F447366

General Info

Members Datasets Scaffolds Average Seq Length
454 153 908 117

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10168218|Ga0099794_101682183
Length 121
Sequence MPRVKSNVARLKRKNKVMKLAKGYWGGRSKLWKAAKESVERAQKYAYRDRRRKKGDFRRLWITRINAAARLHELTYGRFMNGLRKAGVTVNRKILADLAVRDPVAFAQLAEVAKQAPPPTR

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
8 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
36 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
42 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
43 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
44 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
50 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
71 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
72 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
73 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
74 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
75 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
76 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
77 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
78 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
79 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
82 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
83 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
84 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
86 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
87 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
88 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
89 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
90 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
91 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
92 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
93 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
94 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
95 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
96 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
97 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
98 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
99 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
100 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
101 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
102 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
103 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
104 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
105 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
106 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
107 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
110 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
111 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
112 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
113 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
114 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
115 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
118 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
119 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
120 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
121 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
122 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
123 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
124 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
125 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
126 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
127 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
130 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
131 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
132 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
133 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
134 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
135 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
141 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
142 2617270889 Nostoc punctiforme PCC 73102 Isolate Unclassified
143 2738541299 Paenisporosarcina sp. OV554 Isolate Unclassified
144 2831426010 Nostoc sp. 106C Isolate Unclassified
145 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
146 2849660919 Nostoc sp. T09 Isolate Unclassified
147 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
148 2913844669 Nostocales cyanobacterium LEGE 12452 Isolate Unclassified
149 2913939268 Nostoc sp. LEGE 12447 Isolate Unclassified
150 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
151 642555144 Nostoc punctiforme PCC 73102 Isolate Unclassified
152 8002317523 Cohnella sp. GbtcB17 Isolate Unclassified
153 8046991243 Cohnella rhizosphaerae DSM 28161 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.21
Metatranscriptomes 8.15
Isolates 2.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 1.54
Rhizosphere 92.95
Stem 0
Stem Tuber 0
Unclassified 7.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10168218 3300007265 Bacteria 1117
2 Ga0065704_10487266 3300005289 Bacteria 677
3 Ga0065707_10001702 3300005295 Bacteria 7485
4 Ga0065707_10128557 3300005295 Bacteria 1963
5 Ga0065707_10603304 3300005295 Bacteria 689
6 Ga0070680_100085827 3300005336 Bacteria 2601
7 Ga0070680_100398548 3300005336 Bacteria 1173
8 Ga0070691_10561081 3300005341 Bacteria 668
9 Ga0070687_100035538 3300005343 Bacteria 2475
10 Ga0070692_10034063 3300005345 Bacteria 2570
11 Ga0070703_10010620 3300005406 Bacteria 2596
12 Ga0070703_10010689 3300005406 Bacteria 2588
13 Ga0070703_10085390 3300005406 Unclassified 1084
14 Ga0070703_10350852 3300005406 Bacteria 629
15 Ga0070709_10002412 3300005434 Bacteria 10128
16 Ga0070709_10057272 3300005434 Bacteria 2468
17 Ga0070709_10146828 3300005434 Bacteria 1626
18 Ga0070714_100120869 3300005435 Bacteria 2330
19 Ga0070713_100141639 3300005436 Bacteria 2131
20 Ga0070713_100247215 3300005436 Bacteria 1626
21 Ga0070701_10001843 3300005438 Bacteria 8029
22 Ga0070711_100000466 3300005439 Bacteria 21169
23 Ga0070705_100072691 3300005440 Bacteria 2084
24 Ga0070705_100214555 3300005440 Bacteria 1329
25 Ga0070705_100485500 3300005440 Bacteria 934
26 Ga0070705_100521768 3300005440 Bacteria 905
27 Ga0070700_100144922 3300005441 Bacteria 1618
28 Ga0070694_100003097 3300005444 Bacteria 9899
29 Ga0070694_100035006 3300005444 Bacteria 3316
30 Ga0070694_100096351 3300005444 Bacteria 2085
31 Ga0070694_100480803 3300005444 Bacteria 985
32 Ga0070694_100690138 3300005444 Bacteria 829
33 Ga0070694_100762708 3300005444 Bacteria 791
34 Ga0070694_101944288 3300005444 Bacteria 502
35 Ga0070708_100001912 3300005445 Bacteria 16029
36 Ga0070708_100042312 3300005445 Bacteria 3998
37 Ga0070708_100107478 3300005445 Bacteria 2561
38 Ga0070708_100123418 3300005445 Bacteria 2391
39 Ga0070708_100211359 3300005445 Bacteria 1818
40 Ga0070708_100311951 3300005445 Bacteria 1481
41 Ga0070708_100365274 3300005445 Bacteria 1360
42 Ga0070708_100974059 3300005445 Bacteria 795
43 Ga0070708_101485594 3300005445 Bacteria 631
44 Ga0070663_100700751 3300005455 Bacteria 861
45 Ga0068867_100232782 3300005459 Bacteria 1490
46 Ga0070706_100003511 3300005467 Bacteria 15410
47 Ga0070706_100007900 3300005467 Bacteria 9934
48 Ga0070706_100027110 3300005467 Bacteria 5272
49 Ga0070706_100034131 3300005467 Bacteria 4697
50 Ga0070706_100139786 3300005467 Bacteria 2260
51 Ga0070706_100548439 3300005467 Bacteria 1075
52 Ga0070707_100044232 3300005468 Bacteria 4262
53 Ga0070707_100060977 3300005468 Bacteria 3617
54 Ga0070707_100072874 3300005468 Bacteria 3311
55 Ga0070707_100117207 3300005468 Bacteria 2585
56 Ga0070707_100438943 3300005468 Bacteria 1266
57 Ga0070707_100449342 3300005468 Bacteria 1249
58 Ga0070707_100878867 3300005468 Bacteria 861
59 Ga0070707_100958796 3300005468 Bacteria 820
60 Ga0070707_101835444 3300005468 Bacteria 573
61 Ga0070698_100000416 3300005471 Bacteria 45414
62 Ga0070698_100048093 3300005471 Bacteria 4358
63 Ga0070698_100296885 3300005471 Bacteria 1547
64 Ga0070698_100304400 3300005471 Bacteria 1525
65 Ga0070699_100010664 3300005518 Bacteria 7953
66 Ga0070699_100013305 3300005518 Bacteria 7096
67 Ga0070699_100042082 3300005518 Bacteria 3952
68 Ga0070699_100054171 3300005518 Bacteria 3472
69 Ga0070699_100167452 3300005518 Bacteria 1947
70 Ga0070699_100173212 3300005518 Bacteria 1913
71 Ga0070699_100344020 3300005518 Bacteria 1342
72 Ga0070699_100480363 3300005518 Bacteria 1128
73 Ga0070679_100442343 3300005530 Unclassified 1245
74 Ga0070697_100049685 3300005536 Bacteria 3404
75 Ga0070697_100240511 3300005536 Bacteria 1546
76 Ga0070697_100342187 3300005536 Bacteria 1291
77 Ga0070695_100028089 3300005545 Bacteria 3489
78 Ga0070695_100035587 3300005545 Bacteria 3128
79 Ga0070695_100104886 3300005545 Bacteria 1909
80 Ga0070696_100071808 3300005546 Bacteria 2436
81 Ga0070696_100138800 3300005546 Bacteria 1774
82 Ga0070696_100331658 3300005546 Bacteria 1173
83 Ga0070696_100338390 3300005546 Bacteria 1162
84 Ga0070696_100538865 3300005546 Bacteria 934
85 Ga0070696_101276059 3300005546 Bacteria 623
86 Ga0070696_101893209 3300005546 Unclassified 516
87 Ga0070693_100299299 3300005547 Unclassified 1084
88 Ga0070704_100007259 3300005549 Bacteria 6592
89 Ga0070704_100192752 3300005549 Bacteria 1639
90 Ga0070704_100282679 3300005549 Bacteria 1375
91 Ga0070704_100345991 3300005549 Bacteria 1253
92 Ga0070704_101497885 3300005549 Bacteria 620
93 Ga0070702_100227511 3300005615 Bacteria 1251
94 Ga0070702_100378911 3300005615 Bacteria 1005
95 Ga0068861_100593766 3300005719 Unclassified 1015
96 Ga0070715_10234621 3300006163 Bacteria 951
97 Ga0070716_100000833 3300006173 Bacteria 13306
98 Ga0070712_100845247 3300006175 Bacteria 787
99 Ga0075428_100072133 3300006844 Bacteria 3773
100 Ga0075428_100708033 3300006844 Bacteria 1073
101 Ga0075428_101472602 3300006844 Bacteria 714
102 Ga0075430_100415956 3300006846 Bacteria 1110
103 Ga0075430_101710854 3300006846 Bacteria 516
104 Ga0075431_100161292 3300006847 Bacteria 2305
105 Ga0075431_100304256 3300006847 Bacteria 1610
106 Ga0075433_10000946 3300006852 Bacteria 20505
107 Ga0075433_10012213 3300006852 Bacteria 6927
108 Ga0075433_10207593 3300006852 Bacteria 1741
109 Ga0075433_10222011 3300006852 Bacteria 1678
110 Ga0075433_10547301 3300006852 Bacteria 1018
111 Ga0075433_10671142 3300006852 Bacteria 908
112 Ga0075434_100017892 3300006871 Bacteria 6836
113 Ga0075434_100063169 3300006871 Bacteria 3686
114 Ga0075434_100110214 3300006871 Bacteria 2763
115 Ga0075434_100316051 3300006871 Bacteria 1582
116 Ga0075434_100342334 3300006871 Bacteria 1516
117 Ga0075434_100378950 3300006871 Bacteria 1435
118 Ga0075434_100421663 3300006871 Bacteria 1355
119 Ga0075434_100661839 3300006871 Bacteria 1062
120 Ga0075436_100000724 3300006914 Bacteria 21850
121 Ga0075436_100020245 3300006914 Bacteria 4566
122 Ga0075436_100021129 3300006914 Bacteria 4466
123 Ga0075436_100048460 3300006914 Bacteria 2931
124 Ga0075436_100128836 3300006914 Bacteria 1774
125 Ga0075436_100305135 3300006914 Bacteria 1141
126 Ga0075436_100592009 3300006914 Bacteria 816
127 Ga0075435_100027526 3300007076 Bacteria 4449
128 Ga0075435_100042270 3300007076 Bacteria 3646
129 Ga0075435_100063230 3300007076 Bacteria 3005
130 Ga0075435_100127538 3300007076 Bacteria 2127
131 Ga0075435_100415931 3300007076 Bacteria 1158
132 Ga0075435_100800048 3300007076 Bacteria 821
133 Ga0099794_10019423 3300007265 Bacteria 3061
134 Ga0099794_10042505 3300007265 Bacteria 2167
135 Ga0099794_10138625 3300007265 Bacteria 1231
136 Ga0099794_10223949 3300007265 Bacteria 967
137 Ga0099794_10318714 3300007265 Bacteria 806
138 Ga0099795_10074263 3300007788 Bacteria 1289
139 Ga0099795_10331361 3300007788 Bacteria 676
140 Ga0105251_10505974 3300009011 Unclassified 565
141 Ga0111539_10521482 3300009094 Bacteria 1384
142 Ga0114129_10124105 3300009147 Bacteria 3551
143 Ga0114129_10353240 3300009147 Bacteria 1947
144 Ga0114129_10365044 3300009147 Bacteria 1910
145 Ga0105242_10608603 3300009176 Bacteria 1056
146 Ga0105248_11871847 3300009177 Bacteria 681
147 Ga0099796_10222393 3300010159 Bacteria 774
148 Ga0209566_100113 3300025225 Bacteria 109893
149 Ga0207653_10000333 3300025885 Bacteria 24834
150 Ga0207653_10010048 3300025885 Bacteria 2951
151 Ga0207685_10053815 3300025905 Bacteria 1565
152 Ga0207685_10176384 3300025905 Bacteria 987
153 Ga0207699_10005787 3300025906 Bacteria 5946
154 Ga0207699_10046333 3300025906 Bacteria 2543
155 Ga0207699_10529162 3300025906 Bacteria 853
156 Ga0207684_10012760 3300025910 Bacteria 7287
157 Ga0207684_10015791 3300025910 Bacteria 6494
158 Ga0207684_10119077 3300025910 Bacteria 2263
159 Ga0207684_10231720 3300025910 Bacteria 1593
160 Ga0207684_10491548 3300025910 Bacteria 1052
161 Ga0207684_10641265 3300025910 Bacteria 905
162 Ga0207684_10963548 3300025910 Bacteria 715
163 Ga0207693_10304141 3300025915 Bacteria 1249
164 Ga0207663_10000556 3300025916 Bacteria 16472
165 Ga0207660_10104525 3300025917 Bacteria 2121
166 Ga0207660_10139308 3300025917 Bacteria 1854
167 Ga0207660_10194805 3300025917 Bacteria 1580
168 Ga0207662_10032449 3300025918 Bacteria 3040
169 Ga0207652_10418293 3300025921 Unclassified 1209
170 Ga0207646_10004203 3300025922 Bacteria 15766
171 Ga0207646_10021064 3300025922 Bacteria 6029
172 Ga0207646_10096705 3300025922 Bacteria 2646
173 Ga0207646_10163732 3300025922 Bacteria 2008
174 Ga0207646_10334028 3300025922 Bacteria 1369
175 Ga0207646_10359763 3300025922 Bacteria 1315
176 Ga0207646_10462778 3300025922 Bacteria 1144
177 Ga0207646_11036349 3300025922 Bacteria 724
178 Ga0207700_10315062 3300025928 Bacteria 1354
179 Ga0207700_10537536 3300025928 Bacteria 1036
180 Ga0207664_10425967 3300025929 Bacteria 1183
181 Ga0207686_10735040 3300025934 Bacteria 787
182 Ga0207670_10435867 3300025936 Bacteria 1054
183 Ga0207665_10001273 3300025939 Bacteria 17022
184 Ga0207708_10034526 3300026075 Bacteria 3846
185 Ga0207648_10803701 3300026089 Bacteria 875
186 Ga0207675_100610362 3300026118 Unclassified 1094
187 Ga0209588_1001900 3300027671 Bacteria 5586
188 Ga0209588_1004374 3300027671 Bacteria 3981
189 Ga0209588_1115643 3300027671 Bacteria 860
190 Ga0209588_1185906 3300027671 Bacteria 651
191 Ga0268264_11738946 3300028381 Bacteria 634
192 Ga0265338_10423252 3300028800 Bacteria 946
193 Ga0265324_10179974 3300029957 Unclassified 718
194 Ga0265327_10117854 3300031251 Unclassified 1262
195 Ga0265327_10249992 3300031251 Unclassified 790
196 Ga0265316_10413675 3300031344 Bacteria 970
197 Ga0307509_10455043 3300031507 Bacteria 973
198 Ga0316576_10010664 3300031727 Bacteria 5985
199 Ga0316576_10154617 3300031727 Bacteria 1729
200 Ga0316576_10582226 3300031727 Bacteria 818
201 Ga0316576_10827913 3300031727 Bacteria 665
202 Ga0316576_10845368 3300031727 Bacteria 657
203 Ga0316578_10289941 3300031728 Bacteria 979
204 Ga0316578_10378048 3300031728 Bacteria 841
205 Ga0316577_10070922 3300031733 Bacteria 1944
206 Ga0316577_10208218 3300031733 Bacteria 1105
207 Ga0316577_10515869 3300031733 Unclassified 679
208 Ga0316580_10217832 3300032139 Bacteria 589
209 Ga0316580_10279028 3300032139 Unclassified 518
210 Ga0316593_10004513 3300032168 Bacteria 3582
211 Ga0316593_10022482 3300032168 Bacteria 1981
212 Ga0316593_10047563 3300032168 Bacteria 1443
213 Ga0316593_10048381 3300032168 Bacteria 1431
214 Ga0316593_10051776 3300032168 Unclassified 1389
215 Ga0316593_10052750 3300032168 Unclassified 1377
216 Ga0316593_10083893 3300032168 Unclassified 1115
217 Ga0316593_10089570 3300032168 Bacteria 1082
218 Ga0316593_10093080 3300032168 Bacteria 1063
219 Ga0316593_10165215 3300032168 Bacteria 810
220 Ga0316593_10215056 3300032168 Bacteria 713
221 Ga0316592_1001236 3300033524 Bacteria 4033
222 Ga0316592_1002387 3300033524 Bacteria 3239
223 Ga0316592_1008478 3300033524 Bacteria 2034
224 Ga0316592_1015698 3300033524 Bacteria 1578
225 Ga0316592_1018789 3300033524 Bacteria 1459
226 Ga0316592_1034129 3300033524 Bacteria 1113
227 Ga0316592_1039549 3300033524 Bacteria 1042
228 Ga0316592_1113073 3300033524 Bacteria 628
229 Ga0316586_1030656 3300033527 Bacteria 920
230 Ga0316588_1009326 3300033528 Bacteria 2045
231 Ga0316588_1020653 3300033528 Bacteria 1493
232 Ga0316588_1035338 3300033528 Bacteria 1184
233 Ga0316588_1082844 3300033528 Unclassified 795
234 Ga0316588_1151084 3300033528 Unclassified 596
235 Ga0316587_1004138 3300033529 Bacteria 2090
236 Ga0316596_1000599 3300033541 Bacteria 6357
237 Ga0316596_1001565 3300033541 Bacteria 4665
238 Ga0316596_1013933 3300033541 Bacteria 1988
239 Ga0316596_1020637 3300033541 Unclassified 1677
240 Ga0316596_1023730 3300033541 Bacteria 1572
241 Ga0316596_1028088 3300033541 Bacteria 1453
242 Ga0316596_1029358 3300033541 Unclassified 1423
243 Ga0316596_1031283 3300033541 Bacteria 1382
244 Ga0316596_1035844 3300033541 Bacteria 1296
245 Ga0316596_1076711 3300033541 Bacteria 897
246 Ga0316596_1087554 3300033541 Unclassified 839
247 Ga0373932_0079127 3300035112 Bacteria 1035
248 Ga0373953_0220421 3300035117 Bacteria 822
249 Ga0373954_0482314 3300035118 Bacteria 614
250 Ga0373954_0696110 3300035118 Bacteria 504
251 Ga0373956_0247342 3300035119 Bacteria 848
252 Ga0316574_0008420 3300035398 Bacteria 5725
253 Ga0316574_0045215 3300035398 Bacteria 2726
254 Ga0316574_0286529 3300035398 Bacteria 1049
255 Ga0316574_0532025 3300035398 Bacteria 731
256 Ga0316574_0727424 3300035398 Bacteria 607
257 Ga0316574_0852460 3300035398 Bacteria 553
258 Ga0373933_0224128 3300035724 Bacteria 1207
259 Ga0373937_0465758 3300036401 Bacteria 1200
260 Ga0316582_0048546 3300036647 Bacteria 2684
261 Ga0316582_0136489 3300036647 Bacteria 1651
262 Ga0316582_0634284 3300036647 Bacteria 735
263 Ga0316584_0064252 3300036712 Bacteria 2748
264 Ga0316584_0199920 3300036712 Bacteria 1475
265 Ga0316584_0538047 3300036712 Bacteria 817
266 Ga0400484_27126 3300038725 Bacteria 1118
267 Ga0400490_02528 3300038726 Bacteria 1112
268 Ga0400488_54121 3300038741 Bacteria 2660
269 Ga0242420_018127 3300038996 Bacteria 1237
270 Ga0242420_065021 3300038996 Bacteria 733
271 Ga0400483_025368 3300039062 Bacteria 10003
272 Ga0400483_047173 3300039062 Bacteria 1510
273 Ga0400483_130835 3300039062 Bacteria 1200
274 Ga0400483_236848 3300039062 Bacteria 1419
275 Ga0400489_18718 3300039093 Bacteria 9448
276 Ga0400489_29617 3300039093 Bacteria 1351
277 Ga0400487_66491 3300039110 Bacteria 2033
278 Ga0451795_0977824 3300041456 Bacteria 2168
279 Ga0451837_0839968 3300041494 Bacteria 911
280 Ga0451577_0000035 3300042876 Bacteria 373467
281 Ga0451577_0001455 3300042876 Bacteria 31470
282 Ga0451577_0005950 3300042876 Bacteria 12301
283 Ga0451577_0014478 3300042876 Bacteria 7353
284 Ga0451577_0019300 3300042876 Bacteria 6270
285 Ga0451577_0080646 3300042876 Unclassified 2902
286 Ga0451577_0084759 3300042876 Bacteria 2827
287 Ga0451577_0134032 3300042876 Bacteria 2223
288 Ga0451577_0159139 3300042876 Bacteria 2033
289 Ga0451577_0204370 3300042876 Bacteria 1783
290 Ga0451577_0331332 3300042876 Bacteria 1381
291 Ga0451577_0347994 3300042876 Bacteria 1344
292 Ga0451577_0388643 3300042876 Bacteria 1266
293 Ga0451577_0542091 3300042876 Bacteria 1056
294 Ga0451577_0555635 3300042876 Unclassified 1042
295 Ga0451577_0747300 3300042876 Bacteria 885
296 Ga0451577_0965553 3300042876 Bacteria 766
297 Ga0451577_1174854 3300042876 Bacteria 685
298 Ga0451577_1801651 3300042876 Bacteria 537
299 Ga0453683_0000002 3300044673 Bacteria 1244396
300 Ga0453683_0000048 3300044673 Bacteria 207480
301 Ga0453683_0000058 3300044673 Bacteria 189089
302 Ga0453683_0000067 3300044673 Bacteria 164438
303 Ga0453683_0000236 3300044673 Bacteria 73105
304 Ga0453683_0001452 3300044673 Bacteria 20459
305 Ga0453683_0005568 3300044673 Bacteria 8764
306 Ga0453683_0071704 3300044673 Bacteria 2168
307 Ga0453683_0090358 3300044673 Bacteria 1919
308 Ga0453683_0108030 3300044673 Bacteria 1749
309 Ga0453683_0138214 3300044673 Bacteria 1537
310 Ga0453683_0156947 3300044673 Unclassified 1439
311 Ga0453683_0227008 3300044673 Bacteria 1188
312 Ga0453683_0392527 3300044673 Unclassified 894
313 Ga0453683_0553790 3300044673 Bacteria 748
314 Ga0453683_1027339 3300044673 Unclassified 548
315 Ga0453684_0000097 3300044712 Bacteria 377772
316 Ga0453684_0000209 3300044712 Bacteria 255543
317 Ga0453684_0002386 3300044712 Bacteria 45826
318 Ga0453684_0004226 3300044712 Bacteria 30795
319 Ga0453684_0010758 3300044712 Bacteria 15539
320 Ga0453684_0012581 3300044712 Bacteria 13925
321 Ga0453684_0014570 3300044712 Bacteria 12555
322 Ga0453684_0018024 3300044712 Bacteria 10871
323 Ga0453684_0022329 3300044712 Bacteria 9394
324 Ga0453684_0023712 3300044712 Bacteria 9014
325 Ga0453684_0044199 3300044712 Bacteria 5968
326 Ga0453684_0058214 3300044712 Bacteria 4993
327 Ga0453684_0072732 3300044712 Bacteria 4338
328 Ga0453684_0098443 3300044712 Bacteria 3585
329 Ga0453684_0120292 3300044712 Bacteria 3172
330 Ga0453684_0149751 3300044712 Bacteria 2774
331 Ga0453684_0168607 3300044712 Bacteria 2582
332 Ga0453684_0187591 3300044712 Bacteria 2421
333 Ga0453684_0199780 3300044712 Bacteria 2331
334 Ga0453684_0250687 3300044712 Bacteria 2033
335 Ga0453684_0322073 3300044712 Unclassified 1750
336 Ga0453684_0375999 3300044712 Bacteria 1596
337 Ga0453684_0472163 3300044712 Bacteria 1393
338 Ga0453684_0681084 3300044712 Bacteria 1119
339 Ga0453684_0725997 3300044712 Bacteria 1077
340 Ga0453684_1936874 3300044712 Bacteria 595
341 Ga0453684_2214541 3300044712 Bacteria 548
342 Ga0453684_2304211 3300044712 Bacteria 535
343 Ga0451576_0000303 3300045051 Bacteria 119347
344 Ga0451576_0002682 3300045051 Bacteria 25918
345 Ga0451576_0003254 3300045051 Bacteria 22530
346 Ga0451576_0018762 3300045051 Bacteria 7564
347 Ga0451576_0042237 3300045051 Bacteria 4814
348 Ga0451576_0043831 3300045051 Bacteria 4719
349 Ga0451576_0062713 3300045051 Bacteria 3875
350 Ga0451576_0117799 3300045051 Bacteria 2765
351 Ga0451576_0150441 3300045051 Bacteria 2428
352 Ga0451576_0156599 3300045051 Bacteria 2376
353 Ga0451576_0205827 3300045051 Bacteria 2055
354 Ga0451576_0246543 3300045051 Bacteria 1867
355 Ga0451576_0297974 3300045051 Bacteria 1686
356 Ga0451576_0304431 3300045051 Bacteria 1667
357 Ga0451576_0441201 3300045051 Bacteria 1366
358 Ga0451576_0463643 3300045051 Bacteria 1330
359 Ga0451576_0600709 3300045051 Bacteria 1156
360 Ga0451576_0610053 3300045051 Bacteria 1147
361 Ga0451576_0890415 3300045051 Bacteria 934
362 Ga0451576_0976953 3300045051 Bacteria 888
363 Ga0451576_1205331 3300045051 Bacteria 790
364 Ga0451576_1266413 3300045051 Bacteria 769
365 Ga0451576_1465437 3300045051 Bacteria 709
366 Ga0451576_1524791 3300045051 Bacteria 694
367 Ga0451576_2547845 3300045051 Bacteria 522
368 Ga0495639_0445751 3300046475 Bacteria 657
369 Ga0495606_0408003 3300046507 Bacteria 706
370 Ga0495644_0221739 3300046523 Unclassified 731
371 Ga0495663_0075972 3300046525 Bacteria 1076
372 Ga0495642_0227139 3300046528 Unclassified 815
373 Ga0495598_0009203 3300046537 Bacteria 2327
374 Ga0495598_0402985 3300046537 Bacteria 535
375 Ga0495621_0020976 3300046539 Bacteria 2150
376 Ga0495621_0065263 3300046539 Bacteria 1330
377 Ga0495622_0522153 3300046557 Bacteria 507
378 Ga0495656_0000017 3300046615 Bacteria 121976
379 Ga0495658_0492648 3300046683 Bacteria 784
380 Ga0495669_0345691 3300046684 Unclassified 719
381 Ga0495604_0169698 3300047317 Bacteria 1536
382 Ga0495636_0038442 3300047318 Bacteria 1980
383 Ga0495636_0252289 3300047318 Bacteria 816
384 Ga0495636_0670658 3300047318 Bacteria 510
385 Ga0495677_0198860 3300047445 Unclassified 779
386 Ga0495615_0038452 3300048090 Bacteria 1183
387 Ga0495615_0076649 3300048090 Bacteria 910
388 Ga0496101_0202221 3300048904 Bacteria 1536
389 Ga0496102_1423774 3300048905 Bacteria 612
390 Ga0496110_0389240 3300048913 Unclassified 1271
391 Ga0496111_0582119 3300048914 Bacteria 820
392 Ga0496112_0041441 3300048915 Bacteria 4506
393 Ga0496113_0398671 3300048916 Bacteria 1105
394 Ga0501034_0279795 3300049571 Bacteria 1608
395 Ga0501034_0795461 3300049571 Bacteria 839
396 Ga0501034_1589164 3300049571 Bacteria 527
397 Ga0501068_0090973 3300049584 Bacteria 1883
398 Ga0501071_0800179 3300049587 Bacteria 727
399 Ga0501076_0765279 3300049592 Bacteria 797
400 Ga0501044_0995721 3300049823 Bacteria 710
401 nmdc:mga05p37_119906_c1 3300050507 Bacteria 3232
402 nmdc:mga05p37_1515570_c1 3300050507 Bacteria 667
403 nmdc:mga05p37_475500_c1 3300050507 Bacteria 1441
404 nmdc:mga0qj67_145091_c1 3300050509 Bacteria 1924
405 nmdc:mga0qj67_789213_c1 3300050509 Bacteria 752
406 nmdc:mga06r32_1178273_c1 3300050510 Bacteria 713
407 nmdc:mga06r32_38358_c1 3300050510 Bacteria 4539
408 nmdc:mga06r32_463257_c1 3300050510 Bacteria 1246
409 nmdc:mga06r32_698871_c1 3300050510 Bacteria 980
410 nmdc:mga0n895_1180009_c1 3300050512 Bacteria 740
411 nmdc:mga0n895_133176_c1 3300050512 Bacteria 2512
412 nmdc:mga0n895_1944162_c1 3300050512 Bacteria 547
413 nmdc:mga0n895_21697_c1 3300050512 Bacteria 6010
414 nmdc:mga0n895_226305_c1 3300050512 Bacteria 1899
415 nmdc:mga0n895_3234_c1 3300050512 Bacteria 13055
416 nmdc:mga0n895_386174_c1 3300050512 Bacteria 1416
417 nmdc:mga0n895_52641_c1 3300050512 Bacteria 3997
418 nmdc:mga0rr50_1002451_c1 3300050513 Bacteria 712
419 nmdc:mga0rr50_132016_c1 3300050513 Bacteria 2001
420 nmdc:mga0rr50_146591_c1 3300050513 Bacteria 1904
421 nmdc:mga0rr50_1677859_c1 3300050513 Bacteria 536
422 nmdc:mga0rr50_276453_c1 3300050513 Bacteria 1401
423 nmdc:mga0rr50_40716_c1 3300050513 Bacteria 3380
424 nmdc:mga0rr50_527794_c1 3300050513 Bacteria 1005
425 nmdc:mga0rr50_53414_c1 3300050513 Bacteria 3006
426 nmdc:mga08x19_106249_c1 3300050514 Bacteria 1868
427 nmdc:mga08x19_108161_c1 3300050514 Bacteria 1852
428 nmdc:mga08x19_1185667_c1 3300050514 Bacteria 541
429 nmdc:mga08x19_159446_c1 3300050514 Bacteria 1532
430 nmdc:mga08x19_170353_c1 3300050514 Bacteria 1483
431 nmdc:mga08x19_17199_c1 3300050514 Bacteria 4421
432 nmdc:mga08x19_251389_c1 3300050514 Bacteria 1220
433 nmdc:mga08x19_47965_c1 3300050514 Bacteria 2735
434 nmdc:mga08x19_627816_c1 3300050514 Bacteria 762
435 nmdc:mga08x19_90347_c1 3300050514 Bacteria 2021
436 nmdc:mga08x19_91899_c1 3300050514 Bacteria 2004
437 nmdc:mga0a205_112266_c1 3300050515 Bacteria 2625
438 nmdc:mga0a205_429358_c1 3300050515 Bacteria 1183
439 nmdc:mga0a205_77592_c1 3300050515 Bacteria 3210
440 nmdc:mga0a205_823_c1 3300050515 Bacteria 25240
441 Ga0500639_105220 3300053163 Bacteria 1382
442 Ga0500567_206002 3300053723 Bacteria 648
443 2617913249 2617270889 Bacteria 9064343
444 2738838278 2738541299 Bacteria 4020721
445 2831431307 2831426010 Bacteria 8662725
446 2848699625 2848694841 Bacteria 9205737
447 2849668072 2849660919 Bacteria 8251853
448 2886629831 2886627955 Bacteria 7618130
449 2913845305 2913844669 Bacteria 8381711
450 2913942375 2913939268 Bacteria 8559644
451 3006971926 3006969106 Bacteria 4739423
452 642603893 642555144 Bacteria 9059191
453 8002324610 8002317523 Bacteria 8051857
454 8046991760 8046991243 Bacteria 8497463
455 Ga0099794_10168218
456 Ga0065704_10487266
457 Ga0065707_10001702
458 Ga0065707_10128557
459 Ga0065707_10603304
460 Ga0070680_100085827
461 Ga0070680_100398548
462 Ga0070691_10561081
463 Ga0070687_100035538
464 Ga0070692_10034063
465 Ga0070703_10010620
466 Ga0070703_10010689
467 Ga0070703_10085390
468 Ga0070703_10350852
469 Ga0070709_10002412
470 Ga0070709_10057272
471 Ga0070709_10146828
472 Ga0070714_100120869
473 Ga0070713_100141639
474 Ga0070713_100247215
475 Ga0070701_10001843
476 Ga0070711_100000466
477 Ga0070705_100072691
478 Ga0070705_100214555
479 Ga0070705_100485500
480 Ga0070705_100521768
481 Ga0070700_100144922
482 Ga0070694_100003097
483 Ga0070694_100035006
484 Ga0070694_100096351
485 Ga0070694_100480803
486 Ga0070694_100690138
487 Ga0070694_100762708
488 Ga0070694_101944288
489 Ga0070708_100001912
490 Ga0070708_100042312
491 Ga0070708_100107478
492 Ga0070708_100123418
493 Ga0070708_100211359
494 Ga0070708_100311951
495 Ga0070708_100365274
496 Ga0070708_100974059
497 Ga0070708_101485594
498 Ga0070663_100700751
499 Ga0068867_100232782
500 Ga0070706_100003511
501 Ga0070706_100007900
502 Ga0070706_100027110
503 Ga0070706_100034131
504 Ga0070706_100139786
505 Ga0070706_100548439
506 Ga0070707_100044232
507 Ga0070707_100060977
508 Ga0070707_100072874
509 Ga0070707_100117207
510 Ga0070707_100438943
511 Ga0070707_100449342
512 Ga0070707_100878867
513 Ga0070707_100958796
514 Ga0070707_101835444
515 Ga0070698_100000416
516 Ga0070698_100048093
517 Ga0070698_100296885
518 Ga0070698_100304400
519 Ga0070699_100010664
520 Ga0070699_100013305
521 Ga0070699_100042082
522 Ga0070699_100054171
523 Ga0070699_100167452
524 Ga0070699_100173212
525 Ga0070699_100344020
526 Ga0070699_100480363
527 Ga0070679_100442343
528 Ga0070697_100049685
529 Ga0070697_100240511
530 Ga0070697_100342187
531 Ga0070695_100028089
532 Ga0070695_100035587
533 Ga0070695_100104886
534 Ga0070696_100071808
535 Ga0070696_100138800
536 Ga0070696_100331658
537 Ga0070696_100338390
538 Ga0070696_100538865
539 Ga0070696_101276059
540 Ga0070696_101893209
541 Ga0070693_100299299
542 Ga0070704_100007259
543 Ga0070704_100192752
544 Ga0070704_100282679
545 Ga0070704_100345991
546 Ga0070704_101497885
547 Ga0070702_100227511
548 Ga0070702_100378911
549 Ga0068861_100593766
550 Ga0070715_10234621
551 Ga0070716_100000833
552 Ga0070712_100845247
553 Ga0075428_100072133
554 Ga0075428_100708033
555 Ga0075428_101472602
556 Ga0075430_100415956
557 Ga0075430_101710854
558 Ga0075431_100161292
559 Ga0075431_100304256
560 Ga0075433_10000946
561 Ga0075433_10012213
562 Ga0075433_10207593
563 Ga0075433_10222011
564 Ga0075433_10547301
565 Ga0075433_10671142
566 Ga0075434_100017892
567 Ga0075434_100063169
568 Ga0075434_100110214
569 Ga0075434_100316051
570 Ga0075434_100342334
571 Ga0075434_100378950
572 Ga0075434_100421663
573 Ga0075434_100661839
574 Ga0075436_100000724
575 Ga0075436_100020245
576 Ga0075436_100021129
577 Ga0075436_100048460
578 Ga0075436_100128836
579 Ga0075436_100305135
580 Ga0075436_100592009
581 Ga0075435_100027526
582 Ga0075435_100042270
583 Ga0075435_100063230
584 Ga0075435_100127538
585 Ga0075435_100415931
586 Ga0075435_100800048
587 Ga0099794_10019423
588 Ga0099794_10042505
589 Ga0099794_10138625
590 Ga0099794_10223949
591 Ga0099794_10318714
592 Ga0099795_10074263
593 Ga0099795_10331361
594 Ga0105251_10505974
595 Ga0111539_10521482
596 Ga0114129_10124105
597 Ga0114129_10353240
598 Ga0114129_10365044
599 Ga0105242_10608603
600 Ga0105248_11871847
601 Ga0099796_10222393
602 Ga0209566_100113
603 Ga0207653_10000333
604 Ga0207653_10010048
605 Ga0207685_10053815
606 Ga0207685_10176384
607 Ga0207699_10005787
608 Ga0207699_10046333
609 Ga0207699_10529162
610 Ga0207684_10012760
611 Ga0207684_10015791
612 Ga0207684_10119077
613 Ga0207684_10231720
614 Ga0207684_10491548
615 Ga0207684_10641265
616 Ga0207684_10963548
617 Ga0207693_10304141
618 Ga0207663_10000556
619 Ga0207660_10104525
620 Ga0207660_10139308
621 Ga0207660_10194805
622 Ga0207662_10032449
623 Ga0207652_10418293
624 Ga0207646_10004203
625 Ga0207646_10021064
626 Ga0207646_10096705
627 Ga0207646_10163732
628 Ga0207646_10334028
629 Ga0207646_10359763
630 Ga0207646_10462778
631 Ga0207646_11036349
632 Ga0207700_10315062
633 Ga0207700_10537536
634 Ga0207664_10425967
635 Ga0207686_10735040
636 Ga0207670_10435867
637 Ga0207665_10001273
638 Ga0207708_10034526
639 Ga0207648_10803701
640 Ga0207675_100610362
641 Ga0209588_1001900
642 Ga0209588_1004374
643 Ga0209588_1115643
644 Ga0209588_1185906
645 Ga0268264_11738946
646 Ga0265338_10423252
647 Ga0265324_10179974
648 Ga0265327_10117854
649 Ga0265327_10249992
650 Ga0265316_10413675
651 Ga0307509_10455043
652 Ga0316576_10010664
653 Ga0316576_10154617
654 Ga0316576_10582226
655 Ga0316576_10827913
656 Ga0316576_10845368
657 Ga0316578_10289941
658 Ga0316578_10378048
659 Ga0316577_10070922
660 Ga0316577_10208218
661 Ga0316577_10515869
662 Ga0316580_10217832
663 Ga0316580_10279028
664 Ga0316593_10004513
665 Ga0316593_10022482
666 Ga0316593_10047563
667 Ga0316593_10048381
668 Ga0316593_10051776
669 Ga0316593_10052750
670 Ga0316593_10083893
671 Ga0316593_10089570
672 Ga0316593_10093080
673 Ga0316593_10165215
674 Ga0316593_10215056
675 Ga0316592_1001236
676 Ga0316592_1002387
677 Ga0316592_1008478
678 Ga0316592_1015698
679 Ga0316592_1018789
680 Ga0316592_1034129
681 Ga0316592_1039549
682 Ga0316592_1113073
683 Ga0316586_1030656
684 Ga0316588_1009326
685 Ga0316588_1020653
686 Ga0316588_1035338
687 Ga0316588_1082844
688 Ga0316588_1151084
689 Ga0316587_1004138
690 Ga0316596_1000599
691 Ga0316596_1001565
692 Ga0316596_1013933
693 Ga0316596_1020637
694 Ga0316596_1023730
695 Ga0316596_1028088
696 Ga0316596_1029358
697 Ga0316596_1031283
698 Ga0316596_1035844
699 Ga0316596_1076711
700 Ga0316596_1087554
701 Ga0373932_0079127
702 Ga0373953_0220421
703 Ga0373954_0482314
704 Ga0373954_0696110
705 Ga0373956_0247342
706 Ga0316574_0008420
707 Ga0316574_0045215
708 Ga0316574_0286529
709 Ga0316574_0532025
710 Ga0316574_0727424
711 Ga0316574_0852460
712 Ga0373933_0224128
713 Ga0373937_0465758
714 Ga0316582_0048546
715 Ga0316582_0136489
716 Ga0316582_0634284
717 Ga0316584_0064252
718 Ga0316584_0199920
719 Ga0316584_0538047
720 Ga0400484_27126
721 Ga0400490_02528
722 Ga0400488_54121
723 Ga0242420_018127
724 Ga0242420_065021
725 Ga0400483_025368
726 Ga0400483_047173
727 Ga0400483_130835
728 Ga0400483_236848
729 Ga0400489_18718
730 Ga0400489_29617
731 Ga0400487_66491
732 Ga0451795_0977824
733 Ga0451837_0839968
734 Ga0451577_0000035
735 Ga0451577_0001455
736 Ga0451577_0005950
737 Ga0451577_0014478
738 Ga0451577_0019300
739 Ga0451577_0080646
740 Ga0451577_0084759
741 Ga0451577_0134032
742 Ga0451577_0159139
743 Ga0451577_0204370
744 Ga0451577_0331332
745 Ga0451577_0347994
746 Ga0451577_0388643
747 Ga0451577_0542091
748 Ga0451577_0555635
749 Ga0451577_0747300
750 Ga0451577_0965553
751 Ga0451577_1174854
752 Ga0451577_1801651
753 Ga0453683_0000002
754 Ga0453683_0000048
755 Ga0453683_0000058
756 Ga0453683_0000067
757 Ga0453683_0000236
758 Ga0453683_0001452
759 Ga0453683_0005568
760 Ga0453683_0071704
761 Ga0453683_0090358
762 Ga0453683_0108030
763 Ga0453683_0138214
764 Ga0453683_0156947
765 Ga0453683_0227008
766 Ga0453683_0392527
767 Ga0453683_0553790
768 Ga0453683_1027339
769 Ga0453684_0000097
770 Ga0453684_0000209
771 Ga0453684_0002386
772 Ga0453684_0004226
773 Ga0453684_0010758
774 Ga0453684_0012581
775 Ga0453684_0014570
776 Ga0453684_0018024
777 Ga0453684_0022329
778 Ga0453684_0023712
779 Ga0453684_0044199
780 Ga0453684_0058214
781 Ga0453684_0072732
782 Ga0453684_0098443
783 Ga0453684_0120292
784 Ga0453684_0149751
785 Ga0453684_0168607
786 Ga0453684_0187591
787 Ga0453684_0199780
788 Ga0453684_0250687
789 Ga0453684_0322073
790 Ga0453684_0375999
791 Ga0453684_0472163
792 Ga0453684_0681084
793 Ga0453684_0725997
794 Ga0453684_1936874
795 Ga0453684_2214541
796 Ga0453684_2304211
797 Ga0451576_0000303
798 Ga0451576_0002682
799 Ga0451576_0003254
800 Ga0451576_0018762
801 Ga0451576_0042237
802 Ga0451576_0043831
803 Ga0451576_0062713
804 Ga0451576_0117799
805 Ga0451576_0150441
806 Ga0451576_0156599
807 Ga0451576_0205827
808 Ga0451576_0246543
809 Ga0451576_0297974
810 Ga0451576_0304431
811 Ga0451576_0441201
812 Ga0451576_0463643
813 Ga0451576_0600709
814 Ga0451576_0610053
815 Ga0451576_0890415
816 Ga0451576_0976953
817 Ga0451576_1205331
818 Ga0451576_1266413
819 Ga0451576_1465437
820 Ga0451576_1524791
821 Ga0451576_2547845
822 Ga0495639_0445751
823 Ga0495606_0408003
824 Ga0495644_0221739
825 Ga0495663_0075972
826 Ga0495642_0227139
827 Ga0495598_0009203
828 Ga0495598_0402985
829 Ga0495621_0020976
830 Ga0495621_0065263
831 Ga0495622_0522153
832 Ga0495656_0000017
833 Ga0495658_0492648
834 Ga0495669_0345691
835 Ga0495604_0169698
836 Ga0495636_0038442
837 Ga0495636_0252289
838 Ga0495636_0670658
839 Ga0495677_0198860
840 Ga0495615_0038452
841 Ga0495615_0076649
842 Ga0496101_0202221
843 Ga0496102_1423774
844 Ga0496110_0389240
845 Ga0496111_0582119
846 Ga0496112_0041441
847 Ga0496113_0398671
848 Ga0501034_0279795
849 Ga0501034_0795461
850 Ga0501034_1589164
851 Ga0501068_0090973
852 Ga0501071_0800179
853 Ga0501076_0765279
854 Ga0501044_0995721
855 nmdc:mga05p37_119906_c1
856 nmdc:mga05p37_1515570_c1
857 nmdc:mga05p37_475500_c1
858 nmdc:mga0qj67_145091_c1
859 nmdc:mga0qj67_789213_c1
860 nmdc:mga06r32_1178273_c1
861 nmdc:mga06r32_38358_c1
862 nmdc:mga06r32_463257_c1
863 nmdc:mga06r32_698871_c1
864 nmdc:mga0n895_1180009_c1
865 nmdc:mga0n895_133176_c1
866 nmdc:mga0n895_1944162_c1
867 nmdc:mga0n895_21697_c1
868 nmdc:mga0n895_226305_c1
869 nmdc:mga0n895_3234_c1
870 nmdc:mga0n895_386174_c1
871 nmdc:mga0n895_52641_c1
872 nmdc:mga0rr50_1002451_c1
873 nmdc:mga0rr50_132016_c1
874 nmdc:mga0rr50_146591_c1
875 nmdc:mga0rr50_1677859_c1
876 nmdc:mga0rr50_276453_c1
877 nmdc:mga0rr50_40716_c1
878 nmdc:mga0rr50_527794_c1
879 nmdc:mga0rr50_53414_c1
880 nmdc:mga08x19_106249_c1
881 nmdc:mga08x19_108161_c1
882 nmdc:mga08x19_1185667_c1
883 nmdc:mga08x19_159446_c1
884 nmdc:mga08x19_170353_c1
885 nmdc:mga08x19_17199_c1
886 nmdc:mga08x19_251389_c1
887 nmdc:mga08x19_47965_c1
888 nmdc:mga08x19_627816_c1
889 nmdc:mga08x19_90347_c1
890 nmdc:mga08x19_91899_c1
891 nmdc:mga0a205_112266_c1
892 nmdc:mga0a205_429358_c1
893 nmdc:mga0a205_77592_c1
894 nmdc:mga0a205_823_c1
895 Ga0500639_105220
896 Ga0500567_206002
897 2617913249
898 2738838278
899 2831431307
900 2848699625
901 2849668072
902 2886629831
903 2913845305
904 2913942375
905 3006971926
906 642603893
907 8002324610
908 8046991760

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00453

Ribosomal_L20

Ribosomal protein L20

3

109

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.8784 51 117
1gyz-assembly1.cif.gz_A bacterial ribosomal protein l20 from aquifex aeolicus 0.8577 61 116
4v48-assembly1.cif.gz_AO real space refined coordinates of the 30s and 50s subunits fitted into the low resolution cryo-em map of the initiation-like state of e. coli 70s ribosome 0.8559 51 117
1gyz-assembly1.cif.gz_A bacterial ribosomal protein l20 from aquifex aeolicus 0.7968 61 116
7pkt-assembly1.cif.gz_o large subunit of the chlamydomonas reinhardtii mitoribosome 0.7876 14 114
ID Description Score Start End Superfamily
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.9589 53 116 1.10.1900.20
2ghjB02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8964 58 116 1.10.1900.20
2ghjD02 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8786 53 116 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.8577 61 116 1.10.1900.20
1gyzA00 Mainly Alpha;Orthogonal Bundle;c-terminal domain of poly(a) binding protein;Ribosomal protein L20, C-terminal domain 0.7968 61 116 1.10.1900.20
ID Description Score Start End GO Terms
AF-W4LHU2-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.012 64 116 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-G6EM08-F1-model_v4 deleted 1.007 57 116
AF-A0A7X7PKE9-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.007 60 116 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A357L7L9-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.006 61 116 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A354QTS7-F1-model_v4 Large ribosomal subunit protein bL20 (50S ribosomal protein L20) 1.005 53 116 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map