50 Ga0075365_10289095 3300006038 Bacteria 1153
51 Ga0075365_10347188 3300006038 Bacteria 1046
52 Ga0075365_10418030 3300006038 Bacteria 947
53 Ga0075368_10000529 3300006042 Bacteria 11406
54 Ga0075363_100003967 3300006048 Bacteria 6396
55 Ga0075363_100020254 3300006048 Bacteria 3334
56 Ga0075363_100072516 3300006048 Bacteria 1872
57 Ga0075363_100142922 3300006048 Bacteria 1348
58 Ga0075364_10005556 3300006051 Bacteria 7346
59 Ga0075364_10011323 3300006051 Bacteria 5418
60 Ga0075364_10017885 3300006051 Bacteria 4432
61 Ga0075364_10422668 3300006051 Bacteria 910
62 Ga0075362_10006603 3300006177 Bacteria 4331
63 Ga0075367_10027230 3300006178 Bacteria 3250
64 Ga0075370_10012087 3300006353 Bacteria 4554
65 Ga0075370_10018994 3300006353 Bacteria 3734
66 Ga0075370_10019446 3300006353 Bacteria 3699
67 Ga0075370_10231331 3300006353 Bacteria 1094
68 Ga0068865_100310604 3300006881 Bacteria 1265
69 Ga0105245_10007388 3300009098 Bacteria 9622
70 Ga0105243_10112119 3300009148 Bacteria 2284
71 Ga0105243_10460799 3300009148 Bacteria 1195
72 Ga0105243_10873339 3300009148 Bacteria 892
73 Ga0105242_10100001 3300009176 Bacteria 2455
74 Ga0105242_10669683 3300009176 Bacteria 1011
75 Ga0105238_10869715 3300009551 Bacteria 919
76 Ga0105249_10041826 3300009553 Bacteria 4167
77 Ga0105239_10003082 3300010375 Bacteria 20711
78 Ga0105246_10015819 3300011119 Bacteria 4770
79 Ga0157371_10346984 3300013102 Bacteria 1080
80 Ga0157369_10099679 3300013105 Bacteria 3097
81 Ga0163162_10359137 3300013306 Bacteria 1590
82 Ga0157372_10172091 3300013307 Bacteria 2506
83 Ga0157372_10284479 3300013307 Bacteria 1923
84 Ga0157372_10322149 3300013307 Bacteria 1800
85 Ga0157372_10791530 3300013307 Bacteria 1102
86 Ga0157375_10006488 3300013308 Bacteria 10188
87 Ga0157375_10030975 3300013308 Bacteria 5050
88 Ga0157375_10255263 3300013308 Bacteria 1915
89 Ga0163163_10356366 3300014325 Bacteria 1519
90 Ga0157380_10040592 3300014326 Bacteria 3625
91 Ga0182008_10016958 3300014497 Bacteria 3778
92 Ga0182008_10073303 3300014497 Bacteria 1685
93 Ga0182008_10155961 3300014497 Bacteria 1147
94 Ga0157377_10482712 3300014745 Bacteria 862
95 Ga0157379_10053443 3300014968 Bacteria 3608
96 Ga0157376_10483926 3300014969 Bacteria 1213
97 Ga0206353_10862183 3300020082 Bacteria 931
98 Ga0206353_11006745 3300020082 Bacteria 1097
99 Ga0207688_10018470 3300025901 Bacteria 3794
100 Ga0207647_10276605 3300025904 Bacteria 959
101 Ga0207705_10151914 3300025909 Bacteria 1735
102 Ga0207660_10043589 3300025917 Bacteria 3153
103 Ga0207662_10086714 3300025918 Bacteria 1919
104 Ga0207657_10021029 3300025919 Bacteria 6152
105 Ga0207649_10302480 3300025920 Bacteria 1170
106 Ga0207652_10311106 3300025921 Bacteria 1422
107 Ga0207646_10331476 3300025922 Bacteria 1375
108 Ga0207659_10180006 3300025926 Bacteria 1674
109 Ga0207687_10018606 3300025927 Bacteria 4589
110 Ga0207690_10021748 3300025932 Bacteria 3982
111 Ga0207686_10123430 3300025934 Bacteria 1766
112 Ga0207709_10122140 3300025935 Bacteria 1760
113 Ga0207709_10140965 3300025935 Bacteria 1657
114 Ga0207709_10871991 3300025935 Bacteria 730
115 Ga0207661_10066162 3300025944 Bacteria 2935
116 Ga0207679_10177849 3300025945 Bacteria 1757
117 Ga0207667_10040919 3300025949 Bacteria 4932
118 Ga0207712_10052873 3300025961 Bacteria 2847
119 Ga0207712_10227933 3300025961 Bacteria 1494
120 Ga0207677_10097972 3300026023 Bacteria 2150
121 Ga0207703_10384218 3300026035 Bacteria 1299
122 Ga0207639_10250576 3300026041 Bacteria 1544
123 Ga0207708_10053882 3300026075 Bacteria 3066
124 Ga0207702_10329534 3300026078 Bacteria 1456
125 Ga0207648_10324833 3300026089 Bacteria 1383
126 Ga0207648_10445255 3300026089 Bacteria 1179
127 Ga0207674_10009755 3300026116 Bacteria 10937
128 Ga0207675_100039727 3300026118 Bacteria 4392
129 Ga0268266_10480856 3300028379 Bacteria 1184
130 Ga0268264_10694835 3300028381 Bacteria 1010
131 Ga0307408_100493841 3300031548 Bacteria 1070
132 Ga0307408_100648287 3300031548 Bacteria 944
133 Ga0307405_10035201 3300031731 Bacteria 2988
134 Ga0307410_10215705 3300031852 Bacteria 1473
135 Ga0307410_10523018 3300031852 Bacteria 979
136 Ga0307406_10090163 3300031901 Bacteria 2062
137 Ga0307407_10004200 3300031903 Bacteria 6077
138 Ga0307407_10023889 3300031903 Bacteria 3196
139 Ga0307407_10117536 3300031903 Bacteria 1680
140 Ga0307407_10295811 3300031903 Bacteria 1127
141 Ga0307412_10025529 3300031911 Bacteria 3662
142 Ga0307412_10226114 3300031911 Bacteria 1438
143 Ga0307412_10293769 3300031911 Bacteria 1281
144 Ga0307412_10368948 3300031911 Bacteria 1158
145 Ga0307409_100027515 3300031995 Bacteria 4031
146 Ga0307409_100113280 3300031995 Bacteria 2279
147 Ga0307409_100767791 3300031995 Bacteria 969
148 Ga0307416_100000221 3300032002 Bacteria 30062
149 Ga0307416_100057771 3300032002 Bacteria 3141
150 Ga0307416_100885430 3300032002 Bacteria 992
151 Ga0307414_10279112 3300032004 Bacteria 1403
152 Ga0307414_10508222 3300032004 Bacteria 1067
153 Ga0307411_10037100 3300032005 Bacteria 3061
154 Ga0307415_100000455 3300032126 Bacteria 17595
155 Ga0307415_100037266 3300032126 Bacteria 3194
156 Ga0307415_100289899 3300032126 Bacteria 1350
157 Ga0395900_0064398 3300037418 Bacteria 3767
158 Ga0395898_0027410 3300037466 Bacteria 5721
159 Ga0395905_0043099 3300037471 Bacteria 4234
160 Ga0395901_0017796 3300038443 Bacteria 7252
161 Ga0395901_0408105 3300038443 Bacteria 1395
162 Ga0395901_0809360 3300038443 Bacteria 925
163 Ga0436365_1426711 3300039437 Bacteria 1495
164 Ga0451853_2760549 3300041512 Bacteria 653
165 Ga0439431_0004287 3300041997 Bacteria 3133
166 Ga0439442_028340 3300042002 Bacteria 1168
167 Ga0439445_0038138 3300042004 Bacteria 1270
168 Ga0439457_073183 3300042014 Bacteria 783
169 Ga0450907_035647 3300042146 Bacteria 849
170 Ga0439446_0061835 3300042156 Bacteria 1133
171 Ga0439434_0008883 3300042435 Bacteria 2952
172 Ga0466972_0036473 3300044658 Bacteria 2406
173 Ga0466965_0066504 3300044683 Bacteria 1807
174 Ga0466966_0015053 3300044684 Bacteria 5117
175 Ga0466966_0461933 3300044684 Bacteria 763
176 Ga0466961_0075179 3300044693 Bacteria 2142
177 Ga0466961_0590169 3300044693 Bacteria 668
178 Ga0466963_0064044 3300044694 Bacteria 2462
179 Ga0466963_0270564 3300044694 Bacteria 1193
180 Ga0466963_0299389 3300044694 Bacteria 1131
181 Ga0466963_0651903 3300044694 Bacteria 743
182 Ga0466964_0046740 3300044706 Bacteria 1765
183 Ga0466971_0098323 3300044719 Bacteria 1343
184 Ga0466970_0081097 3300044765 Bacteria 1754
185 Ga0466970_0104532 3300044765 Bacteria 1544
186 Ga0466970_0106063 3300044765 Bacteria 1532
187 Ga0466970_0111448 3300044765 Bacteria 1494
188 Ga0466970_0157760 3300044765 Bacteria 1254
189 Ga0466957_0016292 3300044842 Bacteria 4347
190 Ga0466957_0286014 3300044842 Bacteria 1105
191 Ga0466957_0313410 3300044842 Bacteria 1057
192 Ga0466957_0499411 3300044842 Bacteria 843
193 Ga0466957_0516524 3300044842 Bacteria 829
194 Ga0466957_0611754 3300044842 Bacteria 763
195 Ga0466960_0008532 3300044901 Bacteria 4198
196 Ga0466960_0019642 3300044901 Bacteria 2980
197 Ga0466960_0022272 3300044901 Bacteria 2831
198 Ga0466960_0045288 3300044901 Bacteria 2101
199 Ga0466960_0054268 3300044901 Bacteria 1945
200 Ga0466960_0057415 3300044901 Bacteria 1898
201 Ga0466960_0105249 3300044901 Bacteria 1458
202 Ga0466960_0337909 3300044901 Bacteria 856
203 Ga0466960_0567633 3300044901 Bacteria 671
204 Ga0466958_0177627 3300045836 Bacteria 1350
205 Ga0466967_0007617 3300045976 Bacteria 7832
206 Ga0466967_0010070 3300045976 Bacteria 7065
207 Ga0466967_0051375 3300045976 Bacteria 3612
208 Ga0466967_0084960 3300045976 Bacteria 2864
209 Ga0466967_0355747 3300045976 Bacteria 1418
210 Ga0466967_0442684 3300045976 Bacteria 1269
211 Ga0466967_0502100 3300045976 Bacteria 1190
212 Ga0495620_0084535 3300046515 Bacteria 1280
213 Ga0495680_0394335 3300047322 Bacteria 957
214 Ga0496101_0216965 3300048904 Bacteria 1484
215 Ga0496101_0249531 3300048904 Bacteria 1382
216 Ga0496101_0485557 3300048904 Bacteria 976
217 Ga0496101_0650474 3300048904 Bacteria 833
218 Ga0496101_0771450 3300048904 Bacteria 758
219 Ga0496101_0855560 3300048904 Bacteria 716
220 Ga0496102_0030321 3300048905 Bacteria 4840
221 Ga0496102_0034295 3300048905 Bacteria 4564
222 Ga0496102_0075289 3300048905 Bacteria 3103
223 Ga0496102_0124293 3300048905 Bacteria 2411
224 Ga0496102_0257324 3300048905 Bacteria 1646
225 Ga0496102_0701367 3300048905 Bacteria 935
226 Ga0496105_0001788 3300048908 Bacteria 15363
227 Ga0496105_0033894 3300048908 Bacteria 4197
228 Ga0496105_0561547 3300048908 Bacteria 890
229 Ga0496107_0177535 3300048910 Bacteria 1581
230 Ga0496108_0227951 3300048911 Bacteria 1619
231 Ga0496108_0384661 3300048911 Bacteria 1225
232 Ga0496108_0622409 3300048911 Bacteria 940
233 Ga0496109_0004367 3300048912 Bacteria 11813
234 Ga0496109_0035220 3300048912 Bacteria 4514
235 Ga0496109_0038345 3300048912 Bacteria 4332
236 Ga0496109_0090810 3300048912 Bacteria 2825
237 Ga0496109_0158604 3300048912 Bacteria 2119
238 Ga0496109_0474560 3300048912 Bacteria 1181
239 Ga0496110_0008067 3300048913 Bacteria 8453
240 Ga0496110_0323763 3300048913 Bacteria 1404
241 Ga0496111_0040905 3300048914 Bacteria 3325
242 Ga0496111_0540156 3300048914 Bacteria 856
243 Ga0496112_0670690 3300048915 Bacteria 966
244 Ga0496113_0104067 3300048916 Bacteria 2202
245 Ga0496113_0443066 3300048916 Bacteria 1043
246 Ga0496113_0802508 3300048916 Bacteria 748
247 Ga0496114_0004376 3300048917 Bacteria 10942
248 Ga0496114_0005642 3300048917 Bacteria 9814
249 Ga0496114_0019142 3300048917 Bacteria 5547
250 Ga0496114_0030973 3300048917 Bacteria 4401
251 Ga0496114_0240797 3300048917 Bacteria 1591
252 Ga0496114_0295941 3300048917 Bacteria 1429
253 Ga0496114_0672297 3300048917 Bacteria 909
254 Ga0496115_0024020 3300048918 Bacteria 4735
255 Ga0496115_0083090 3300048918 Bacteria 2610
256 Ga0496115_0119585 3300048918 Bacteria 2167
257 Ga0496115_0455376 3300048918 Bacteria 1033
258 Ga0496124_0353404 3300048927 Bacteria 1039
259 Ga0501031_0016385 3300049568 Bacteria 4813
260 Ga0501031_0055976 3300049568 Bacteria 2570
261 Ga0501031_0356484 3300049568 Bacteria 946
262 Ga0501031_0428066 3300049568 Bacteria 855
263 Ga0501032_0002003 3300049569 Bacteria 16055
264 Ga0501032_0472692 3300049569 Bacteria 802
265 Ga0501033_0003693 3300049570 Bacteria 12446
266 Ga0501033_0220042 3300049570 Bacteria 1352
267 Ga0501033_0348783 3300049570 Unclassified 1037
268 Ga0501034_0009129 3300049571 Bacteria 10410
269 Ga0501034_0010965 3300049571 Bacteria 9414
270 Ga0501034_0020880 3300049571 Bacteria 6685
271 Ga0501034_0027704 3300049571 Bacteria 5762
272 Ga0501034_0457627 3300049571 Bacteria 1193
273 Ga0501036_0010955 3300049572 Bacteria 7496
274 Ga0501036_0017866 3300049572 Bacteria 5937
275 Ga0501036_0030465 3300049572 Bacteria 4557
276 Ga0501036_0109558 3300049572 Bacteria 2333
277 Ga0501036_0117469 3300049572 Bacteria 2246
278 Ga0501036_0210499 3300049572 Bacteria 1634
279 Ga0501037_0005898 3300049573 Bacteria 8948
280 Ga0501037_0082058 3300049573 Bacteria 2337
281 Ga0501037_0087742 3300049573 Bacteria 2251
282 Ga0501037_0242375 3300049573 Bacteria 1263
283 Ga0501038_0002504 3300049574 Bacteria 17105
284 Ga0501038_0008339 3300049574 Bacteria 9536
285 Ga0501038_0029979 3300049574 Bacteria 4816
286 Ga0501038_0084029 3300049574 Bacteria 2679
287 Ga0501038_0109453 3300049574 Bacteria 2289
288 Ga0501038_0331733 3300049574 Bacteria 1188
289 Ga0501038_0439368 3300049574 Bacteria 1005
290 Ga0501039_0026214 3300049575 Bacteria 4480
291 Ga0501039_0070304 3300049575 Bacteria 2719
292 Ga0501039_0083527 3300049575 Bacteria 2487
293 Ga0501039_0144664 3300049575 Bacteria 1868
294 Ga0501039_0363864 3300049575 Bacteria 1136
295 Ga0501039_0740901 3300049575 Bacteria 768
296 Ga0501039_0846562 3300049575 Bacteria 713
297 Ga0501040_0006014 3300049576 Bacteria 7851
298 Ga0501040_0096949 3300049576 Bacteria 2054
299 Ga0501040_0191935 3300049576 Bacteria 1449
300 Ga0501040_0524712 3300049576 Bacteria 854
301 Ga0501040_0773798 3300049576 Bacteria 694
302 Ga0501041_0010897 3300049577 Bacteria 5365
303 Ga0501041_0035473 3300049577 Bacteria 3021
304 Ga0501041_0290228 3300049577 Bacteria 1030
305 Ga0501041_0362155 3300049577 Bacteria 917
306 Ga0501042_0049344 3300049578 Bacteria 3002
307 Ga0501042_0093801 3300049578 Bacteria 2156
308 Ga0501042_0106740 3300049578 Bacteria 2016
309 Ga0501042_0147757 3300049578 Bacteria 1694
310 Ga0501042_0147798 3300049578 Bacteria 1694
311 Ga0501042_0152816 3300049578 Bacteria 1664
312 Ga0501042_0727253 3300049578 Bacteria 722
313 Ga0501043_0004060 3300049579 Bacteria 11969
314 Ga0501043_0020972 3300049579 Bacteria 5124
315 Ga0501046_0002659 3300049580 Bacteria 16677
316 Ga0501046_0005691 3300049580 Bacteria 11124
317 Ga0501046_0012673 3300049580 Bacteria 7169
318 Ga0501046_0017778 3300049580 Bacteria 5931
319 Ga0501046_0018081 3300049580 Bacteria 5871
320 Ga0501047_0031615 3300049581 Bacteria 5107
321 Ga0501047_0087511 3300049581 Bacteria 2992
322 Ga0501047_0219117 3300049581 Bacteria 1759
323 Ga0501048_0000846 3300049582 Bacteria 22534
324 Ga0501048_0047186 3300049582 Bacteria 3073
325 Ga0501048_0050608 3300049582 Bacteria 2958
326 Ga0501048_0142493 3300049582 Bacteria 1695
327 Ga0501048_0216956 3300049582 Bacteria 1357
328 Ga0501067_0002696 3300049583 Bacteria 9795
329 Ga0501067_0037657 3300049583 Bacteria 2686
330 Ga0501067_0343838 3300049583 Bacteria 831
331 Ga0501068_0003366 3300049584 Bacteria 8588
332 Ga0501068_0353133 3300049584 Bacteria 945
333 Ga0501069_0000486 3300049585 Bacteria 18160
334 Ga0501069_0011836 3300049585 Bacteria 4626
335 Ga0501069_0027761 3300049585 Bacteria 3103
336 Ga0501069_0221738 3300049585 Bacteria 1099
337 Ga0501069_0223445 3300049585 Bacteria 1095
338 Ga0501070_0002647 3300049586 Bacteria 15633
339 Ga0501070_0003993 3300049586 Bacteria 12684
340 Ga0501070_0013831 3300049586 Bacteria 6797
341 Ga0501070_0016150 3300049586 Bacteria 6275
342 Ga0501070_0019595 3300049586 Bacteria 5672
343 Ga0501070_0409054 3300049586 Bacteria 1097
344 Ga0501070_0489045 3300049586 Bacteria 989
345 Ga0501071_0002767 3300049587 Bacteria 10773
346 Ga0501071_0005406 3300049587 Bacteria 8206
347 Ga0501071_0080095 3300049587 Bacteria 2388
348 Ga0501071_0083696 3300049587 Bacteria 2337
349 Ga0501071_0133568 3300049587 Bacteria 1845
350 Ga0501071_0345374 3300049587 Bacteria 1132
351 Ga0501072_0007597 3300049588 Bacteria 8225
352 Ga0501072_0019037 3300049588 Bacteria 5302
353 Ga0501072_0124560 3300049588 Bacteria 2053
354 Ga0501072_0227298 3300049588 Bacteria 1487
355 Ga0501072_0447880 3300049588 Bacteria 1023
356 Ga0501072_0497376 3300049588 Bacteria 964
357 Ga0501072_0549947 3300049588 Bacteria 912
358 Ga0501073_0087854 3300049589 Bacteria 2161
359 Ga0501073_0149353 3300049589 Bacteria 1619
360 Ga0501073_0206117 3300049589 Bacteria 1359
361 Ga0501073_0702029 3300049589 Bacteria 698
362 Ga0501074_0004359 3300049590 Bacteria 10104
363 Ga0501074_0004705 3300049590 Bacteria 9775
364 Ga0501074_0018040 3300049590 Bacteria 5126
365 Ga0501074_0082219 3300049590 Bacteria 2310
366 Ga0501074_0671715 3300049590 Bacteria 731
367 Ga0501075_0031230 3300049591 Bacteria 3952
368 Ga0501075_0149501 3300049591 Bacteria 1780
369 Ga0501075_0179399 3300049591 Bacteria 1616
370 Ga0501075_0772357 3300049591 Bacteria 731
371 Ga0501076_0018711 3300049592 Bacteria 5287
372 Ga0501076_0228392 3300049592 Bacteria 1521
373 Ga0501077_0004994 3300049593 Bacteria 8043
374 Ga0501077_0007137 3300049593 Bacteria 6889
375 Ga0501077_0010070 3300049593 Bacteria 5885
376 Ga0501077_0085435 3300049593 Bacteria 2000
377 Ga0501079_0050644 3300049741 Bacteria 3206
378 Ga0501079_0054295 3300049741 Bacteria 3090
379 Ga0501079_0060883 3300049741 Bacteria 2912
380 Ga0501079_0852096 3300049741 Bacteria 718
381 Ga0501080_0016285 3300049742 Bacteria 6864
382 Ga0501080_0016384 3300049742 Bacteria 6845
383 Ga0501080_0042264 3300049742 Bacteria 4245
384 Ga0501080_0083967 3300049742 Bacteria 2959
385 Ga0501080_0101722 3300049742 Bacteria 2666
386 Ga0501080_0105212 3300049742 Bacteria 2617
387 Ga0501083_0142998 3300049744 Bacteria 1566
388 Ga0501083_0195614 3300049744 Bacteria 1319
389 Ga0501035_0004801 3300049822 Bacteria 12812
390 Ga0501035_0022896 3300049822 Bacteria 5736
391 Ga0501035_0444637 3300049822 Bacteria 1073
392 Ga0501035_0712987 3300049822 Bacteria 808
393 Ga0501044_0004098 3300049823 Bacteria 16346
394 Ga0501044_0074494 3300049823 Bacteria 3448
395 Ga0501044_0307420 3300049823 Bacteria 1513
396 Ga0501044_0548238 3300049823 Bacteria 1054
397 Ga0501045_0037957 3300049824 Bacteria 3503
398 Ga0501045_0076699 3300049824 Bacteria 2463
399 Ga0501045_0115298 3300049824 Bacteria 1993
400 Ga0501045_0305494 3300049824 Bacteria 1184
401 nmdc:mga03683_4196_c1 3300050489 Bacteria 4748
402 nmdc:mga03n38_85837_c1 3300050490 Bacteria 1489
403 nmdc:mga00v17_136317_c1 3300050491 Bacteria 1572
404 nmdc:mga00v17_34461_c1 3300050491 Bacteria 3007
405 nmdc:mga00v17_37660_c1 3300050491 Bacteria 2889
406 nmdc:mga00v17_51951_c1 3300050491 Bacteria 2493
407 nmdc:mga00v17_84183_c1 3300050491 Bacteria 1990
408 nmdc:mga0yw44_120678_c1 3300050492 Bacteria 1688
409 nmdc:mga0yw44_20975_c1 3300050492 Bacteria 3637
410 nmdc:mga0yw44_284399_c1 3300050492 Bacteria 1106
411 nmdc:mga0yw44_50135_c1 3300050492 Bacteria 2523
412 nmdc:mga0yw44_63776_c1 3300050492 Bacteria 2266
413 nmdc:mga0yw44_75661_c1 3300050492 Bacteria 2100
414 nmdc:mga0yw44_93278_c1 3300050492 Bacteria 1906
415 nmdc:mga0yw44_9886_c1 3300050492 Bacteria 4846
416 nmdc:mga06z11_292397_c1 3300050494 Bacteria 967
417 nmdc:mga07m45_22554_c1 3300050496 Bacteria 3438
418 nmdc:mga07m45_382289_c1 3300050496 Bacteria 817
419 nmdc:mga0sz30_72427_c1 3300050516 Bacteria 1022
420 Ga0495595_0248850 3300053084 Bacteria 890
421 Ga0495619_0211249 3300053085 Bacteria 1344
422 Ga0500556_0000502 3300053104 Bacteria 27054
423 Ga0501084_0012105 3300054114 Bacteria 7140
424 Ga0501084_0013970 3300054114 Bacteria 6647
425 Ga0501084_0101938 3300054114 Bacteria 2410
426 Ga0501084_0185278 3300054114 Bacteria 1757
427 Ga0501084_0345880 3300054114 Bacteria 1256
428 Ga0501082_0093064 3300060353 Bacteria 2604
429 Ga0501082_0232225 3300060353 Bacteria 1605
430 Ga0501082_0307068 3300060353 Bacteria 1381
431 Ga0501082_0316143 3300060353 Bacteria 1360
432 Ga0466962_0016016 3300061719 Bacteria 3617
433 Ga0530510_0056017 3300061734 Bacteria 2848
434 Ga0530510_0096712 3300061734 Bacteria 2158
435 Ga0530510_0190712 3300061734 Bacteria 1521
436 Ga0530510_0532673 3300061734 Bacteria 891

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005438 Ga0070701_10374024 Ga0070701_103740241 159
2 3300005466 Ga0070685_10071066 Ga0070685_100710662 159
3 3300005719 Ga0068861_100127866 Ga0068861_1001278662 159
4 3300014326 Ga0157380_10040592 Ga0157380_100405922 159
5 3300026075 Ga0207708_10053882 Ga0207708_100538821 159
6 3300026118 Ga0207675_100039727 Ga0207675_1000397272 159
7 3300048905 Ga0496102_0701367 Ga0496102_0701367_406_924 172
8 3300026089 Ga0207648_10324833 Ga0207648_103248331 173
9 3300039437 Ga0436365_1426711 Ga0436365_1426711_525_1121 173
10 3300046515 Ga0495620_0084535 Ga0495620_0084535_467_1063 173
11 3300049584 Ga0501068_0353133 Ga0501068_0353133_36_635 175
12 3300049571 Ga0501034_0020880 Ga0501034_0020880_6049_6648 177
13 3300049581 Ga0501047_0031615 Ga0501047_0031615_3975_4574 177
14 3300049583 Ga0501067_0037657 Ga0501067_0037657_282_881 177
15 3300049585 Ga0501069_0027761 Ga0501069_0027761_2154_2753 177
16 3300049586 Ga0501070_0002647 Ga0501070_0002647_14569_15168 177
17 3300049587 Ga0501071_0345374 Ga0501071_0345374_206_805 177
18 3300049590 Ga0501074_0004359 Ga0501074_0004359_2883_3482 177
19 3300049593 Ga0501077_0004994 Ga0501077_0004994_7164_7763 177
20 3300049741 Ga0501079_0060883 Ga0501079_0060883_1649_2248 177
21 3300049742 Ga0501080_0016285 Ga0501080_0016285_4946_5545 177
22 3300049744 Ga0501083_0142998 Ga0501083_0142998_660_1259 177
23 3300049822 Ga0501035_0712987 Ga0501035_0712987_98_697 177
24 3300054114 Ga0501084_0101938 Ga0501084_0101938_77_676 177
25 3300060353 Ga0501082_0307068 Ga0501082_0307068_157_756 177
26 3300005535 Ga0070684_100060898 Ga0070684_1000608982 179
27 3300044765 Ga0466970_0157760 Ga0466970_0157760_251_820 180
28 3300044842 Ga0466957_0313410 Ga0466957_0313410_247_846 181
29 3300049585 Ga0501069_0000486 Ga0501069_0000486_5775_6347 181
30 3300049586 Ga0501070_0019595 Ga0501070_0019595_69_641 181
31 iso_pu_bacteria 2643221561 2643827669 181
32 iso_pu_bacteria 2643221696 2644534923 181
33 3300006353 Ga0075370_10231331 Ga0075370_102313312 183
34 3300050516 nmdc:mga0sz30_72427_c1 nmdc:mga0sz30_72427_c1_161_721 184
35 3300025904 Ga0207647_10276605 Ga0207647_102766051 185
36 3300044694 Ga0466963_0299389 Ga0466963_0299389_192_791 185
37 3300045976 Ga0466967_0007617 Ga0466967_0007617_3953_4552 185
38 iso_pu_bacteria 2643221590 2643961364 185
39 iso_pu_bacteria 2643221657 2644321337 185
40 3300006038 Ga0075365_10000585 Ga0075365_1000058510 186
41 3300006038 Ga0075365_10347188 Ga0075365_103471881 186
42 3300047322 Ga0495680_0394335 Ga0495680_0394335_80_676 186
43 3300049571 Ga0501034_0009129 Ga0501034_0009129_4721_5320 186
44 3300049572 Ga0501036_0117469 Ga0501036_0117469_1149_1748 186
45 3300049573 Ga0501037_0082058 Ga0501037_0082058_1511_2110 186
46 3300049574 Ga0501038_0084029 Ga0501038_0084029_265_864 186
47 3300049583 Ga0501067_0002696 Ga0501067_0002696_4783_5382 186
48 3300049584 Ga0501068_0003366 Ga0501068_0003366_4719_5318 186
49 3300049586 Ga0501070_0016150 Ga0501070_0016150_1498_2097 186
50 3300049587 Ga0501071_0005406 Ga0501071_0005406_3105_3704 186
51 3300049588 Ga0501072_0019037 Ga0501072_0019037_2648_3247 186
52 3300049589 Ga0501073_0087854 Ga0501073_0087854_65_664 186
53 3300049590 Ga0501074_0018040 Ga0501074_0018040_2158_2757 186
54 3300049593 Ga0501077_0007137 Ga0501077_0007137_249_848 186
55 3300049742 Ga0501080_0016384 Ga0501080_0016384_4090_4689 186
56 3300049744 Ga0501083_0195614 Ga0501083_0195614_100_699 186
57 3300049823 Ga0501044_0548238 Ga0501044_0548238_362_961 186
58 3300050491 nmdc:mga00v17_84183_c1 nmdc:mga00v17_84183_c1_112_672 186
59 3300050492 nmdc:mga0yw44_9886_c1 nmdc:mga0yw44_9886_c1_1720_2280 186
60 3300054114 Ga0501084_0013970 Ga0501084_0013970_4669_5268 186
61 3300060353 Ga0501082_0316143 Ga0501082_0316143_33_632 186
62 3300013308 Ga0157375_10030975 Ga0157375_100309753 187
63 3300048904 Ga0496101_0485557 Ga0496101_0485557_140_736 187
64 3300049569 Ga0501032_0472692 Ga0501032_0472692_65_664 187
65 3300049574 Ga0501038_0439368 Ga0501038_0439368_271_870 187
66 3300049575 Ga0501039_0144664 Ga0501039_0144664_225_824 187
67 3300049576 Ga0501040_0096949 Ga0501040_0096949_819_1418 187
68 3300049577 Ga0501041_0290228 Ga0501041_0290228_341_940 187
69 3300049578 Ga0501042_0106740 Ga0501042_0106740_1202_1801 187
70 3300049587 Ga0501071_0080095 Ga0501071_0080095_204_803 187
71 3300049590 Ga0501074_0082219 Ga0501074_0082219_1372_1971 187
72 3300049591 Ga0501075_0179399 Ga0501075_0179399_607_1206 187
73 3300049824 Ga0501045_0115298 Ga0501045_0115298_287_886 187
74 3300054114 Ga0501084_0185278 Ga0501084_0185278_276_875 187
75 3300061734 Ga0530510_0096712 Ga0530510_0096712_1422_2021 187
76 3300044901 Ga0466960_0008532 Ga0466960_0008532_285_851 188
77 3300049574 Ga0501038_0331733 Ga0501038_0331733_418_1023 188
78 3300049575 Ga0501039_0363864 Ga0501039_0363864_215_820 188
79 3300049575 Ga0501039_0846562 Ga0501039_0846562_56_652 188
80 3300049577 Ga0501041_0035473 Ga0501041_0035473_785_1390 188
81 3300049582 Ga0501048_0142493 Ga0501048_0142493_448_1053 188
82 3300049587 Ga0501071_0133568 Ga0501071_0133568_920_1525 188
83 3300049588 Ga0501072_0447880 Ga0501072_0447880_405_1010 188
84 3300049824 Ga0501045_0076699 Ga0501045_0076699_471_1076 188
85 3300005459 Ga0068867_100366674 Ga0068867_1003666742 189
86 3300006038 Ga0075365_10059655 Ga0075365_100596552 189
87 3300006038 Ga0075365_10076826 Ga0075365_100768263 189
88 3300006038 Ga0075365_10216784 Ga0075365_102167842 189
89 3300006038 Ga0075365_10289095 Ga0075365_102890951 189
90 3300006038 Ga0075365_10418030 Ga0075365_104180302 189
91 3300006048 Ga0075363_100003967 Ga0075363_1000039673 189
92 3300006048 Ga0075363_100020254 Ga0075363_1000202542 189
93 3300006048 Ga0075363_100072516 Ga0075363_1000725162 189
94 3300006051 Ga0075364_10005556 Ga0075364_100055564 189
95 3300006051 Ga0075364_10017885 Ga0075364_100178852 189
96 3300006353 Ga0075370_10012087 Ga0075370_100120872 189
97 3300006353 Ga0075370_10018994 Ga0075370_100189942 189
98 3300013308 Ga0157375_10255263 Ga0157375_102552632 189
99 3300031548 Ga0307408_100648287 Ga0307408_1006482871 189
100 3300031903 Ga0307407_10295811 Ga0307407_102958112 189
101 3300031911 Ga0307412_10293769 Ga0307412_102937691 189
102 3300032002 Ga0307416_100885430 Ga0307416_1008854301 189
103 3300032004 Ga0307414_10279112 Ga0307414_102791122 189
104 3300038443 Ga0395901_0809360 Ga0395901_0809360_48_617 189
105 3300041512 Ga0451853_2760549 Ga0451853_2760549_45_614 189
106 3300041997 Ga0439431_0004287 Ga0439431_0004287_1442_2023 189
107 3300042002 Ga0439442_028340 Ga0439442_028340_45_626 189
108 3300042004 Ga0439445_0038138 Ga0439445_0038138_610_1191 189
109 3300042014 Ga0439457_073183 Ga0439457_073183_148_729 189
110 3300042146 Ga0450907_035647 Ga0450907_035647_17_586 189
111 3300042156 Ga0439446_0061835 Ga0439446_0061835_190_771 189
112 3300042435 Ga0439434_0008883 Ga0439434_0008883_1066_1647 189
113 3300044658 Ga0466972_0036473 Ga0466972_0036473_199_768 189
114 3300044684 Ga0466966_0461933 Ga0466966_0461933_166_735 189
115 3300044693 Ga0466961_0075179 Ga0466961_0075179_502_1071 189
116 3300044693 Ga0466961_0590169 Ga0466961_0590169_13_582 189
117 3300044694 Ga0466963_0270564 Ga0466963_0270564_245_814 189
118 3300044706 Ga0466964_0046740 Ga0466964_0046740_232_801 189
119 3300044719 Ga0466971_0098323 Ga0466971_0098323_211_780 189
120 3300044765 Ga0466970_0081097 Ga0466970_0081097_663_1232 189
121 3300044765 Ga0466970_0104532 Ga0466970_0104532_632_1222 189
122 3300044842 Ga0466957_0016292 Ga0466957_0016292_478_1047 189
123 3300044901 Ga0466960_0054268 Ga0466960_0054268_1028_1597 189
124 3300044901 Ga0466960_0057415 Ga0466960_0057415_1251_1820 189
125 3300044901 Ga0466960_0567633 Ga0466960_0567633_85_654 189
126 3300045836 Ga0466958_0177627 Ga0466958_0177627_335_904 189
127 3300045976 Ga0466967_0010070 Ga0466967_0010070_4693_5292 189
128 3300045976 Ga0466967_0084960 Ga0466967_0084960_1505_2074 189
129 3300045976 Ga0466967_0502100 Ga0466967_0502100_348_917 189
130 3300048904 Ga0496101_0650474 Ga0496101_0650474_89_658 189
131 3300048905 Ga0496102_0257324 Ga0496102_0257324_43_612 189
132 3300048927 Ga0496124_0353404 Ga0496124_0353404_158_727 189
133 3300049568 Ga0501031_0356484 Ga0501031_0356484_222_791 189
134 3300049570 Ga0501033_0220042 Ga0501033_0220042_645_1214 189
135 3300049572 Ga0501036_0030465 Ga0501036_0030465_2531_3100 189
136 3300049573 Ga0501037_0242375 Ga0501037_0242375_348_917 189
137 3300049574 Ga0501038_0109453 Ga0501038_0109453_1523_2092 189
138 3300049575 Ga0501039_0083527 Ga0501039_0083527_1090_1659 189
139 3300049576 Ga0501040_0191935 Ga0501040_0191935_472_1041 189
140 3300049578 Ga0501042_0049344 Ga0501042_0049344_215_784 189
141 3300049580 Ga0501046_0018081 Ga0501046_0018081_510_1079 189
142 3300049582 Ga0501048_0050608 Ga0501048_0050608_2253_2822 189
143 3300049583 Ga0501067_0343838 Ga0501067_0343838_83_652 189
144 3300049585 Ga0501069_0221738 Ga0501069_0221738_352_921 189
145 3300049585 Ga0501069_0223445 Ga0501069_0223445_59_628 189
146 3300049586 Ga0501070_0409054 Ga0501070_0409054_103_672 189
147 3300049586 Ga0501070_0489045 Ga0501070_0489045_282_851 189
148 3300049587 Ga0501071_0002767 Ga0501071_0002767_6412_6981 189
149 3300049588 Ga0501072_0497376 Ga0501072_0497376_95_664 189
150 3300049589 Ga0501073_0149353 Ga0501073_0149353_359_928 189
151 3300049589 Ga0501073_0702029 Ga0501073_0702029_45_614 189
152 3300049590 Ga0501074_0671715 Ga0501074_0671715_141_710 189
153 3300049591 Ga0501075_0149501 Ga0501075_0149501_515_1084 189
154 3300049592 Ga0501076_0228392 Ga0501076_0228392_140_709 189
155 3300049593 Ga0501077_0085435 Ga0501077_0085435_71_640 189
156 3300049741 Ga0501079_0050644 Ga0501079_0050644_1392_1961 189
157 3300049741 Ga0501079_0852096 Ga0501079_0852096_125_694 189
158 3300049742 Ga0501080_0083967 Ga0501080_0083967_469_1038 189
159 3300049823 Ga0501044_0307420 Ga0501044_0307420_190_759 189
160 3300050491 nmdc:mga00v17_34461_c1 nmdc:mga00v17_34461_c1_768_1337 189
161 3300050491 nmdc:mga00v17_37660_c1 nmdc:mga00v17_37660_c1_188_757 189
162 3300050491 nmdc:mga00v17_51951_c1 nmdc:mga00v17_51951_c1_356_925 189
163 3300050492 nmdc:mga0yw44_120678_c1 nmdc:mga0yw44_120678_c1_737_1306 189
164 3300050492 nmdc:mga0yw44_20975_c1 nmdc:mga0yw44_20975_c1_2657_3226 189
165 3300050492 nmdc:mga0yw44_50135_c1 nmdc:mga0yw44_50135_c1_1681_2250 189
166 3300050492 nmdc:mga0yw44_75661_c1 nmdc:mga0yw44_75661_c1_1192_1761 189
167 3300050492 nmdc:mga0yw44_93278_c1 nmdc:mga0yw44_93278_c1_124_693 189
168 3300050494 nmdc:mga06z11_292397_c1 nmdc:mga06z11_292397_c1_380_949 189
169 3300050496 nmdc:mga07m45_22554_c1 nmdc:mga07m45_22554_c1_906_1475 189
170 3300053104 Ga0500556_0000502 Ga0500556_0000502_2280_2849 189
171 3300060353 Ga0501082_0093064 Ga0501082_0093064_1966_2535 189
172 3300061719 Ga0466962_0016016 Ga0466962_0016016_1153_1722 189
173 3300061734 Ga0530510_0056017 Ga0530510_0056017_580_1149 189
174 3300049585 Ga0501069_0011836 Ga0501069_0011836_1585_2184 191
175 3300049586 Ga0501070_0013831 Ga0501070_0013831_1902_2501 191
176 3300049590 Ga0501074_0004705 Ga0501074_0004705_71_670 191
177 3300049742 Ga0501080_0042264 Ga0501080_0042264_2662_3261 191
178 3300005471 Ga0070698_100090068 Ga0070698_1000900682 192
179 3300025922 Ga0207646_10331476 Ga0207646_103314762 192
180 3300048911 Ga0496108_0384661 Ga0496108_0384661_98_694 193
181 3300048912 Ga0496109_0090810 Ga0496109_0090810_255_851 193
182 iso_pu_bacteria 2643221604 2644033432 193
183 iso_pu_bacteria 2738541305 2738869337 193
184 iso_pu_bacteria 2808606439 2809198104 193
185 iso_pu_bacteria 2891968417 2891969164 193
186 3300049577 Ga0501041_0362155 Ga0501041_0362155_144_734 194
187 3300049588 Ga0501072_0549947 Ga0501072_0549947_304_894 194
188 3300049824 Ga0501045_0305494 Ga0501045_0305494_141_731 194
189 iso_pu_bacteria 2643221617 2644101508 194
190 iso_pu_bacteria 2643221620 2644118756 194
191 iso_pu_bacteria 2855386786 2855389550 194
192 iso_pu_bacteria 2857481737 2857485412 194
193 3300006051 Ga0075364_10422668 Ga0075364_104226682 195
194 3300009551 Ga0105238_10869715 Ga0105238_108697151 195
195 iso_pu_bacteria 2643221576 2643892312 195
196 iso_pu_bacteria 2811994874 2812331416 195
197 3300037471 Ga0395905_0043099 Ga0395905_0043099_1823_2413 196
198 3300044765 Ga0466970_0111448 Ga0466970_0111448_156_746 196
199 3300044842 Ga0466957_0516524 Ga0466957_0516524_126_716 196
200 3300044901 Ga0466960_0022272 Ga0466960_0022272_280_870 196
201 3300044901 Ga0466960_0045288 Ga0466960_0045288_1370_1960 196
202 3300044901 Ga0466960_0337909 Ga0466960_0337909_107_697 196
203 3300045976 Ga0466967_0355747 Ga0466967_0355747_717_1307 196
204 3300049571 Ga0501034_0010965 Ga0501034_0010965_4491_5081 196
205 3300049572 Ga0501036_0010955 Ga0501036_0010955_4951_5541 196
206 3300049573 Ga0501037_0005898 Ga0501037_0005898_1426_2016 196
207 3300049574 Ga0501038_0002504 Ga0501038_0002504_14663_15253 196
208 3300049578 Ga0501042_0147798 Ga0501042_0147798_814_1404 196
209 3300049580 Ga0501046_0017778 Ga0501046_0017778_5245_5835 196
210 3300049581 Ga0501047_0219117 Ga0501047_0219117_668_1258 196
211 3300049822 Ga0501035_0004801 Ga0501035_0004801_4152_4742 196
212 3300049823 Ga0501044_0004098 Ga0501044_0004098_3407_3997 196
213 3300003578 Ga0006562J51391_1037182 Ga0006562J51391_10371822 197
214 3300049568 Ga0501031_0016385 Ga0501031_0016385_3365_3958 197
215 3300049569 Ga0501032_0002003 Ga0501032_0002003_974_1567 197
216 3300049570 Ga0501033_0003693 Ga0501033_0003693_6145_6738 197
217 3300049571 Ga0501034_0027704 Ga0501034_0027704_3890_4483 197
218 3300049571 Ga0501034_0457627 Ga0501034_0457627_474_1067 197
219 3300049572 Ga0501036_0017866 Ga0501036_0017866_2794_3387 197
220 3300049573 Ga0501037_0087742 Ga0501037_0087742_1379_1972 197
221 3300049574 Ga0501038_0008339 Ga0501038_0008339_5626_6219 197
222 3300049575 Ga0501039_0070304 Ga0501039_0070304_2098_2691 197
223 3300049576 Ga0501040_0773798 Ga0501040_0773798_29_622 197
224 3300049578 Ga0501042_0152816 Ga0501042_0152816_260_853 197
225 3300049579 Ga0501043_0004060 Ga0501043_0004060_934_1527 197
226 3300049579 Ga0501043_0020972 Ga0501043_0020972_2211_2804 197
227 3300049580 Ga0501046_0002659 Ga0501046_0002659_13734_14327 197
228 3300049580 Ga0501046_0005691 Ga0501046_0005691_2070_2663 197
229 3300049581 Ga0501047_0087511 Ga0501047_0087511_1865_2458 197
230 3300049582 Ga0501048_0000846 Ga0501048_0000846_19451_20044 197
231 3300049586 Ga0501070_0003993 Ga0501070_0003993_10342_10935 197
232 3300049588 Ga0501072_0124560 Ga0501072_0124560_57_650 197
233 3300049589 Ga0501073_0206117 Ga0501073_0206117_220_813 197
234 3300049742 Ga0501080_0101722 Ga0501080_0101722_662_1255 197
235 3300049822 Ga0501035_0022896 Ga0501035_0022896_1582_2175 197
236 3300049823 Ga0501044_0074494 Ga0501044_0074494_897_1490 197
237 iso_pu_bacteria 2984576629 2984579093 197
238 iso_pu_bacteria 2990256926 2990260013 197
239 3300000549 LJQas_1006953 LJQas_10069532 198
240 3300003323 rootH1_10079093 rootH1_100790932 198
241 3300005329 Ga0070683_100001398 Ga0070683_10000139816 198
242 3300005329 Ga0070683_100150793 Ga0070683_1001507932 198
243 3300005334 Ga0068869_100435849 Ga0068869_1004358492 198
244 3300005335 Ga0070666_10236497 Ga0070666_102364972 198
245 3300005336 Ga0070680_100314985 Ga0070680_1003149851 198
246 3300005337 Ga0070682_100018966 Ga0070682_1000189662 198
247 3300005339 Ga0070660_100058030 Ga0070660_1000580303 198
248 3300005339 Ga0070660_100066788 Ga0070660_1000667882 198
249 3300005341 Ga0070691_10384559 Ga0070691_103845591 198
250 3300005343 Ga0070687_100068695 Ga0070687_1000686952 198
251 3300005344 Ga0070661_100631715 Ga0070661_1006317152 198
252 3300005345 Ga0070692_10155485 Ga0070692_101554852 198
253 3300005354 Ga0070675_100155199 Ga0070675_1001551992 198
254 3300005366 Ga0070659_100021202 Ga0070659_1000212022 198
255 3300005366 Ga0070659_100647619 Ga0070659_1006476191 198
256 3300005367 Ga0070667_100062525 Ga0070667_1000625252 198
257 3300005456 Ga0070678_101082663 Ga0070678_1010826631 198
258 3300005530 Ga0070679_100079275 Ga0070679_1000792752 198
259 3300005530 Ga0070679_100393636 Ga0070679_1003936362 198
260 3300005535 Ga0070684_100000859 Ga0070684_10000085919 198
261 3300005535 Ga0070684_100162741 Ga0070684_1001627412 198
262 3300005539 Ga0068853_100289074 Ga0068853_1002890741 198
263 3300005546 Ga0070696_100087805 Ga0070696_1000878052 198
264 3300005547 Ga0070693_100557956 Ga0070693_1005579561 198
265 3300005548 Ga0070665_100000606 Ga0070665_10000060616 198
266 3300005548 Ga0070665_100090593 Ga0070665_1000905932 198
267 3300005563 Ga0068855_100065608 Ga0068855_1000656083 198
268 3300005564 Ga0070664_100080676 Ga0070664_1000806762 198
269 3300005577 Ga0068857_100016723 Ga0068857_1000167232 198
270 3300005577 Ga0068857_100552718 Ga0068857_1005527182 198
271 3300005614 Ga0068856_100295609 Ga0068856_1002956092 198
272 3300005842 Ga0068858_100218406 Ga0068858_1002184062 198
273 3300005844 Ga0068862_100869884 Ga0068862_1008698841 198
274 3300006038 Ga0075365_10009628 Ga0075365_100096282 198
275 3300006038 Ga0075365_10041611 Ga0075365_100416112 198
276 3300006038 Ga0075365_10148386 Ga0075365_101483862 198
277 3300006042 Ga0075368_10000529 Ga0075368_100005292 198
278 3300006048 Ga0075363_100142922 Ga0075363_1001429222 198
279 3300006051 Ga0075364_10011323 Ga0075364_100113232 198
280 3300006177 Ga0075362_10006603 Ga0075362_100066032 198
281 3300006178 Ga0075367_10027230 Ga0075367_100272302 198
282 3300006353 Ga0075370_10019446 Ga0075370_100194462 198
283 3300006881 Ga0068865_100310604 Ga0068865_1003106041 198
284 3300009098 Ga0105245_10007388 Ga0105245_100073882 198
285 3300009148 Ga0105243_10112119 Ga0105243_101121192 198
286 3300009148 Ga0105243_10460799 Ga0105243_104607991 198
287 3300009148 Ga0105243_10873339 Ga0105243_108733392 198
288 3300009176 Ga0105242_10100001 Ga0105242_101000012 198
289 3300009176 Ga0105242_10669683 Ga0105242_106696831 198
290 3300009553 Ga0105249_10041826 Ga0105249_100418262 198
291 3300010375 Ga0105239_10003082 Ga0105239_100030822 198
292 3300011119 Ga0105246_10015819 Ga0105246_100158195 198
293 3300013102 Ga0157371_10346984 Ga0157371_103469842 198
294 3300013105 Ga0157369_10099679 Ga0157369_100996792 198
295 3300013306 Ga0163162_10359137 Ga0163162_103591371 198
296 3300013307 Ga0157372_10172091 Ga0157372_101720912 198
297 3300013307 Ga0157372_10284479 Ga0157372_102844792 198
298 3300013307 Ga0157372_10322149 Ga0157372_103221491 198
299 3300013307 Ga0157372_10791530 Ga0157372_107915302 198
300 3300013308 Ga0157375_10006488 Ga0157375_100064886 198
301 3300014325 Ga0163163_10356366 Ga0163163_103563662 198
302 3300014497 Ga0182008_10016958 Ga0182008_100169582 198
303 3300014497 Ga0182008_10073303 Ga0182008_100733031 198
304 3300014497 Ga0182008_10155961 Ga0182008_101559612 198
305 3300014745 Ga0157377_10482712 Ga0157377_104827122 198
306 3300014968 Ga0157379_10053443 Ga0157379_100534432 198
307 3300014969 Ga0157376_10483926 Ga0157376_104839261 198
308 3300020082 Ga0206353_10862183 Ga0206353_108621831 198
309 3300020082 Ga0206353_11006745 Ga0206353_110067451 198
310 3300025901 Ga0207688_10018470 Ga0207688_100184702 198
311 3300025909 Ga0207705_10151914 Ga0207705_101519142 198
312 3300025917 Ga0207660_10043589 Ga0207660_100435891 198
313 3300025918 Ga0207662_10086714 Ga0207662_100867142 198
314 3300025919 Ga0207657_10021029 Ga0207657_100210293 198
315 3300025920 Ga0207649_10302480 Ga0207649_103024802 198
316 3300025921 Ga0207652_10311106 Ga0207652_103111062 198
317 3300025926 Ga0207659_10180006 Ga0207659_101800062 198
318 3300025927 Ga0207687_10018606 Ga0207687_100186063 198
319 3300025932 Ga0207690_10021748 Ga0207690_100217483 198
320 3300025934 Ga0207686_10123430 Ga0207686_101234302 198
321 3300025935 Ga0207709_10122140 Ga0207709_101221402 198
322 3300025935 Ga0207709_10140965 Ga0207709_101409652 198
323 3300025935 Ga0207709_10871991 Ga0207709_108719911 198
324 3300025944 Ga0207661_10066162 Ga0207661_100661622 198
325 3300025945 Ga0207679_10177849 Ga0207679_101778492 198
326 3300025949 Ga0207667_10040919 Ga0207667_100409192 198
327 3300025961 Ga0207712_10052873 Ga0207712_100528733 198
328 3300025961 Ga0207712_10227933 Ga0207712_102279331 198
329 3300026023 Ga0207677_10097972 Ga0207677_100979722 198
330 3300026035 Ga0207703_10384218 Ga0207703_103842182 198
331 3300026041 Ga0207639_10250576 Ga0207639_102505761 198
332 3300026078 Ga0207702_10329534 Ga0207702_103295341 198
333 3300026089 Ga0207648_10445255 Ga0207648_104452552 198
334 3300026116 Ga0207674_10009755 Ga0207674_100097554 198
335 3300028379 Ga0268266_10480856 Ga0268266_104808562 198
336 3300028381 Ga0268264_10694835 Ga0268264_106948351 198
337 3300031548 Ga0307408_100493841 Ga0307408_1004938412 198
338 3300031731 Ga0307405_10035201 Ga0307405_100352012 198
339 3300031852 Ga0307410_10215705 Ga0307410_102157052 198
340 3300031852 Ga0307410_10523018 Ga0307410_105230182 198
341 3300031901 Ga0307406_10090163 Ga0307406_100901632 198
342 3300031903 Ga0307407_10004200 Ga0307407_100042002 198
343 3300031903 Ga0307407_10023889 Ga0307407_100238892 198
344 3300031903 Ga0307407_10117536 Ga0307407_101175362 198
345 3300031911 Ga0307412_10025529 Ga0307412_100255292 198
346 3300031911 Ga0307412_10226114 Ga0307412_102261142 198
347 3300031911 Ga0307412_10368948 Ga0307412_103689482 198
348 3300031995 Ga0307409_100027515 Ga0307409_1000275152 198
349 3300031995 Ga0307409_100113280 Ga0307409_1001132802 198
350 3300031995 Ga0307409_100767791 Ga0307409_1007677912 198
351 3300032002 Ga0307416_100000221 Ga0307416_10000022128 198
352 3300032002 Ga0307416_100057771 Ga0307416_1000577714 198
353 3300032004 Ga0307414_10508222 Ga0307414_105082222 198
354 3300032005 Ga0307411_10037100 Ga0307411_100371003 198
355 3300032126 Ga0307415_100000455 Ga0307415_1000004555 198
356 3300032126 Ga0307415_100037266 Ga0307415_1000372662 198
357 3300032126 Ga0307415_100289899 Ga0307415_1002898992 198
358 3300037418 Ga0395900_0064398 Ga0395900_0064398_2268_2867 198
359 3300037466 Ga0395898_0027410 Ga0395898_0027410_100_699 198
360 3300038443 Ga0395901_0017796 Ga0395901_0017796_5182_5781 198
361 3300038443 Ga0395901_0408105 Ga0395901_0408105_593_1192 198
362 3300044683 Ga0466965_0066504 Ga0466965_0066504_216_815 198
363 3300044684 Ga0466966_0015053 Ga0466966_0015053_3577_4185 198
364 3300044694 Ga0466963_0064044 Ga0466963_0064044_1462_2061 198
365 3300044694 Ga0466963_0651903 Ga0466963_0651903_24_644 198
366 3300044765 Ga0466970_0106063 Ga0466970_0106063_596_1195 198
367 3300044842 Ga0466957_0286014 Ga0466957_0286014_185_784 198
368 3300044842 Ga0466957_0499411 Ga0466957_0499411_40_660 198
369 3300044842 Ga0466957_0611754 Ga0466957_0611754_43_669 198
370 3300044901 Ga0466960_0019642 Ga0466960_0019642_614_1240 198
371 3300044901 Ga0466960_0105249 Ga0466960_0105249_599_1198 198
372 3300045976 Ga0466967_0051375 Ga0466967_0051375_2042_2662 198
373 3300045976 Ga0466967_0442684 Ga0466967_0442684_581_1180 198
374 3300048904 Ga0496101_0216965 Ga0496101_0216965_711_1355 198
375 3300048904 Ga0496101_0249531 Ga0496101_0249531_39_635 198
376 3300048904 Ga0496101_0771450 Ga0496101_0771450_35_640 198
377 3300048904 Ga0496101_0855560 Ga0496101_0855560_99_695 198
378 3300048905 Ga0496102_0030321 Ga0496102_0030321_3754_4359 198
379 3300048905 Ga0496102_0034295 Ga0496102_0034295_2943_3542 198
380 3300048905 Ga0496102_0075289 Ga0496102_0075289_1103_1699 198
381 3300048905 Ga0496102_0124293 Ga0496102_0124293_254_850 198
382 3300048908 Ga0496105_0001788 Ga0496105_0001788_12555_13151 198
383 3300048908 Ga0496105_0033894 Ga0496105_0033894_1840_2436 198
384 3300048908 Ga0496105_0561547 Ga0496105_0561547_102_698 198
385 3300048910 Ga0496107_0177535 Ga0496107_0177535_161_766 198
386 3300048911 Ga0496108_0227951 Ga0496108_0227951_781_1425 198
387 3300048911 Ga0496108_0622409 Ga0496108_0622409_189_788 198
388 3300048912 Ga0496109_0004367 Ga0496109_0004367_1908_2552 198
389 3300048912 Ga0496109_0035220 Ga0496109_0035220_3247_3846 198
390 3300048912 Ga0496109_0038345 Ga0496109_0038345_283_879 198
391 3300048912 Ga0496109_0158604 Ga0496109_0158604_1352_1957 198
392 3300048912 Ga0496109_0474560 Ga0496109_0474560_383_1003 198
393 3300048913 Ga0496110_0008067 Ga0496110_0008067_2144_2743 198
394 3300048913 Ga0496110_0323763 Ga0496110_0323763_563_1183 198
395 3300048914 Ga0496111_0040905 Ga0496111_0040905_2026_2625 198
396 3300048914 Ga0496111_0540156 Ga0496111_0540156_87_683 198
397 3300048915 Ga0496112_0670690 Ga0496112_0670690_41_658 198
398 3300048916 Ga0496113_0104067 Ga0496113_0104067_138_743 198
399 3300048916 Ga0496113_0443066 Ga0496113_0443066_254_898 198
400 3300048916 Ga0496113_0802508 Ga0496113_0802508_11_607 198
401 3300048917 Ga0496114_0004376 Ga0496114_0004376_5729_6325 198
402 3300048917 Ga0496114_0005642 Ga0496114_0005642_364_969 198
403 3300048917 Ga0496114_0019142 Ga0496114_0019142_3323_3967 198
404 3300048917 Ga0496114_0030973 Ga0496114_0030973_23_643 198
405 3300048917 Ga0496114_0240797 Ga0496114_0240797_358_978 198
406 3300048917 Ga0496114_0295941 Ga0496114_0295941_462_1061 198
407 3300048917 Ga0496114_0672297 Ga0496114_0672297_267_863 198
408 3300048918 Ga0496115_0024020 Ga0496115_0024020_284_880 198
409 3300048918 Ga0496115_0083090 Ga0496115_0083090_917_1522 198
410 3300048918 Ga0496115_0119585 Ga0496115_0119585_301_897 198
411 3300048918 Ga0496115_0455376 Ga0496115_0455376_238_882 198
412 3300049568 Ga0501031_0055976 Ga0501031_0055976_1207_1818 198
413 3300049568 Ga0501031_0428066 Ga0501031_0428066_165_785 198
414 3300049570 Ga0501033_0348783 Ga0501033_0348783_94_705 198
415 3300049572 Ga0501036_0109558 Ga0501036_0109558_400_1011 198
416 3300049572 Ga0501036_0210499 Ga0501036_0210499_761_1381 198
417 3300049574 Ga0501038_0029979 Ga0501038_0029979_1026_1637 198
418 3300049575 Ga0501039_0026214 Ga0501039_0026214_1401_2012 198
419 3300049575 Ga0501039_0740901 Ga0501039_0740901_92_691 198
420 3300049576 Ga0501040_0006014 Ga0501040_0006014_1667_2278 198
421 3300049576 Ga0501040_0524712 Ga0501040_0524712_93_704 198
422 3300049577 Ga0501041_0010897 Ga0501041_0010897_1729_2340 198
423 3300049578 Ga0501042_0093801 Ga0501042_0093801_609_1229 198
424 3300049578 Ga0501042_0147757 Ga0501042_0147757_771_1382 198
425 3300049578 Ga0501042_0727253 Ga0501042_0727253_86_697 198
426 3300049580 Ga0501046_0012673 Ga0501046_0012673_815_1426 198
427 3300049582 Ga0501048_0047186 Ga0501048_0047186_692_1303 198
428 3300049582 Ga0501048_0216956 Ga0501048_0216956_361_981 198
429 3300049587 Ga0501071_0083696 Ga0501071_0083696_1633_2244 198
430 3300049588 Ga0501072_0007597 Ga0501072_0007597_2775_3386 198
431 3300049588 Ga0501072_0227298 Ga0501072_0227298_757_1377 198
432 3300049591 Ga0501075_0031230 Ga0501075_0031230_3021_3632 198
433 3300049591 Ga0501075_0772357 Ga0501075_0772357_43_654 198
434 3300049592 Ga0501076_0018711 Ga0501076_0018711_2598_3209 198
435 3300049593 Ga0501077_0010070 Ga0501077_0010070_612_1223 198
436 3300049741 Ga0501079_0054295 Ga0501079_0054295_1701_2312 198
437 3300049742 Ga0501080_0105212 Ga0501080_0105212_671_1282 198
438 3300049822 Ga0501035_0444637 Ga0501035_0444637_236_856 198
439 3300049824 Ga0501045_0037957 Ga0501045_0037957_1156_1767 198
440 3300050489 nmdc:mga03683_4196_c1 nmdc:mga03683_4196_c1_435_1031 198
441 3300050490 nmdc:mga03n38_85837_c1 nmdc:mga03n38_85837_c1_630_1226 198
442 3300050491 nmdc:mga00v17_136317_c1 nmdc:mga00v17_136317_c1_295_891 198
443 3300050492 nmdc:mga0yw44_284399_c1 nmdc:mga0yw44_284399_c1_149_745 198
444 3300050492 nmdc:mga0yw44_63776_c1 nmdc:mga0yw44_63776_c1_189_785 198
445 3300050496 nmdc:mga07m45_382289_c1 nmdc:mga07m45_382289_c1_104_706 198
446 3300053084 Ga0495595_0248850 Ga0495595_0248850_42_647 198
447 3300053085 Ga0495619_0211249 Ga0495619_0211249_562_1167 198
448 3300054114 Ga0501084_0012105 Ga0501084_0012105_1547_2158 198
449 3300054114 Ga0501084_0345880 Ga0501084_0345880_369_980 198
450 3300060353 Ga0501082_0232225 Ga0501082_0232225_199_810 198
451 3300061734 Ga0530510_0190712 Ga0530510_0190712_95_706 198
452 3300061734 Ga0530510_0532673 Ga0530510_0532673_164_787 198
453 iso_pu_bacteria 2773857762 2774396447 198
454 iso_pu_bacteria 2811994878 2812353206 198

Structural Annotation

Top 5 Hits

ID Description Score Start End
7dih-assembly2.cif.gz_B crystal structure of thermoglobin y29f mutant in complex with imidazole 0.5005 86 193
6zif-assembly1.cif.gz_C the structure of a cytosolic copper storage protein from methylocystis sp. strain rockwell (atcc 49242) 0.4776 94 189
3lmf-assembly1.cif.gz_A crystal structure of nmul_a1745 protein from nitrosospira multiformis, northeast structural genomics consortium target nmr72 0.4703 94 190
2cj5-assembly1.cif.gz_A crystal structure of a cell wall invertase inhibitor from tobacco (ph 5.0) 0.4507 73 190
5arn-assembly1.cif.gz_A cu(i)-csp3 (copper storage protein 3) from methylosinus 0.4407 87 191
ID Description Score Start End Superfamily
af_Q9UAG7_2_143_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.5201 86 195 1.10.490.10
af_P24232_1_143_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.5051 86 195 1.10.490.10
af_Q7ARS9_4_141_1.10.490.10 Mainly Alpha;Orthogonal Bundle;Globin-like;Globins 0.4728 86 191 1.10.490.10
af_Q54HM5_62_190_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4727 87 196 1.20.58.70
af_Q55DR2_66_193_1.20.58.70 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.4682 87 196 1.20.58.70
ID Description Score Start End GO Terms
AF-A0A4S4ZT33-F1-model_v4 Uncharacterized protein 0.9094 30 172
AF-A0A7X7NPG2-F1-model_v4 DNA-directed RNA polymerase subunit beta 0.8974 23 198
AF-A0A212U7S6-F1-model_v4 Uncharacterized protein 0.895 21 198
AF-A0A4Y4D8E0-F1-model_v4 DNA-directed RNA polymerase subunit beta 0.8881 22 198
AF-A0A1M3AL93-F1-model_v4 deleted 0.8841 24 198

Feature Viewer

pLDDT pTM Quality
79.59 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map