F447380

General Info

Members Datasets Scaffolds Average Seq Length
454 219 908 431

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10018713|Ga0157369_100187134
Length 510
Sequence LELPAFDDELPHETTSKENIIAAKRKTFFINGPRNKFQIVNESIRRFAMLSRSRRLRFVRVSDKLNSPIAQTNSSSAQSLARRLSLFDATMLVMGGIIGTGIFMNPYVVAQRVHTPALVLGAWLVGGCIALLGGFIWAELADRMPTAGGQYAYLRDAYDPLVSFLYGWVLLLVIQTGGMAAVTVTFSRYFLELTGRHAGEWQIAFVALSVLTIINCMGVRAGGTVQSGLMVLKIAAIALLVFAGAFLVHGHVQWKPVLDQPVSGGLFSSFGAAMVPVVFAFGGWHTATFASAEMKAPRRDLPRALIMGVIAVALLYLSVNXXXXHALGVSALANTPAPASAVMRMALGQRGATIIALAIAISTLGFLSQSVLTAPRVYFAMAQDRLFFRQLAWVHPRTQAPVLAIAIQSVWTMVILLTGGYDKILNYVTSMDVLFWAFTAGSLFILRRRDSSRSAFSMPGHPYTTALFCVVCLAVVGNTLYTYPENTLIGFAILAAGVPMYYIWRRTLRA

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
55 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
56 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
150 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
156 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
174 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
175 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
176 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
192 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
193 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
194 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
208 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
209 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
210 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
211 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
212 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
213 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
217 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
218 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
219 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 0
Rhizoplane 2.64
Rhizosphere 95.37
Stem 0
Stem Tuber 0
Unclassified 8.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10018713 3300013105 Bacteria 7767
2 JGI24740J21852_10004254 3300001979 Bacteria 6167
3 JGI24739J22299_10001795 3300001989 Bacteria 8170
4 JGI24739J22299_10002106 3300001989 Bacteria 7621
5 JGI24737J22298_10000419 3300001990 Bacteria 14540
6 JGI24738J21930_10000456 3300002075 Bacteria 11594
7 Ga0065712_10074837 3300005290 Bacteria 3996
8 Ga0065715_10116660 3300005293 Bacteria 2373
9 Ga0070658_10065055 3300005327 Bacteria 2975
10 Ga0070658_10067341 3300005327 Bacteria 2926
11 Ga0070658_10124625 3300005327 Bacteria 2143
12 Ga0070676_10000962 3300005328 Bacteria 14326
13 Ga0070676_10020752 3300005328 Bacteria 3672
14 Ga0070683_100021802 3300005329 Bacteria 5719
15 Ga0070683_100209656 3300005329 Bacteria 1851
16 Ga0070690_100028212 3300005330 Bacteria 3476
17 Ga0070670_100058462 3300005331 Bacteria 3310
18 Ga0070670_100067723 3300005331 Bacteria 3063
19 Ga0068869_100000249 3300005334 Bacteria 28378
20 Ga0068869_100048112 3300005334 Bacteria 3082
21 Ga0070666_10000853 3300005335 Bacteria 18463
22 Ga0070680_100000384 3300005336 Bacteria 29982
23 Ga0070680_100005554 3300005336 Bacteria 9544
24 Ga0070680_100084339 3300005336 Bacteria 2624
25 Ga0070680_100102557 3300005336 Bacteria 2376
26 Ga0070682_100061260 3300005337 Unclassified 2381
27 Ga0068868_100000113 3300005338 Bacteria 50799
28 Ga0070660_100023068 3300005339 Bacteria 4608
29 Ga0070660_100025786 3300005339 Bacteria 4372
30 Ga0070660_100072476 3300005339 Bacteria 2692
31 Ga0070660_100093480 3300005339 Bacteria 2375
32 Ga0070691_10000966 3300005341 Bacteria 11743
33 Ga0070661_100092609 3300005344 Bacteria 2239
34 Ga0070692_10087702 3300005345 Bacteria 1686
35 Ga0070668_100018349 3300005347 Bacteria 5252
36 Ga0070668_100168602 3300005347 Bacteria 1781
37 Ga0070669_100000155 3300005353 Bacteria 61710
38 Ga0070669_100031918 3300005353 Bacteria 3805
39 Ga0070669_100036775 3300005353 Bacteria 3549
40 Ga0070671_100003933 3300005355 Bacteria 11687
41 Ga0070671_100007800 3300005355 Bacteria 8551
42 Ga0070673_100000177 3300005364 Bacteria 31060
43 Ga0070673_100065928 3300005364 Bacteria 2891
44 Ga0070659_100000305 3300005366 Bacteria 38108
45 Ga0070659_100016610 3300005366 Bacteria 5528
46 Ga0070659_100024764 3300005366 Bacteria 4603
47 Ga0070667_100002102 3300005367 Bacteria 17561
48 Ga0070667_100060400 3300005367 Bacteria 3207
49 Ga0070709_10000041 3300005434 Bacteria 105988
50 Ga0070714_100013043 3300005435 Bacteria 6649
51 Ga0070714_100157375 3300005435 Bacteria 2052
52 Ga0070713_100010301 3300005436 Bacteria 6749
53 Ga0070710_10019990 3300005437 Bacteria 3469
54 Ga0070711_100000051 3300005439 Bacteria 73775
55 Ga0070711_100012252 3300005439 Bacteria 5351
56 Ga0070711_100021487 3300005439 Bacteria 4175
57 Ga0070700_100000090 3300005441 Bacteria 61626
58 Ga0070700_100135282 3300005441 Bacteria 1668
59 Ga0070662_100000133 3300005457 Bacteria 41884
60 Ga0070662_100042776 3300005457 Bacteria 3237
61 Ga0070662_100165707 3300005457 Bacteria 1731
62 Ga0070681_10002906 3300005458 Bacteria 15850
63 Ga0070681_10118937 3300005458 Bacteria 2578
64 Ga0068867_100001645 3300005459 Bacteria 15522
65 Ga0068867_100001817 3300005459 Bacteria 14865
66 Ga0070685_10001726 3300005466 Bacteria 11469
67 Ga0070706_100000012 3300005467 Bacteria 195040
68 Ga0070706_100003274 3300005467 Bacteria 16019
69 Ga0070706_100015555 3300005467 Bacteria 7028
70 Ga0070707_100129582 3300005468 Bacteria 2452
71 Ga0070707_100130786 3300005468 Bacteria 2441
72 Ga0070698_100000714 3300005471 Bacteria 35621
73 Ga0070698_100055982 3300005471 Bacteria 3997
74 Ga0070699_100002827 3300005518 Bacteria 15494
75 Ga0070679_100000495 3300005530 Bacteria 33587
76 Ga0070684_100015605 3300005535 Bacteria 6194
77 Ga0070697_100000498 3300005536 Bacteria 29802
78 Ga0070697_100110776 3300005536 Unclassified 2287
79 Ga0070697_100155112 3300005536 Unclassified 1932
80 Ga0068853_100001365 3300005539 Bacteria 17608
81 Ga0068853_100006076 3300005539 Bacteria 9558
82 Ga0068853_100016680 3300005539 Bacteria 6050
83 Ga0068853_100023480 3300005539 Bacteria 5163
84 Ga0068853_100067376 3300005539 Bacteria 3110
85 Ga0068853_100165596 3300005539 Bacteria 1997
86 Ga0070672_100000437 3300005543 Bacteria 24334
87 Ga0070693_100006808 3300005547 Bacteria 5552
88 Ga0070665_100000265 3300005548 Bacteria 85729
89 Ga0070665_100000495 3300005548 Bacteria 56309
90 Ga0070665_100000995 3300005548 Bacteria 35932
91 Ga0068855_100000753 3300005563 Bacteria 39796
92 Ga0070664_100004040 3300005564 Bacteria 11785
93 Ga0070664_100025084 3300005564 Bacteria 4939
94 Ga0070664_100047423 3300005564 Bacteria 3629
95 Ga0070664_100104575 3300005564 Bacteria 2465
96 Ga0070664_100182288 3300005564 Bacteria 1867
97 Ga0068857_100002400 3300005577 Bacteria 15273
98 Ga0068857_100004566 3300005577 Bacteria 11718
99 Ga0068857_100026484 3300005577 Bacteria 5112
100 Ga0068857_100043885 3300005577 Bacteria 3965
101 Ga0068857_100146653 3300005577 Bacteria 2135
102 Ga0068854_100000206 3300005578 Bacteria 39747
103 Ga0068854_100029092 3300005578 Bacteria 3822
104 Ga0068856_100079969 3300005614 Bacteria 3242
105 Ga0068852_100004086 3300005616 Bacteria 10269
106 Ga0068852_100005891 3300005616 Bacteria 8813
107 Ga0068852_100050771 3300005616 Bacteria 3556
108 Ga0068859_100001723 3300005617 Bacteria 22290
109 Ga0068859_100008667 3300005617 Bacteria 10279
110 Ga0068859_100020895 3300005617 Bacteria 6570
111 Ga0068859_100081118 3300005617 Bacteria 3286
112 Ga0068859_100097292 3300005617 Bacteria 2996
113 Ga0068859_100108273 3300005617 Bacteria 2840
114 Ga0068859_100127913 3300005617 Bacteria 2611
115 Ga0068864_100000428 3300005618 Bacteria 36392
116 Ga0068864_100013518 3300005618 Bacteria 6768
117 Ga0068861_100030418 3300005719 Bacteria 3957
118 Ga0068851_10013119 3300005834 Bacteria 3921
119 Ga0068863_100000634 3300005841 Bacteria 35566
120 Ga0068863_100027190 3300005841 Bacteria 5456
121 Ga0068863_100147375 3300005841 Bacteria 2251
122 Ga0068858_100002105 3300005842 Bacteria 20206
123 Ga0068858_100057681 3300005842 Bacteria 3589
124 Ga0068858_100118340 3300005842 Bacteria 2476
125 Ga0068860_100002325 3300005843 Bacteria 19958
126 Ga0068860_100003985 3300005843 Bacteria 15149
127 Ga0068860_100008486 3300005843 Bacteria 10239
128 Ga0068862_100018881 3300005844 Bacteria 5745
129 Ga0068862_100056723 3300005844 Bacteria 3357
130 Ga0068862_100124997 3300005844 Bacteria 2270
131 Ga0068862_100174565 3300005844 Bacteria 1926
132 Ga0081539_10001840 3300005985 Bacteria 33465
133 Ga0081539_10013466 3300005985 Bacteria 6159
134 Ga0070717_10139549 3300006028 Bacteria 2090
135 Ga0070715_10008538 3300006163 Unclassified 3574
136 Ga0070716_100019402 3300006173 Bacteria 3553
137 Ga0070712_100012255 3300006175 Bacteria 5450
138 Ga0075362_10033722 3300006177 Bacteria 2228
139 Ga0068871_100045287 3300006358 Bacteria 3540
140 Ga0075431_100096104 3300006847 Unclassified 3059
141 Ga0075434_100032154 3300006871 Bacteria 5173
142 Ga0068865_100002437 3300006881 Bacteria 10995
143 Ga0068865_100127731 3300006881 Unclassified 1900
144 Ga0075436_100005524 3300006914 Bacteria 8688
145 Ga0075436_100039587 3300006914 Unclassified 3253
146 Ga0097620_100001723 3300006931 Bacteria 22290
147 Ga0097620_100008667 3300006931 Bacteria 10279
148 Ga0097620_100020896 3300006931 Bacteria 6570
149 Ga0097620_100081118 3300006931 Bacteria 3286
150 Ga0097620_100097289 3300006931 Bacteria 2996
151 Ga0097620_100108270 3300006931 Bacteria 2840
152 Ga0097620_100127913 3300006931 Bacteria 2611
153 Ga0105240_10017562 3300009093 Bacteria 9639
154 Ga0105240_10079641 3300009093 Bacteria 4031
155 Ga0105240_10100484 3300009093 Bacteria 3520
156 Ga0105240_10182690 3300009093 Bacteria 2473
157 Ga0105240_10220697 3300009093 Unclassified 2209
158 Ga0105245_10000325 3300009098 Bacteria 44936
159 Ga0105245_10043411 3300009098 Unclassified 4010
160 Ga0114129_10002730 3300009147 Bacteria 24606
161 Ga0114129_10031340 3300009147 Bacteria 7517
162 Ga0114129_10034566 3300009147 Bacteria 7141
163 Ga0114129_10222149 3300009147 Unclassified 2548
164 Ga0105243_10020783 3300009148 Bacteria 4981
165 Ga0105243_10170323 3300009148 Archaea 1885
166 Ga0105241_10153740 3300009174 Bacteria 1885
167 Ga0105242_10146375 3300009176 Unclassified 2055
168 Ga0105248_10001472 3300009177 Bacteria 26219
169 Ga0105248_10012006 3300009177 Bacteria 9553
170 Ga0105248_10148915 3300009177 Bacteria 2641
171 Ga0105237_10061054 3300009545 Bacteria 3770
172 Ga0105238_10053333 3300009551 Bacteria 4063
173 Ga0105238_10056727 3300009551 Bacteria 3928
174 Ga0105238_10135567 3300009551 Bacteria 2439
175 Ga0157373_10008548 3300013100 Bacteria 7605
176 Ga0157373_10017790 3300013100 Bacteria 5175
177 Ga0157373_10020704 3300013100 Bacteria 4777
178 Ga0157373_10023438 3300013100 Bacteria 4475
179 Ga0157373_10028364 3300013100 Bacteria 4037
180 Ga0157370_10101284 3300013104 Bacteria 2698
181 Ga0157370_10158073 3300013104 Bacteria 2109
182 Ga0157369_10001722 3300013105 Bacteria 26646
183 Ga0157369_10094394 3300013105 Bacteria 3193
184 Ga0157378_10000385 3300013297 Bacteria 43624
185 Ga0157378_10000922 3300013297 Bacteria 27059
186 Ga0163162_10003059 3300013306 Bacteria 15983
187 Ga0163162_10023035 3300013306 Bacteria 6142
188 Ga0157372_10004258 3300013307 Bacteria 15306
189 Ga0157372_10015552 3300013307 Bacteria 8154
190 Ga0157372_10016955 3300013307 Bacteria 7820
191 Ga0157372_10036692 3300013307 Bacteria 5403
192 Ga0157372_10128244 3300013307 Bacteria 2917
193 Ga0157375_10021468 3300013308 Bacteria 5922
194 Ga0163163_10030062 3300014325 Bacteria 5230
195 Ga0157380_10025023 3300014326 Bacteria 4523
196 Ga0157380_10039167 3300014326 Bacteria 3685
197 Ga0157377_10031669 3300014745 Bacteria 2875
198 Ga0157379_10012979 3300014968 Bacteria 7291
199 Ga0157379_10030775 3300014968 Bacteria 4780
200 Ga0213872_10006081 3300021361 Bacteria 6106
201 Ga0213876_10000031 3300021384 Bacteria 213087
202 Ga0213876_10000160 3300021384 Bacteria 70306
203 Ga0207697_10000109 3300025315 Bacteria 38398
204 Ga0207656_10041300 3300025321 Bacteria 1959
205 Ga0207688_10000437 3300025901 Bacteria 19709
206 Ga0207688_10005020 3300025901 Bacteria 7194
207 Ga0207680_10007545 3300025903 Bacteria 5313
208 Ga0207680_10025830 3300025903 Bacteria 3245
209 Ga0207647_10000999 3300025904 Bacteria 21927
210 Ga0207647_10001452 3300025904 Bacteria 18194
211 Ga0207699_10000003 3300025906 Bacteria 577076
212 Ga0207645_10001179 3300025907 Bacteria 21601
213 Ga0207645_10008994 3300025907 Bacteria 6935
214 Ga0207705_10008203 3300025909 Bacteria 7641
215 Ga0207684_10000028 3300025910 Bacteria 306450
216 Ga0207707_10056654 3300025912 Bacteria 3410
217 Ga0207695_10153770 3300025913 Bacteria 2237
218 Ga0207695_10234641 3300025913 Bacteria 1737
219 Ga0207695_10298511 3300025913 Bacteria 1502
220 Ga0207693_10018250 3300025915 Bacteria 5589
221 Ga0207663_10000003 3300025916 Bacteria 458807
222 Ga0207663_10126850 3300025916 Bacteria 1757
223 Ga0207660_10000603 3300025917 Bacteria 24273
224 Ga0207660_10042533 3300025917 Bacteria 3190
225 Ga0207660_10139952 3300025917 Bacteria 1850
226 Ga0207657_10005161 3300025919 Bacteria 13700
227 Ga0207657_10018679 3300025919 Bacteria 6608
228 Ga0207649_10015240 3300025920 Bacteria 4318
229 Ga0207649_10042898 3300025920 Bacteria 2762
230 Ga0207652_10010487 3300025921 Bacteria 7458
231 Ga0207652_10083713 3300025921 Bacteria 2793
232 Ga0207652_10195580 3300025921 Unclassified 1819
233 Ga0207681_10042235 3300025923 Bacteria 3044
234 Ga0207694_10020241 3300025924 Bacteria 5031
235 Ga0207694_10067683 3300025924 Bacteria 2788
236 Ga0207687_10010009 3300025927 Bacteria 6203
237 Ga0207687_10010223 3300025927 Bacteria 6129
238 Ga0207700_10215643 3300025928 Unclassified 1625
239 Ga0207664_10055653 3300025929 Bacteria 3139
240 Ga0207664_10124160 3300025929 Bacteria 2165
241 Ga0207644_10136233 3300025931 Bacteria 1885
242 Ga0207690_10003663 3300025932 Bacteria 9146
243 Ga0207690_10058864 3300025932 Bacteria 2601
244 Ga0207706_10000300 3300025933 Bacteria 53727
245 Ga0207706_10045614 3300025933 Bacteria 3883
246 Ga0207706_10122383 3300025933 Bacteria 2288
247 Ga0207706_10216797 3300025933 Bacteria 1677
248 Ga0207709_10058866 3300025935 Bacteria 2389
249 Ga0207704_10052478 3300025938 Bacteria 2472
250 Ga0207665_10027844 3300025939 Bacteria 3733
251 Ga0207665_10078831 3300025939 Bacteria 2263
252 Ga0207691_10000294 3300025940 Bacteria 49457
253 Ga0207711_10016086 3300025941 Bacteria 6208
254 Ga0207711_10022837 3300025941 Bacteria 5235
255 Ga0207711_10103298 3300025941 Bacteria 2524
256 Ga0207689_10000900 3300025942 Bacteria 28541
257 Ga0207689_10141706 3300025942 Bacteria 1980
258 Ga0207661_10035311 3300025944 Bacteria 3895
259 Ga0207679_10033338 3300025945 Bacteria 3622
260 Ga0207679_10035318 3300025945 Bacteria 3536
261 Ga0207667_10002705 3300025949 Bacteria 21934
262 Ga0207667_10020666 3300025949 Bacteria 7315
263 Ga0207667_10038716 3300025949 Bacteria 5087
264 Ga0207667_10099668 3300025949 Bacteria 2997
265 Ga0207667_10120695 3300025949 Bacteria 2701
266 Ga0207667_10167836 3300025949 Bacteria 2256
267 Ga0207651_10005717 3300025960 Bacteria 6420
268 Ga0207668_10000021 3300025972 Bacteria 137592
269 Ga0207668_10042469 3300025972 Bacteria 3079
270 Ga0207640_10000884 3300025981 Bacteria 16999
271 Ga0207658_10005047 3300025986 Bacteria 9087
272 Ga0207703_10007475 3300026035 Bacteria 8679
273 Ga0207703_10049055 3300026035 Bacteria 3412
274 Ga0207703_10076606 3300026035 Bacteria 2775
275 Ga0207639_10006885 3300026041 Bacteria 7742
276 Ga0207639_10007623 3300026041 Bacteria 7383
277 Ga0207639_10040034 3300026041 Unclassified 3496
278 Ga0207639_10041873 3300026041 Bacteria 3430
279 Ga0207639_10042460 3300026041 Bacteria 3408
280 Ga0207639_10053757 3300026041 Bacteria 3074
281 Ga0207678_10014225 3300026067 Bacteria 6996
282 Ga0207678_10041259 3300026067 Bacteria 4001
283 Ga0207678_10240160 3300026067 Unclassified 1552
284 Ga0207708_10000095 3300026075 Bacteria 67730
285 Ga0207641_10012662 3300026088 Bacteria 6916
286 Ga0207641_10032090 3300026088 Bacteria 4360
287 Ga0207648_10001537 3300026089 Bacteria 25401
288 Ga0207648_10008749 3300026089 Bacteria 9757
289 Ga0207676_10000492 3300026095 Bacteria 33222
290 Ga0207676_10197877 3300026095 Bacteria 1773
291 Ga0207674_10000023 3300026116 Bacteria 157752
292 Ga0207674_10001709 3300026116 Bacteria 28102
293 Ga0207674_10005725 3300026116 Bacteria 14735
294 Ga0207674_10014471 3300026116 Bacteria 8712
295 Ga0207674_10110791 3300026116 Bacteria 2720
296 Ga0207675_100046717 3300026118 Bacteria 4046
297 Ga0207675_100079959 3300026118 Bacteria 3064
298 Ga0207675_100095000 3300026118 Bacteria 2804
299 Ga0207698_10003528 3300026142 Bacteria 9434
300 Ga0207698_10054544 3300026142 Bacteria 3076
301 Ga0207698_10123140 3300026142 Bacteria 2199
302 Ga0207698_10221460 3300026142 Bacteria 1710
303 Ga0268266_10000187 3300028379 Bacteria 110229
304 Ga0268266_10000318 3300028379 Bacteria 76400
305 Ga0268266_10001881 3300028379 Bacteria 23712
306 Ga0268266_10047250 3300028379 Bacteria 3687
307 Ga0268265_10000789 3300028380 Bacteria 30232
308 Ga0268265_10032580 3300028380 Unclassified 3779
309 Ga0268265_10060759 3300028380 Bacteria 2897
310 Ga0268264_10002322 3300028381 Bacteria 16822
311 Ga0268264_10004293 3300028381 Bacteria 12162
312 Ga0265322_10000184 3300028654 Bacteria 28703
313 Ga0265338_10048199 3300028800 Unclassified 3880
314 Ga0265320_10010444 3300031240 Bacteria 5533
315 Ga0265313_10037332 3300031595 Unclassified 2431
316 Ga0307413_10014089 3300031824 Bacteria 4046
317 Ga0307410_10017696 3300031852 Bacteria 4288
318 Ga0307410_10038505 3300031852 Bacteria 3133
319 Ga0307409_100007636 3300031995 Bacteria 6487
320 Ga0307409_100010609 3300031995 Bacteria 5742
321 Ga0307409_100100765 3300031995 Bacteria 2395
322 Ga0307411_10061433 3300032005 Bacteria 2501
323 Ga0307411_10072011 3300032005 Bacteria 2345
324 Ga0373959_0012229 3300034820 Bacteria 1528
325 Ga0373926_0008779 3300035083 Bacteria 3364
326 Ga0373923_0010101 3300035111 Bacteria 3425
327 Ga0373957_0005111 3300035120 Bacteria 4050
328 Ga0373957_0040408 3300035120 Bacteria 1754
329 Ga0373924_0000058 3300035410 Bacteria 28551
330 Ga0373935_0000413 3300035692 Bacteria 22221
331 Ga0373935_0041618 3300035692 Bacteria 2887
332 Ga0373927_0001716 3300035695 Bacteria 16370
333 Ga0373927_0011274 3300035695 Bacteria 5950
334 Ga0373927_0030541 3300035695 Unclassified 3515
335 Ga0373933_0259024 3300035724 Bacteria 1121
336 Ga0373947_0009977 3300035725 Bacteria 5453
337 Ga0373947_0014191 3300035725 Unclassified 4568
338 Ga0373947_0146603 3300035725 Bacteria 1518
339 Ga0373937_0000569 3300036401 Bacteria 32728
340 Ga0373937_0007336 3300036401 Bacteria 9546
341 Ga0373937_0018974 3300036401 Bacteria 6151
342 Ga0373937_0028276 3300036401 Bacteria 5072
343 Ga0373937_0110624 3300036401 Bacteria 2555
344 Ga0373925_0017592 3300037068 Bacteria 5185
345 Ga0373925_0099121 3300037068 Bacteria 2237
346 Ga0395899_0015046 3300037312 Bacteria 5898
347 Ga0395899_0023950 3300037312 Bacteria 4619
348 Ga0395899_0094484 3300037312 Unclassified 2163
349 Ga0395900_0002008 3300037418 Bacteria 22966
350 Ga0395900_0002613 3300037418 Bacteria 19679
351 Ga0395900_0007137 3300037418 Bacteria 11577
352 Ga0395900_0029758 3300037418 Bacteria 5604
353 Ga0395900_0040442 3300037418 Bacteria 4805
354 Ga0395900_0079058 3300037418 Bacteria 3379
355 Ga0395900_0091091 3300037418 Bacteria 3133
356 Ga0395900_0104921 3300037418 Bacteria 2904
357 Ga0395900_0106498 3300037418 Unclassified 2880
358 Ga0395900_0186074 3300037418 Bacteria 2108
359 Ga0395900_0192452 3300037418 Bacteria 2068
360 Ga0395898_0016301 3300037466 Bacteria 7605
361 Ga0395898_0132300 3300037466 Unclassified 2389
362 Ga0395898_0136416 3300037466 Unclassified 2349
363 Ga0395898_0224782 3300037466 Bacteria 1790
364 Ga0395898_0234684 3300037466 Bacteria 1749
365 Ga0395898_0389661 3300037466 Unclassified 1329
366 Ga0395905_0000218 3300037471 Bacteria 87745
367 Ga0395905_0002082 3300037471 Bacteria 22753
368 Ga0395905_0003854 3300037471 Bacteria 15814
369 Ga0395905_0009372 3300037471 Bacteria 9574
370 Ga0395905_0010977 3300037471 Bacteria 8766
371 Ga0395905_0054053 3300037471 Bacteria 3758
372 Ga0395905_0061120 3300037471 Bacteria 3523
373 Ga0395905_0063243 3300037471 Bacteria 3462
374 Ga0395905_0078059 3300037471 Bacteria 3102
375 Ga0395905_0079096 3300037471 Bacteria 3081
376 Ga0395905_0111552 3300037471 Bacteria 2568
377 Ga0395905_0237264 3300037471 Bacteria 1704
378 Ga0395901_0002884 3300038443 Bacteria 17345
379 Ga0395901_0016335 3300038443 Bacteria 7560
380 Ga0395901_0017066 3300038443 Bacteria 7400
381 Ga0395901_0162820 3300038443 Unclassified 2342
382 Ga0395901_0181244 3300038443 Bacteria 2209
383 Ga0395901_0208327 3300038443 Bacteria 2047
384 Ga0395901_0243794 3300038443 Unclassified 1873
385 Ga0436365_0882969 3300039437 Bacteria 184313
386 Ga0436365_1352252 3300039437 Bacteria 6516
387 Ga0436365_1621207 3300039437 Bacteria 143212
388 Ga0436361_0002110 3300039447 Bacteria 36452
389 Ga0436361_0327584 3300039447 Unclassified 2118
390 Ga0439458_0000393 3300042157 Bacteria 10965
391 Ga0453683_0035530 3300044673 Unclassified 3140
392 Ga0466966_0046264 3300044684 Bacteria 2779
393 Ga0466961_0002409 3300044693 Bacteria 11623
394 Ga0466963_0010123 3300044694 Bacteria 5701
395 Ga0466963_0015710 3300044694 Bacteria 4696
396 Ga0466963_0031778 3300044694 Unclassified 3414
397 Ga0466963_0169121 3300044694 Unclassified 1523
398 Ga0466957_0000088 3300044842 Bacteria 36833
399 Ga0466957_0011375 3300044842 Bacteria 5132
400 Ga0466960_0083537 3300044901 Unclassified 1614
401 Ga0466958_0065920 3300045836 Bacteria 2210
402 Ga0466967_0019046 3300045976 Bacteria 5509
403 Ga0466967_0142226 3300045976 Bacteria 2236
404 Ga0466967_0165138 3300045976 Bacteria 2080
405 Ga0466967_0173967 3300045976 Bacteria 2027
406 Ga0466967_0245082 3300045976 Unclassified 1710
407 Ga0466967_0254923 3300045976 Unclassified 1677
408 Ga0495580_0004829 3300046472 Bacteria 11283
409 Ga0495582_0049120 3300046473 Bacteria 2323
410 Ga0495608_0075342 3300046511 Bacteria 2199
411 Ga0495642_0024326 3300046528 Bacteria 2396
412 Ga0495652_0075553 3300046529 Bacteria 2798
413 Ga0495665_0059223 3300046531 Unclassified 2021
414 Ga0495623_0022991 3300046679 Bacteria 4025
415 Ga0495658_0030203 3300046683 Unclassified 2941
416 Ga0495669_0021077 3300046684 Bacteria 2826
417 Ga0495604_0010356 3300047317 Bacteria 7383
418 Ga0495672_0074995 3300047320 Unclassified 1903
419 Ga0495675_0059060 3300047444 Bacteria 2432
420 Ga0495675_0156723 3300047444 Bacteria 1404
421 Ga0495677_0010754 3300047445 Bacteria 3353
422 Ga0495684_0003519 3300047471 Bacteria 12252
423 Ga0495602_0024460 3300048088 Bacteria 5859
424 Ga0496102_0005962 3300048905 Bacteria 10380
425 Ga0496104_0091679 3300048907 Bacteria 2905
426 Ga0496105_0001364 3300048908 Bacteria 17172
427 Ga0496106_0019022 3300048909 Bacteria 5091
428 Ga0496110_0084853 3300048913 Bacteria 2827
429 Ga0496112_0007469 3300048915 Bacteria 9700
430 Ga0496112_0034805 3300048915 Bacteria 4902
431 Ga0496112_0097122 3300048915 Unclassified 2917
432 Ga0496113_0003466 3300048916 Bacteria 9448
433 Ga0496113_0039770 3300048916 Bacteria 3463
434 Ga0496113_0061177 3300048916 Bacteria 2841
435 Ga0496114_0092179 3300048917 Bacteria 2574
436 Ga0501034_0200191 3300049571 Bacteria 1956
437 Ga0501069_0009717 3300049585 Bacteria 5082
438 Ga0501217_008696 3300049661 Unclassified 2198
439 Ga0501227_002903 3300049665 Bacteria 3759
440 nmdc:mga03683_33321_c1 3300050489 Bacteria 2077
441 nmdc:mga05p37_112187_c1 3300050507 Bacteria 3353
442 nmdc:mga05p37_14958_c1 3300050507 Bacteria 9315
443 nmdc:mga05p37_151400_c1 3300050507 Bacteria 2837
444 nmdc:mga09592_19027_c1 3300050508 Bacteria 5635
445 nmdc:mga0qj67_77943_c1 3300050509 Unclassified 2652
446 nmdc:mga06r32_265163_c1 3300050510 Bacteria 1705
447 nmdc:mga0n895_13809_c1 3300050512 Bacteria 7305
448 nmdc:mga0n895_236936_c1 3300050512 Bacteria 1852
449 nmdc:mga0n895_53454_c1 3300050512 Bacteria 3968
450 nmdc:mga08x19_46_c1 3300050514 Bacteria 145818
451 Ga0495601_0007188 3300053077 Bacteria 6533
452 Ga0495619_0002004 3300053085 Bacteria 13548
453 Ga0500628_000418 3300053129 Bacteria 8097
454 Ga0500587_007321 3300053739 Bacteria 1439
455 Ga0157369_10018713
456 JGI24740J21852_10004254
457 JGI24739J22299_10001795
458 JGI24739J22299_10002106
459 JGI24737J22298_10000419
460 JGI24738J21930_10000456
461 Ga0065712_10074837
462 Ga0065715_10116660
463 Ga0070658_10065055
464 Ga0070658_10067341
465 Ga0070658_10124625
466 Ga0070676_10000962
467 Ga0070676_10020752
468 Ga0070683_100021802
469 Ga0070683_100209656
470 Ga0070690_100028212
471 Ga0070670_100058462
472 Ga0070670_100067723
473 Ga0068869_100000249
474 Ga0068869_100048112
475 Ga0070666_10000853
476 Ga0070680_100000384
477 Ga0070680_100005554
478 Ga0070680_100084339
479 Ga0070680_100102557
480 Ga0070682_100061260
481 Ga0068868_100000113
482 Ga0070660_100023068
483 Ga0070660_100025786
484 Ga0070660_100072476
485 Ga0070660_100093480
486 Ga0070691_10000966
487 Ga0070661_100092609
488 Ga0070692_10087702
489 Ga0070668_100018349
490 Ga0070668_100168602
491 Ga0070669_100000155
492 Ga0070669_100031918
493 Ga0070669_100036775
494 Ga0070671_100003933
495 Ga0070671_100007800
496 Ga0070673_100000177
497 Ga0070673_100065928
498 Ga0070659_100000305
499 Ga0070659_100016610
500 Ga0070659_100024764
501 Ga0070667_100002102
502 Ga0070667_100060400
503 Ga0070709_10000041
504 Ga0070714_100013043
505 Ga0070714_100157375
506 Ga0070713_100010301
507 Ga0070710_10019990
508 Ga0070711_100000051
509 Ga0070711_100012252
510 Ga0070711_100021487
511 Ga0070700_100000090
512 Ga0070700_100135282
513 Ga0070662_100000133
514 Ga0070662_100042776
515 Ga0070662_100165707
516 Ga0070681_10002906
517 Ga0070681_10118937
518 Ga0068867_100001645
519 Ga0068867_100001817
520 Ga0070685_10001726
521 Ga0070706_100000012
522 Ga0070706_100003274
523 Ga0070706_100015555
524 Ga0070707_100129582
525 Ga0070707_100130786
526 Ga0070698_100000714
527 Ga0070698_100055982
528 Ga0070699_100002827
529 Ga0070679_100000495
530 Ga0070684_100015605
531 Ga0070697_100000498
532 Ga0070697_100110776
533 Ga0070697_100155112
534 Ga0068853_100001365
535 Ga0068853_100006076
536 Ga0068853_100016680
537 Ga0068853_100023480
538 Ga0068853_100067376
539 Ga0068853_100165596
540 Ga0070672_100000437
541 Ga0070693_100006808
542 Ga0070665_100000265
543 Ga0070665_100000495
544 Ga0070665_100000995
545 Ga0068855_100000753
546 Ga0070664_100004040
547 Ga0070664_100025084
548 Ga0070664_100047423
549 Ga0070664_100104575
550 Ga0070664_100182288
551 Ga0068857_100002400
552 Ga0068857_100004566
553 Ga0068857_100026484
554 Ga0068857_100043885
555 Ga0068857_100146653
556 Ga0068854_100000206
557 Ga0068854_100029092
558 Ga0068856_100079969
559 Ga0068852_100004086
560 Ga0068852_100005891
561 Ga0068852_100050771
562 Ga0068859_100001723
563 Ga0068859_100008667
564 Ga0068859_100020895
565 Ga0068859_100081118
566 Ga0068859_100097292
567 Ga0068859_100108273
568 Ga0068859_100127913
569 Ga0068864_100000428
570 Ga0068864_100013518
571 Ga0068861_100030418
572 Ga0068851_10013119
573 Ga0068863_100000634
574 Ga0068863_100027190
575 Ga0068863_100147375
576 Ga0068858_100002105
577 Ga0068858_100057681
578 Ga0068858_100118340
579 Ga0068860_100002325
580 Ga0068860_100003985
581 Ga0068860_100008486
582 Ga0068862_100018881
583 Ga0068862_100056723
584 Ga0068862_100124997
585 Ga0068862_100174565
586 Ga0081539_10001840
587 Ga0081539_10013466
588 Ga0070717_10139549
589 Ga0070715_10008538
590 Ga0070716_100019402
591 Ga0070712_100012255
592 Ga0075362_10033722
593 Ga0068871_100045287
594 Ga0075431_100096104
595 Ga0075434_100032154
596 Ga0068865_100002437
597 Ga0068865_100127731
598 Ga0075436_100005524
599 Ga0075436_100039587
600 Ga0097620_100001723
601 Ga0097620_100008667
602 Ga0097620_100020896
603 Ga0097620_100081118
604 Ga0097620_100097289
605 Ga0097620_100108270
606 Ga0097620_100127913
607 Ga0105240_10017562
608 Ga0105240_10079641
609 Ga0105240_10100484
610 Ga0105240_10182690
611 Ga0105240_10220697
612 Ga0105245_10000325
613 Ga0105245_10043411
614 Ga0114129_10002730
615 Ga0114129_10031340
616 Ga0114129_10034566
617 Ga0114129_10222149
618 Ga0105243_10020783
619 Ga0105243_10170323
620 Ga0105241_10153740
621 Ga0105242_10146375
622 Ga0105248_10001472
623 Ga0105248_10012006
624 Ga0105248_10148915
625 Ga0105237_10061054
626 Ga0105238_10053333
627 Ga0105238_10056727
628 Ga0105238_10135567
629 Ga0157373_10008548
630 Ga0157373_10017790
631 Ga0157373_10020704
632 Ga0157373_10023438
633 Ga0157373_10028364
634 Ga0157370_10101284
635 Ga0157370_10158073
636 Ga0157369_10001722
637 Ga0157369_10094394
638 Ga0157378_10000385
639 Ga0157378_10000922
640 Ga0163162_10003059
641 Ga0163162_10023035
642 Ga0157372_10004258
643 Ga0157372_10015552
644 Ga0157372_10016955
645 Ga0157372_10036692
646 Ga0157372_10128244
647 Ga0157375_10021468
648 Ga0163163_10030062
649 Ga0157380_10025023
650 Ga0157380_10039167
651 Ga0157377_10031669
652 Ga0157379_10012979
653 Ga0157379_10030775
654 Ga0213872_10006081
655 Ga0213876_10000031
656 Ga0213876_10000160
657 Ga0207697_10000109
658 Ga0207656_10041300
659 Ga0207688_10000437
660 Ga0207688_10005020
661 Ga0207680_10007545
662 Ga0207680_10025830
663 Ga0207647_10000999
664 Ga0207647_10001452
665 Ga0207699_10000003
666 Ga0207645_10001179
667 Ga0207645_10008994
668 Ga0207705_10008203
669 Ga0207684_10000028
670 Ga0207707_10056654
671 Ga0207695_10153770
672 Ga0207695_10234641
673 Ga0207695_10298511
674 Ga0207693_10018250
675 Ga0207663_10000003
676 Ga0207663_10126850
677 Ga0207660_10000603
678 Ga0207660_10042533
679 Ga0207660_10139952
680 Ga0207657_10005161
681 Ga0207657_10018679
682 Ga0207649_10015240
683 Ga0207649_10042898
684 Ga0207652_10010487
685 Ga0207652_10083713
686 Ga0207652_10195580
687 Ga0207681_10042235
688 Ga0207694_10020241
689 Ga0207694_10067683
690 Ga0207687_10010009
691 Ga0207687_10010223
692 Ga0207700_10215643
693 Ga0207664_10055653
694 Ga0207664_10124160
695 Ga0207644_10136233
696 Ga0207690_10003663
697 Ga0207690_10058864
698 Ga0207706_10000300
699 Ga0207706_10045614
700 Ga0207706_10122383
701 Ga0207706_10216797
702 Ga0207709_10058866
703 Ga0207704_10052478
704 Ga0207665_10027844
705 Ga0207665_10078831
706 Ga0207691_10000294
707 Ga0207711_10016086
708 Ga0207711_10022837
709 Ga0207711_10103298
710 Ga0207689_10000900
711 Ga0207689_10141706
712 Ga0207661_10035311
713 Ga0207679_10033338
714 Ga0207679_10035318
715 Ga0207667_10002705
716 Ga0207667_10020666
717 Ga0207667_10038716
718 Ga0207667_10099668
719 Ga0207667_10120695
720 Ga0207667_10167836
721 Ga0207651_10005717
722 Ga0207668_10000021
723 Ga0207668_10042469
724 Ga0207640_10000884
725 Ga0207658_10005047
726 Ga0207703_10007475
727 Ga0207703_10049055
728 Ga0207703_10076606
729 Ga0207639_10006885
730 Ga0207639_10007623
731 Ga0207639_10040034
732 Ga0207639_10041873
733 Ga0207639_10042460
734 Ga0207639_10053757
735 Ga0207678_10014225
736 Ga0207678_10041259
737 Ga0207678_10240160
738 Ga0207708_10000095
739 Ga0207641_10012662
740 Ga0207641_10032090
741 Ga0207648_10001537
742 Ga0207648_10008749
743 Ga0207676_10000492
744 Ga0207676_10197877
745 Ga0207674_10000023
746 Ga0207674_10001709
747 Ga0207674_10005725
748 Ga0207674_10014471
749 Ga0207674_10110791
750 Ga0207675_100046717
751 Ga0207675_100079959
752 Ga0207675_100095000
753 Ga0207698_10003528
754 Ga0207698_10054544
755 Ga0207698_10123140
756 Ga0207698_10221460
757 Ga0268266_10000187
758 Ga0268266_10000318
759 Ga0268266_10001881
760 Ga0268266_10047250
761 Ga0268265_10000789
762 Ga0268265_10032580
763 Ga0268265_10060759
764 Ga0268264_10002322
765 Ga0268264_10004293
766 Ga0265322_10000184
767 Ga0265338_10048199
768 Ga0265320_10010444
769 Ga0265313_10037332
770 Ga0307413_10014089
771 Ga0307410_10017696
772 Ga0307410_10038505
773 Ga0307409_100007636
774 Ga0307409_100010609
775 Ga0307409_100100765
776 Ga0307411_10061433
777 Ga0307411_10072011
778 Ga0373959_0012229
779 Ga0373926_0008779
780 Ga0373923_0010101
781 Ga0373957_0005111
782 Ga0373957_0040408
783 Ga0373924_0000058
784 Ga0373935_0000413
785 Ga0373935_0041618
786 Ga0373927_0001716
787 Ga0373927_0011274
788 Ga0373927_0030541
789 Ga0373933_0259024
790 Ga0373947_0009977
791 Ga0373947_0014191
792 Ga0373947_0146603
793 Ga0373937_0000569
794 Ga0373937_0007336
795 Ga0373937_0018974
796 Ga0373937_0028276
797 Ga0373937_0110624
798 Ga0373925_0017592
799 Ga0373925_0099121
800 Ga0395899_0015046
801 Ga0395899_0023950
802 Ga0395899_0094484
803 Ga0395900_0002008
804 Ga0395900_0002613
805 Ga0395900_0007137
806 Ga0395900_0029758
807 Ga0395900_0040442
808 Ga0395900_0079058
809 Ga0395900_0091091
810 Ga0395900_0104921
811 Ga0395900_0106498
812 Ga0395900_0186074
813 Ga0395900_0192452
814 Ga0395898_0016301
815 Ga0395898_0132300
816 Ga0395898_0136416
817 Ga0395898_0224782
818 Ga0395898_0234684
819 Ga0395898_0389661
820 Ga0395905_0000218
821 Ga0395905_0002082
822 Ga0395905_0003854
823 Ga0395905_0009372
824 Ga0395905_0010977
825 Ga0395905_0054053
826 Ga0395905_0061120
827 Ga0395905_0063243
828 Ga0395905_0078059
829 Ga0395905_0079096
830 Ga0395905_0111552
831 Ga0395905_0237264
832 Ga0395901_0002884
833 Ga0395901_0016335
834 Ga0395901_0017066
835 Ga0395901_0162820
836 Ga0395901_0181244
837 Ga0395901_0208327
838 Ga0395901_0243794
839 Ga0436365_0882969
840 Ga0436365_1352252
841 Ga0436365_1621207
842 Ga0436361_0002110
843 Ga0436361_0327584
844 Ga0439458_0000393
845 Ga0453683_0035530
846 Ga0466966_0046264
847 Ga0466961_0002409
848 Ga0466963_0010123
849 Ga0466963_0015710
850 Ga0466963_0031778
851 Ga0466963_0169121
852 Ga0466957_0000088
853 Ga0466957_0011375
854 Ga0466960_0083537
855 Ga0466958_0065920
856 Ga0466967_0019046
857 Ga0466967_0142226
858 Ga0466967_0165138
859 Ga0466967_0173967
860 Ga0466967_0245082
861 Ga0466967_0254923
862 Ga0495580_0004829
863 Ga0495582_0049120
864 Ga0495608_0075342
865 Ga0495642_0024326
866 Ga0495652_0075553
867 Ga0495665_0059223
868 Ga0495623_0022991
869 Ga0495658_0030203
870 Ga0495669_0021077
871 Ga0495604_0010356
872 Ga0495672_0074995
873 Ga0495675_0059060
874 Ga0495675_0156723
875 Ga0495677_0010754
876 Ga0495684_0003519
877 Ga0495602_0024460
878 Ga0496102_0005962
879 Ga0496104_0091679
880 Ga0496105_0001364
881 Ga0496106_0019022
882 Ga0496110_0084853
883 Ga0496112_0007469
884 Ga0496112_0034805
885 Ga0496112_0097122
886 Ga0496113_0003466
887 Ga0496113_0039770
888 Ga0496113_0061177
889 Ga0496114_0092179
890 Ga0501034_0200191
891 Ga0501069_0009717
892 Ga0501217_008696
893 Ga0501227_002903
894 nmdc:mga03683_33321_c1
895 nmdc:mga05p37_112187_c1
896 nmdc:mga05p37_14958_c1
897 nmdc:mga05p37_151400_c1
898 nmdc:mga09592_19027_c1
899 nmdc:mga0qj67_77943_c1
900 nmdc:mga06r32_265163_c1
901 nmdc:mga0n895_13809_c1
902 nmdc:mga0n895_236936_c1
903 nmdc:mga0n895_53454_c1
904 nmdc:mga08x19_46_c1
905 Ga0495601_0007188
906 Ga0495619_0002004
907 Ga0500628_000418
908 Ga0500587_007321

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00324

AA_permease

Amino acid permease

88

506

0.87

PF13520

AA_permease_2

Amino acid permease

84

503

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6f2g-assembly1.cif.gz_A bacterial asc transporter crystal structure in open to in conformation 0.9049 17 412
6li9-assembly1.cif.gz_B heteromeric amino acid transporter b0,+at-rbat complex bound with arginine 0.8909 15 409
5oqt-assembly1.cif.gz_A crystal structure of a bacterial cationic amino acid transporter (cat) homologue 0.8887 12 409
7dsk-assembly1.cif.gz_B overall structure of the lat1-4f2hc bound with jx-075 0.8837 10 409
7p9v-assembly1.cif.gz_B cryo em structure of system xc- 0.8814 17 409
ID Description Score Start End Superfamily
af_Q50E62_26_473_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.929 11 408 1.20.1740.10
af_Q8IR48_79_518_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9154 11 408 1.20.1740.10
af_P71892_30_474_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9092 11 409 1.20.1740.10
af_Q9Y1A7_38_480_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9092 11 411 1.20.1740.10
af_Q2G1Y2_23_478_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.9087 11 408 1.20.1740.10
ID Description Score Start End GO Terms
AF-U1Q4E6-F1-model_v4 Amino acid transporter 0.9348 8 409 GO:0016020
GO:0055085
AF-A0A7C1ECS2-F1-model_v4 Amino acid permease 0.9154 7 410 GO:0005886
GO:0022857
AF-A0A0R2NSN2-F1-model_v4 Amino acid transport protein 0.9152 11 408 GO:0015171
GO:0016020
AF-A0A3L7PR48-F1-model_v4 Amino acid permease 0.9141 9 408 GO:0005886
GO:0015179
AF-A0A2V5X0I7-F1-model_v4 Amino acid permease 0.9124 16 409 GO:0015171
GO:0016020

Map