F447406

General Info

Members Datasets Scaffolds Average Seq Length
454 241 908 232

Family's Representative Sequence

Representative Sequence 3300031251|Ga0265327_10003039|Ga0265327_1000303913
Length 274
Sequence MSAPFSQERIKKTHNAKTHRVVFLLDVDNTLLNNDRVTDDLRKFLFREFGEERQKRYWTIYEQLRNELGYADYLGALQRYRAENPRDPRFLLMSKFMMKYPFSNRVFPRAIDAIEHLQQWGPCVILSDGDVVFQPRKIDRSGLGHAVHDNVLIYLHKEHELDDVESRYPADHYVLVDDKLRILDAVKKIWGGGVTTVFVRQGHYAQDEKALAKYPPADVTMDHIGDLCDYDFQKLRAAALGKSEAETTAVATQPEVSLVETAGNPNAHFALAIA

Samples

Sample ID Description Type Environment
1 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
6 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
7 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
59 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
106 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
107 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
110 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
111 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
171 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
174 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
175 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
178 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
179 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
185 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
186 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
187 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
188 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
193 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
200 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
203 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
204 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.02
Metatranscriptomes 1.76
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.98
Nodule 0
Rhizoplane 3.52
Rhizosphere 93.39
Stem 0
Stem Tuber 0
Unclassified 6.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265327_10003039 3300031251 Bacteria 16619
2 JGI24736J21556_1003456 3300001904 Bacteria 2741
3 JGI24741J21665_1002759 3300001915 Bacteria 4445
4 JGI24741J21665_1003536 3300001915 Bacteria 3697
5 JGI24741J21665_1003741 3300001915 Bacteria 3538
6 JGI24740J21852_10000235 3300001979 Bacteria 23567
7 JGI25162J39368_1002011 3300002737 Bacteria 9033
8 JGI25164J39214_1000745 3300002772 Bacteria 12110
9 JGI25165J46597_1001803 3300003214 Bacteria 9122
10 JGI25165J46597_1002802 3300003214 Bacteria 5048
11 Ga0055525_1000161 3300003759 Bacteria 87478
12 Ga0058863_11764645 3300004799 Bacteria 1558
13 Ga0070658_10223393 3300005327 Bacteria 1593
14 Ga0070658_10311366 3300005327 Bacteria 1343
15 Ga0070676_10395117 3300005328 Unclassified 961
16 Ga0070683_100057252 3300005329 Bacteria 3621
17 Ga0070683_100165158 3300005329 Bacteria 2100
18 Ga0070670_100369303 3300005331 Bacteria 1263
19 Ga0068869_100175024 3300005334 Bacteria 1679
20 Ga0070666_10001947 3300005335 Bacteria 12562
21 Ga0070680_100000138 3300005336 Bacteria 44481
22 Ga0070680_100047256 3300005336 Bacteria 3504
23 Ga0070680_100067407 3300005336 Bacteria 2935
24 Ga0070680_100161275 3300005336 Bacteria 1884
25 Ga0070680_100222766 3300005336 Bacteria 1592
26 Ga0070682_100039220 3300005337 Bacteria 2910
27 Ga0070682_100248454 3300005337 Bacteria 1281
28 Ga0068868_100003468 3300005338 Bacteria 10984
29 Ga0070660_100056602 3300005339 Bacteria 3034
30 Ga0070691_10000204 3300005341 Bacteria 19856
31 Ga0070691_10056294 3300005341 Bacteria 1884
32 Ga0070687_100059766 3300005343 Bacteria 2008
33 Ga0070661_100051944 3300005344 Bacteria 3000
34 Ga0070661_100054409 3300005344 Bacteria 2931
35 Ga0070692_10017517 3300005345 Bacteria 3426
36 Ga0070669_100009009 3300005353 Bacteria 7119
37 Ga0070675_100013105 3300005354 Bacteria 6513
38 Ga0070675_100068199 3300005354 Bacteria 2945
39 Ga0070675_100242890 3300005354 Bacteria 1574
40 Ga0070671_100014135 3300005355 Bacteria 6446
41 Ga0070671_100085202 3300005355 Bacteria 2643
42 Ga0070674_100372062 3300005356 Bacteria 1160
43 Ga0070673_100022522 3300005364 Bacteria 4587
44 Ga0070673_100579522 3300005364 Bacteria 1022
45 Ga0070673_101023827 3300005364 Bacteria 770
46 Ga0070688_100064014 3300005365 Bacteria 2333
47 Ga0070659_100034904 3300005366 Bacteria 3914
48 Ga0070667_100003122 3300005367 Bacteria 14233
49 Ga0070667_100014782 3300005367 Bacteria 6449
50 Ga0070714_100174402 3300005435 Bacteria 1953
51 Ga0070714_100432456 3300005435 Bacteria 1248
52 Ga0070713_100181187 3300005436 Bacteria 1893
53 Ga0070713_100238025 3300005436 Bacteria 1657
54 Ga0070710_10041673 3300005437 Bacteria 2536
55 Ga0070711_100158496 3300005439 Bacteria 1714
56 Ga0070705_100126878 3300005440 Bacteria 1658
57 Ga0070694_100081879 3300005444 Bacteria 2247
58 Ga0070708_100235375 3300005445 Bacteria 1719
59 Ga0070663_100134053 3300005455 Bacteria 1884
60 Ga0070681_10001058 3300005458 Bacteria 23417
61 Ga0070681_10073857 3300005458 Bacteria 3372
62 Ga0070681_10093761 3300005458 Bacteria 2951
63 Ga0070681_10205936 3300005458 Bacteria 1884
64 Ga0068867_100114389 3300005459 Bacteria 2077
65 Ga0070685_10011330 3300005466 Bacteria 4670
66 Ga0070706_100039754 3300005467 Bacteria 4342
67 Ga0070707_100000025 3300005468 Bacteria 124890
68 Ga0070707_100058673 3300005468 Bacteria 3690
69 Ga0070707_100147818 3300005468 Bacteria 2287
70 Ga0070698_100213396 3300005471 Bacteria 1864
71 Ga0070698_100345243 3300005471 Bacteria 1420
72 Ga0070698_100713698 3300005471 Bacteria 945
73 Ga0070699_100005998 3300005518 Bacteria 10621
74 Ga0070679_100000504 3300005530 Bacteria 33271
75 Ga0070679_100005669 3300005530 Bacteria 11575
76 Ga0070679_100022865 3300005530 Bacteria 6114
77 Ga0070679_100048237 3300005530 Bacteria 4244
78 Ga0070679_100108637 3300005530 Bacteria 2760
79 Ga0070679_100215142 3300005530 Bacteria 1884
80 Ga0070684_100012847 3300005535 Bacteria 6727
81 Ga0070684_100400398 3300005535 Bacteria 1265
82 Ga0070697_100025186 3300005536 Bacteria 4744
83 Ga0070697_100050695 3300005536 Bacteria 3370
84 Ga0068853_100040635 3300005539 Bacteria 3969
85 Ga0068853_100068367 3300005539 Bacteria 3088
86 Ga0070672_100086821 3300005543 Bacteria 2517
87 Ga0070672_100289352 3300005543 Bacteria 1387
88 Ga0070686_100151303 3300005544 Unclassified 1625
89 Ga0070695_100186909 3300005545 Bacteria 1472
90 Ga0070695_100371254 3300005545 Bacteria 1077
91 Ga0070693_100051514 3300005547 Bacteria 2358
92 Ga0070665_100003287 3300005548 Bacteria 17350
93 Ga0070665_100061063 3300005548 Bacteria 3778
94 Ga0070704_100359955 3300005549 Bacteria 1231
95 Ga0068855_100074025 3300005563 Bacteria 3956
96 Ga0068855_100138332 3300005563 Bacteria 2777
97 Ga0070664_100153783 3300005564 Bacteria 2032
98 Ga0070664_101040226 3300005564 Bacteria 770
99 Ga0068857_100300831 3300005577 Bacteria 1479
100 Ga0068857_100366340 3300005577 Bacteria 1336
101 Ga0068857_100496188 3300005577 Bacteria 1145
102 Ga0068854_100135554 3300005578 Bacteria 1884
103 Ga0068856_100099494 3300005614 Bacteria 2899
104 Ga0068852_100029401 3300005616 Bacteria 4515
105 Ga0068852_100381095 3300005616 Bacteria 1383
106 Ga0068859_100012417 3300005617 Bacteria 8570
107 Ga0068859_100019278 3300005617 Bacteria 6853
108 Ga0068859_101097145 3300005617 Bacteria 875
109 Ga0068864_100182792 3300005618 Bacteria 1918
110 Ga0068864_100183503 3300005618 Bacteria 1914
111 Ga0068864_100310695 3300005618 Bacteria 1478
112 Ga0068861_100312038 3300005719 Bacteria 1367
113 Ga0068863_100096447 3300005841 Bacteria 2807
114 Ga0068863_100119801 3300005841 Bacteria 2509
115 Ga0068863_100187926 3300005841 Bacteria 1985
116 Ga0068863_100192832 3300005841 Bacteria 1958
117 Ga0068863_100201327 3300005841 Bacteria 1916
118 Ga0068858_100218723 3300005842 Bacteria 1804
119 Ga0068858_100364280 3300005842 Bacteria 1386
120 Ga0068860_100011450 3300005843 Bacteria 8738
121 Ga0068860_100073302 3300005843 Bacteria 3254
122 Ga0068860_100827076 3300005843 Unclassified 940
123 Ga0081455_10046966 3300005937 Bacteria 3742
124 Ga0070715_10297380 3300006163 Bacteria 862
125 Ga0097621_100017983 3300006237 Bacteria 5386
126 Ga0097621_100566242 3300006237 Bacteria 1035
127 Ga0068871_100014721 3300006358 Bacteria 5837
128 Ga0068871_100040425 3300006358 Bacteria 3735
129 Ga0068871_100351179 3300006358 Unclassified 1304
130 Ga0075428_100067263 3300006844 Bacteria 3923
131 Ga0075431_100039456 3300006847 Bacteria 4864
132 Ga0075431_100115196 3300006847 Unclassified 2775
133 Ga0075431_100419779 3300006847 Bacteria 1337
134 Ga0075433_10004907 3300006852 Bacteria 10469
135 Ga0075433_10007233 3300006852 Bacteria 8793
136 Ga0075433_10127546 3300006852 Bacteria 2259
137 Ga0075433_10145867 3300006852 Bacteria 2104
138 Ga0075433_10270881 3300006852 Bacteria 1505
139 Ga0075433_10281336 3300006852 Bacteria 1474
140 Ga0075434_100001714 3300006871 Bacteria 18781
141 Ga0075434_100071568 3300006871 Bacteria 3459
142 Ga0075434_100170903 3300006871 Bacteria 2194
143 Ga0075434_100247827 3300006871 Unclassified 1801
144 Ga0075434_100255098 3300006871 Bacteria 1773
145 Ga0075434_100314189 3300006871 Bacteria 1587
146 Ga0075429_100006829 3300006880 Bacteria 9905
147 Ga0068865_100142327 3300006881 Bacteria 1809
148 Ga0068865_100169448 3300006881 Bacteria 1673
149 Ga0075436_100000850 3300006914 Bacteria 20284
150 Ga0075436_100016959 3300006914 Bacteria 4984
151 Ga0075436_100111202 3300006914 Bacteria 1912
152 Ga0097620_100012418 3300006931 Bacteria 8570
153 Ga0097620_100019278 3300006931 Bacteria 6853
154 Ga0097620_100635222 3300006931 Bacteria 1160
155 Ga0097620_101097049 3300006931 Bacteria 875
156 Ga0075435_100000051 3300007076 Bacteria 59038
157 Ga0075435_100005786 3300007076 Bacteria 8684
158 Ga0075435_100020192 3300007076 Bacteria 5100
159 Ga0075435_100153258 3300007076 Unclassified 1938
160 Ga0075435_100173695 3300007076 Bacteria 1819
161 Ga0075435_100181253 3300007076 Unclassified 1780
162 Ga0105240_10237700 3300009093 Bacteria 2114
163 Ga0111539_10030379 3300009094 Bacteria 6568
164 Ga0114129_10008410 3300009147 Bacteria 14697
165 Ga0114129_10020932 3300009147 Bacteria 9290
166 Ga0114129_10077451 3300009147 Bacteria 4625
167 Ga0114129_10687861 3300009147 Bacteria 1316
168 Ga0105242_10040851 3300009176 Bacteria 3738
169 Ga0105242_10225599 3300009176 Bacteria 1676
170 Ga0105248_10000917 3300009177 Bacteria 32799
171 Ga0105248_10001271 3300009177 Bacteria 28206
172 Ga0105248_10001780 3300009177 Bacteria 23957
173 Ga0105248_10064430 3300009177 Bacteria 4115
174 Ga0105248_10204869 3300009177 Bacteria 2223
175 Ga0157373_10035591 3300013100 Bacteria 3574
176 Ga0157371_10023213 3300013102 Bacteria 4536
177 Ga0157371_10089666 3300013102 Bacteria 2178
178 Ga0157370_10224493 3300013104 Bacteria 1739
179 Ga0157370_10675598 3300013104 Bacteria 943
180 Ga0157369_10120410 3300013105 Bacteria 2785
181 Ga0157374_10008107 3300013296 Bacteria 8977
182 Ga0157378_10147399 3300013297 Bacteria 2190
183 Ga0157378_10476113 3300013297 Bacteria 1243
184 Ga0163162_10063063 3300013306 Bacteria 3748
185 Ga0163162_10126794 3300013306 Bacteria 2659
186 Ga0163162_10216706 3300013306 Bacteria 2044
187 Ga0157372_10054989 3300013307 Bacteria 4443
188 Ga0157372_10160437 3300013307 Bacteria 2599
189 Ga0157375_10004755 3300013308 Bacteria 11801
190 Ga0157375_10058581 3300013308 Bacteria 3811
191 Ga0157375_10246495 3300013308 Bacteria 1947
192 Ga0163163_10008201 3300014325 Bacteria 9266
193 Ga0163163_10105981 3300014325 Bacteria 2837
194 Ga0163163_10846506 3300014325 Unclassified 978
195 Ga0157379_10000109 3300014968 Bacteria 56661
196 Ga0157379_10001822 3300014968 Bacteria 17598
197 Ga0157379_10771405 3300014968 Bacteria 906
198 Ga0157376_10002659 3300014969 Bacteria 12142
199 Ga0157376_10018787 3300014969 Bacteria 5310
200 Ga0157376_10065797 3300014969 Bacteria 3063
201 Ga0157376_10960502 3300014969 Bacteria 875
202 Ga0163161_10065103 3300017792 Bacteria 2660
203 Ga0197907_10565531 3300020069 Bacteria 1670
204 Ga0206356_10069590 3300020070 Bacteria 8400
205 Ga0206350_10122875 3300020080 Bacteria 5847
206 Ga0206354_10034129 3300020081 Bacteria 8560
207 Ga0206353_10125677 3300020082 Bacteria 3903
208 Ga0154015_1208008 3300020610 Bacteria 3187
209 Ga0213871_10004838 3300021441 Bacteria 2729
210 Ga0224712_10002264 3300022467 Bacteria 4707
211 Ga0209563_100088 3300025230 Bacteria 175375
212 Ga0207427_100119 3300025231 Bacteria 101986
213 Ga0209437_100005 3300025233 Bacteria 1071596
214 Ga0209233_1000011 3300025261 Bacteria 1071611
215 Ga0207692_10047150 3300025898 Bacteria 2163
216 Ga0207647_10012630 3300025904 Bacteria 5870
217 Ga0207645_10054888 3300025907 Bacteria 2545
218 Ga0207705_10007862 3300025909 Bacteria 7830
219 Ga0207705_10042625 3300025909 Bacteria 3258
220 Ga0207707_10000868 3300025912 Bacteria 29545
221 Ga0207707_10000944 3300025912 Bacteria 28014
222 Ga0207707_10004809 3300025912 Bacteria 11845
223 Ga0207707_10014949 3300025912 Bacteria 6759
224 Ga0207707_10386358 3300025912 Bacteria 1203
225 Ga0207707_10544332 3300025912 Bacteria 987
226 Ga0207695_10024855 3300025913 Bacteria 6723
227 Ga0207695_10172314 3300025913 Bacteria 2089
228 Ga0207693_10115946 3300025915 Bacteria 2103
229 Ga0207663_10109257 3300025916 Bacteria 1874
230 Ga0207660_10000389 3300025917 Bacteria 28880
231 Ga0207660_10004444 3300025917 Bacteria 9135
232 Ga0207660_10030986 3300025917 Bacteria 3680
233 Ga0207660_10070429 3300025917 Bacteria 2542
234 Ga0207662_10040238 3300025918 Unclassified 2747
235 Ga0207657_10028037 3300025919 Bacteria 5146
236 Ga0207657_10030834 3300025919 Bacteria 4860
237 Ga0207657_10543136 3300025919 Bacteria 909
238 Ga0207652_10000409 3300025921 Bacteria 44486
239 Ga0207652_10014525 3300025921 Bacteria 6381
240 Ga0207652_10032144 3300025921 Bacteria 4408
241 Ga0207652_10037033 3300025921 Bacteria 4127
242 Ga0207652_10094272 3300025921 Bacteria 2635
243 Ga0207652_10207114 3300025921 Bacteria 1765
244 Ga0207646_10000002 3300025922 Bacteria 550880
245 Ga0207646_10174355 3300025922 Bacteria 1942
246 Ga0207681_10005375 3300025923 Bacteria 7869
247 Ga0207681_10090087 3300025923 Bacteria 2189
248 Ga0207659_10009717 3300025926 Bacteria 6016
249 Ga0207659_10014442 3300025926 Bacteria 5094
250 Ga0207659_10759673 3300025926 Bacteria 832
251 Ga0207700_10152485 3300025928 Bacteria 1911
252 Ga0207700_10527160 3300025928 Bacteria 1047
253 Ga0207644_10085264 3300025931 Bacteria 2343
254 Ga0207686_10143670 3300025934 Bacteria 1653
255 Ga0207704_10057594 3300025938 Bacteria 2388
256 Ga0207704_10071834 3300025938 Unclassified 2198
257 Ga0207691_10027786 3300025940 Bacteria 5302
258 Ga0207691_10443088 3300025940 Bacteria 1106
259 Ga0207711_10001046 3300025941 Bacteria 26471
260 Ga0207711_10005584 3300025941 Bacteria 10632
261 Ga0207661_10178002 3300025944 Bacteria 1855
262 Ga0207661_10427531 3300025944 Bacteria 1204
263 Ga0207679_10039876 3300025945 Bacteria 3357
264 Ga0207679_10180169 3300025945 Bacteria 1747
265 Ga0207679_10883745 3300025945 Bacteria 817
266 Ga0207667_10018222 3300025949 Bacteria 7879
267 Ga0207667_10025633 3300025949 Bacteria 6451
268 Ga0207667_10083451 3300025949 Bacteria 3308
269 Ga0207651_10029291 3300025960 Bacteria 3487
270 Ga0207651_10099309 3300025960 Bacteria 2155
271 Ga0207651_10743573 3300025960 Bacteria 866
272 Ga0207640_10006783 3300025981 Bacteria 6298
273 Ga0207640_10021410 3300025981 Bacteria 3853
274 Ga0207658_10074378 3300025986 Bacteria 2581
275 Ga0207703_10052240 3300026035 Bacteria 3317
276 Ga0207703_10119131 3300026035 Bacteria 2264
277 Ga0207703_10704462 3300026035 Bacteria 960
278 Ga0207639_10031199 3300026041 Bacteria 3915
279 Ga0207678_10027095 3300026067 Bacteria 4998
280 Ga0207678_10027981 3300026067 Bacteria 4922
281 Ga0207702_10013888 3300026078 Bacteria 6690
282 Ga0207702_10359007 3300026078 Bacteria 1396
283 Ga0207641_10007504 3300026088 Bacteria 9076
284 Ga0207641_10049068 3300026088 Bacteria 3565
285 Ga0207641_10050858 3300026088 Bacteria 3508
286 Ga0207641_10290929 3300026088 Bacteria 1540
287 Ga0207676_10292692 3300026095 Bacteria 1483
288 Ga0207676_10868260 3300026095 Bacteria 883
289 Ga0207674_10023347 3300026116 Bacteria 6628
290 Ga0207674_10080186 3300026116 Bacteria 3267
291 Ga0207674_10189190 3300026116 Unclassified 2008
292 Ga0207675_100023820 3300026118 Bacteria 5695
293 Ga0207683_10152873 3300026121 Unclassified 2083
294 Ga0207683_10158063 3300026121 Unclassified 2048
295 Ga0207698_10007530 3300026142 Bacteria 6823
296 Ga0207698_10931451 3300026142 Bacteria 877
297 Ga0209998_10009832 3300027717 Bacteria 1983
298 Ga0207428_10016919 3300027907 Bacteria 6266
299 Ga0268266_10391111 3300028379 Bacteria 1313
300 Ga0268264_10071279 3300028381 Bacteria 2944
301 Ga0265316_10242217 3300031344 Bacteria 1326
302 Ga0307513_10032409 3300031456 Bacteria 5893
303 Ga0373934_0010138 3300035086 Bacteria 3537
304 Ga0373923_0059413 3300035111 Bacteria 1621
305 Ga0373923_0092637 3300035111 Bacteria 1324
306 Ga0373923_0224035 3300035111 Bacteria 875
307 Ga0373953_0065087 3300035117 Unclassified 1496
308 Ga0373956_0026332 3300035119 Bacteria 2518
309 Ga0373956_0043551 3300035119 Bacteria 1999
310 Ga0373957_0017799 3300035120 Bacteria 2481
311 Ga0373957_0067453 3300035120 Bacteria 1395
312 Ga0373955_0004398 3300035172 Bacteria 6236
313 Ga0373955_0191606 3300035172 Bacteria 1215
314 Ga0373924_0023435 3300035410 Bacteria 2422
315 Ga0373935_0025961 3300035692 Bacteria 3611
316 Ga0373933_0043873 3300035724 Bacteria 2646
317 Ga0373933_0146523 3300035724 Bacteria 1493
318 Ga0373947_0007793 3300035725 Bacteria 6186
319 Ga0373937_0001043 3300036401 Bacteria 23402
320 Ga0373937_0243847 3300036401 Bacteria 1693
321 Ga0395900_0111962 3300037418 Bacteria 2803
322 Ga0395898_0014272 3300037466 Bacteria 8163
323 Ga0436364_0912552 3300037853 Bacteria 7511
324 Ga0395901_0005805 3300038443 Bacteria 12504
325 Ga0395901_0225744 3300038443 Bacteria 1956
326 Ga0395901_0828762 3300038443 Bacteria 912
327 Ga0436360_0462169 3300039438 Unclassified 906
328 Ga0436363_0045766 3300039450 Bacteria 7469
329 Ga0451853_2843911 3300041512 Bacteria 841
330 Ga0451577_0333979 3300042876 Bacteria 1375
331 Ga0466967_0553190 3300045976 Unclassified 1133
332 Ga0495629_0020694 3300046459 Bacteria 4698
333 Ga0495651_0171410 3300046462 Unclassified 1545
334 Ga0495651_0206154 3300046462 Bacteria 1372
335 Ga0495580_0002754 3300046472 Bacteria 15145
336 Ga0495582_0037928 3300046473 Bacteria 2651
337 Ga0495662_0042952 3300046476 Bacteria 2182
338 Ga0495594_0008700 3300046499 Bacteria 5234
339 Ga0495594_0098670 3300046499 Unclassified 1642
340 Ga0495628_0336337 3300046516 Bacteria 1112
341 Ga0495640_0012061 3300046533 Bacteria 6621
342 Ga0495645_0007150 3300046543 Bacteria 7771
343 Ga0495622_0091672 3300046557 Bacteria 1396
344 Ga0495659_0111277 3300046664 Bacteria 1070
345 Ga0495658_0287300 3300046683 Bacteria 1039
346 Ga0495613_0064246 3300046689 Bacteria 2685
347 Ga0495613_0239249 3300046689 Unclassified 1270
348 Ga0495613_0354075 3300046689 Unclassified 1008
349 Ga0495624_0229032 3300046690 Bacteria 1126
350 Ga0495581_0023042 3300047315 Bacteria 3608
351 Ga0495674_0098458 3300047319 Bacteria 2490
352 Ga0495676_0096007 3300047321 Bacteria 2205
353 Ga0495680_0066606 3300047322 Unclassified 2756
354 Ga0495680_0070086 3300047322 Unclassified 2674
355 Ga0495684_0230299 3300047471 Bacteria 1355
356 Ga0496100_0122284 3300048903 Bacteria 1823
357 Ga0496104_0136026 3300048907 Bacteria 2361
358 Ga0496105_0002438 3300048908 Bacteria 13463
359 Ga0496106_0177299 3300048909 Bacteria 1691
360 Ga0496107_0276104 3300048910 Bacteria 1251
361 Ga0496107_0442535 3300048910 Bacteria 966
362 Ga0496108_0019137 3300048911 Bacteria 5619
363 Ga0496108_0036629 3300048911 Bacteria 4083
364 Ga0496108_0417599 3300048911 Bacteria 1172
365 Ga0496109_0003552 3300048912 Bacteria 13011
366 Ga0496110_0059837 3300048913 Bacteria 3358
367 Ga0496110_0268994 3300048913 Bacteria 1552
368 Ga0496111_0433054 3300048914 Bacteria 971
369 Ga0496112_0085758 3300048915 Bacteria 3115
370 Ga0496112_0615970 3300048915 Bacteria 1017
371 Ga0496113_0072435 3300048916 Bacteria 2622
372 Ga0501032_0015639 3300049569 Bacteria 5350
373 Ga0501036_0070531 3300049572 Bacteria 2955
374 Ga0501036_0109272 3300049572 Bacteria 2337
375 Ga0501036_0120016 3300049572 Bacteria 2220
376 Ga0501037_0011548 3300049573 Bacteria 6501
377 Ga0501037_0032169 3300049573 Bacteria 3872
378 Ga0501037_0087619 3300049573 Unclassified 2253
379 Ga0501038_0010581 3300049574 Bacteria 8432
380 Ga0501038_0175510 3300049574 Bacteria 1732
381 Ga0501038_0651875 3300049574 Bacteria 792
382 Ga0501039_0011926 3300049575 Bacteria 6623
383 Ga0501039_0023001 3300049575 Bacteria 4780
384 Ga0501042_0031171 3300049578 Bacteria 3772
385 Ga0501043_0046093 3300049579 Bacteria 3428
386 Ga0501043_0148234 3300049579 Bacteria 1836
387 Ga0501046_0007789 3300049580 Bacteria 9396
388 Ga0501047_0024335 3300049581 Bacteria 5813
389 Ga0501047_0106807 3300049581 Bacteria 2680
390 Ga0501047_0566473 3300049581 Bacteria 959
391 Ga0501048_0027001 3300049582 Bacteria 4176
392 Ga0501048_0027916 3300049582 Bacteria 4099
393 Ga0501067_0088091 3300049583 Bacteria 1723
394 Ga0501069_0189888 3300049585 Bacteria 1188
395 Ga0501070_0002514 3300049586 Bacteria 16069
396 Ga0501070_0014508 3300049586 Bacteria 6629
397 Ga0501071_0199874 3300049587 Bacteria 1501
398 Ga0501072_0198732 3300049588 Bacteria 1599
399 Ga0501073_0037818 3300049589 Bacteria 3426
400 Ga0501073_0049596 3300049589 Bacteria 2943
401 Ga0501074_0002657 3300049590 Bacteria 12519
402 Ga0501074_0014950 3300049590 Bacteria 5648
403 Ga0501075_0347934 3300049591 Bacteria 1129
404 Ga0501076_0042074 3300049592 Bacteria 3597
405 Ga0501080_0019196 3300049742 Bacteria 6330
406 Ga0501080_0048108 3300049742 Bacteria 3970
407 Ga0501080_0052878 3300049742 Bacteria 3781
408 Ga0501080_0355519 3300049742 Bacteria 1322
409 Ga0501080_0572496 3300049742 Bacteria 1005
410 Ga0501081_0019108 3300049743 Bacteria 4558
411 Ga0501035_0008597 3300049822 Bacteria 9500
412 Ga0501035_0038165 3300049822 Bacteria 4349
413 Ga0501035_0123878 3300049822 Bacteria 2257
414 Ga0501035_0131523 3300049822 Bacteria 2181
415 Ga0501035_0220978 3300049822 Bacteria 1617
416 Ga0501035_0338896 3300049822 Bacteria 1260
417 Ga0501044_0041395 3300049823 Bacteria 4796
418 Ga0501044_0083169 3300049823 Bacteria 3237
419 Ga0501044_0314710 3300049823 Bacteria 1491
420 Ga0501044_0456929 3300049823 Bacteria 1183
421 Ga0501045_0102926 3300049824 Bacteria 2114
422 Ga0501045_0176899 3300049824 Bacteria 1589
423 nmdc:mga05p37_177568_c1 3300050507 Bacteria 2593
424 nmdc:mga05p37_400_c1 3300050507 Bacteria 47148
425 nmdc:mga09592_69997_c1 3300050508 Bacteria 2976
426 nmdc:mga09592_7909_c1 3300050508 Bacteria 8639
427 nmdc:mga06r32_8886_c1 3300050510 Bacteria 9055
428 nmdc:mga08y16_23947_c1 3300050511 Bacteria 6448
429 nmdc:mga08y16_293427_c1 3300050511 Bacteria 1676
430 nmdc:mga0n895_10889_c1 3300050512 Bacteria 8077
431 nmdc:mga0n895_161064_c1 3300050512 Bacteria 2275
432 nmdc:mga0n895_4_c1 3300050512 Bacteria 133851
433 nmdc:mga0n895_829156_c1 3300050512 Unclassified 914
434 nmdc:mga0n895_866830_c1 3300050512 Bacteria 890
435 nmdc:mga0rr50_15838_c1 3300050513 Bacteria 4988
436 nmdc:mga0rr50_17395_c1 3300050513 Bacteria 4800
437 nmdc:mga0rr50_188792_c1 3300050513 Unclassified 1688
438 nmdc:mga0rr50_219872_c1 3300050513 Bacteria 1568
439 nmdc:mga0rr50_4_c1 3300050513 Bacteria 338870
440 nmdc:mga08x19_102_c1 3300050514 Bacteria 75432
441 nmdc:mga08x19_155829_c1 3300050514 Bacteria 1549
442 nmdc:mga08x19_17119_c1 3300050514 Bacteria 4431
443 nmdc:mga0a205_12962_c1 3300050515 Bacteria 7737
444 nmdc:mga0a205_160175_c1 3300050515 Bacteria 2148
445 nmdc:mga0a205_213880_c1 3300050515 Bacteria 1815
446 Ga0495601_0133900 3300053077 Unclassified 1615
447 Ga0495601_0160464 3300053077 Bacteria 1469
448 Ga0495601_0270877 3300053077 Unclassified 1108
449 Ga0495595_0099852 3300053084 Bacteria 1400
450 Ga0495619_0080992 3300053085 Bacteria 2186
451 Ga0495619_0315150 3300053085 Unclassified 1083
452 Ga0495619_0478178 3300053085 Bacteria 858
453 Ga0501084_0044818 3300054114 Bacteria 3703
454 2643828452 2643221562 Bacteria 4048635
455 Ga0265327_10003039
456 JGI24736J21556_1003456
457 JGI24741J21665_1002759
458 JGI24741J21665_1003536
459 JGI24741J21665_1003741
460 JGI24740J21852_10000235
461 JGI25162J39368_1002011
462 JGI25164J39214_1000745
463 JGI25165J46597_1001803
464 JGI25165J46597_1002802
465 Ga0055525_1000161
466 Ga0058863_11764645
467 Ga0070658_10223393
468 Ga0070658_10311366
469 Ga0070676_10395117
470 Ga0070683_100057252
471 Ga0070683_100165158
472 Ga0070670_100369303
473 Ga0068869_100175024
474 Ga0070666_10001947
475 Ga0070680_100000138
476 Ga0070680_100047256
477 Ga0070680_100067407
478 Ga0070680_100161275
479 Ga0070680_100222766
480 Ga0070682_100039220
481 Ga0070682_100248454
482 Ga0068868_100003468
483 Ga0070660_100056602
484 Ga0070691_10000204
485 Ga0070691_10056294
486 Ga0070687_100059766
487 Ga0070661_100051944
488 Ga0070661_100054409
489 Ga0070692_10017517
490 Ga0070669_100009009
491 Ga0070675_100013105
492 Ga0070675_100068199
493 Ga0070675_100242890
494 Ga0070671_100014135
495 Ga0070671_100085202
496 Ga0070674_100372062
497 Ga0070673_100022522
498 Ga0070673_100579522
499 Ga0070673_101023827
500 Ga0070688_100064014
501 Ga0070659_100034904
502 Ga0070667_100003122
503 Ga0070667_100014782
504 Ga0070714_100174402
505 Ga0070714_100432456
506 Ga0070713_100181187
507 Ga0070713_100238025
508 Ga0070710_10041673
509 Ga0070711_100158496
510 Ga0070705_100126878
511 Ga0070694_100081879
512 Ga0070708_100235375
513 Ga0070663_100134053
514 Ga0070681_10001058
515 Ga0070681_10073857
516 Ga0070681_10093761
517 Ga0070681_10205936
518 Ga0068867_100114389
519 Ga0070685_10011330
520 Ga0070706_100039754
521 Ga0070707_100000025
522 Ga0070707_100058673
523 Ga0070707_100147818
524 Ga0070698_100213396
525 Ga0070698_100345243
526 Ga0070698_100713698
527 Ga0070699_100005998
528 Ga0070679_100000504
529 Ga0070679_100005669
530 Ga0070679_100022865
531 Ga0070679_100048237
532 Ga0070679_100108637
533 Ga0070679_100215142
534 Ga0070684_100012847
535 Ga0070684_100400398
536 Ga0070697_100025186
537 Ga0070697_100050695
538 Ga0068853_100040635
539 Ga0068853_100068367
540 Ga0070672_100086821
541 Ga0070672_100289352
542 Ga0070686_100151303
543 Ga0070695_100186909
544 Ga0070695_100371254
545 Ga0070693_100051514
546 Ga0070665_100003287
547 Ga0070665_100061063
548 Ga0070704_100359955
549 Ga0068855_100074025
550 Ga0068855_100138332
551 Ga0070664_100153783
552 Ga0070664_101040226
553 Ga0068857_100300831
554 Ga0068857_100366340
555 Ga0068857_100496188
556 Ga0068854_100135554
557 Ga0068856_100099494
558 Ga0068852_100029401
559 Ga0068852_100381095
560 Ga0068859_100012417
561 Ga0068859_100019278
562 Ga0068859_101097145
563 Ga0068864_100182792
564 Ga0068864_100183503
565 Ga0068864_100310695
566 Ga0068861_100312038
567 Ga0068863_100096447
568 Ga0068863_100119801
569 Ga0068863_100187926
570 Ga0068863_100192832
571 Ga0068863_100201327
572 Ga0068858_100218723
573 Ga0068858_100364280
574 Ga0068860_100011450
575 Ga0068860_100073302
576 Ga0068860_100827076
577 Ga0081455_10046966
578 Ga0070715_10297380
579 Ga0097621_100017983
580 Ga0097621_100566242
581 Ga0068871_100014721
582 Ga0068871_100040425
583 Ga0068871_100351179
584 Ga0075428_100067263
585 Ga0075431_100039456
586 Ga0075431_100115196
587 Ga0075431_100419779
588 Ga0075433_10004907
589 Ga0075433_10007233
590 Ga0075433_10127546
591 Ga0075433_10145867
592 Ga0075433_10270881
593 Ga0075433_10281336
594 Ga0075434_100001714
595 Ga0075434_100071568
596 Ga0075434_100170903
597 Ga0075434_100247827
598 Ga0075434_100255098
599 Ga0075434_100314189
600 Ga0075429_100006829
601 Ga0068865_100142327
602 Ga0068865_100169448
603 Ga0075436_100000850
604 Ga0075436_100016959
605 Ga0075436_100111202
606 Ga0097620_100012418
607 Ga0097620_100019278
608 Ga0097620_100635222
609 Ga0097620_101097049
610 Ga0075435_100000051
611 Ga0075435_100005786
612 Ga0075435_100020192
613 Ga0075435_100153258
614 Ga0075435_100173695
615 Ga0075435_100181253
616 Ga0105240_10237700
617 Ga0111539_10030379
618 Ga0114129_10008410
619 Ga0114129_10020932
620 Ga0114129_10077451
621 Ga0114129_10687861
622 Ga0105242_10040851
623 Ga0105242_10225599
624 Ga0105248_10000917
625 Ga0105248_10001271
626 Ga0105248_10001780
627 Ga0105248_10064430
628 Ga0105248_10204869
629 Ga0157373_10035591
630 Ga0157371_10023213
631 Ga0157371_10089666
632 Ga0157370_10224493
633 Ga0157370_10675598
634 Ga0157369_10120410
635 Ga0157374_10008107
636 Ga0157378_10147399
637 Ga0157378_10476113
638 Ga0163162_10063063
639 Ga0163162_10126794
640 Ga0163162_10216706
641 Ga0157372_10054989
642 Ga0157372_10160437
643 Ga0157375_10004755
644 Ga0157375_10058581
645 Ga0157375_10246495
646 Ga0163163_10008201
647 Ga0163163_10105981
648 Ga0163163_10846506
649 Ga0157379_10000109
650 Ga0157379_10001822
651 Ga0157379_10771405
652 Ga0157376_10002659
653 Ga0157376_10018787
654 Ga0157376_10065797
655 Ga0157376_10960502
656 Ga0163161_10065103
657 Ga0197907_10565531
658 Ga0206356_10069590
659 Ga0206350_10122875
660 Ga0206354_10034129
661 Ga0206353_10125677
662 Ga0154015_1208008
663 Ga0213871_10004838
664 Ga0224712_10002264
665 Ga0209563_100088
666 Ga0207427_100119
667 Ga0209437_100005
668 Ga0209233_1000011
669 Ga0207692_10047150
670 Ga0207647_10012630
671 Ga0207645_10054888
672 Ga0207705_10007862
673 Ga0207705_10042625
674 Ga0207707_10000868
675 Ga0207707_10000944
676 Ga0207707_10004809
677 Ga0207707_10014949
678 Ga0207707_10386358
679 Ga0207707_10544332
680 Ga0207695_10024855
681 Ga0207695_10172314
682 Ga0207693_10115946
683 Ga0207663_10109257
684 Ga0207660_10000389
685 Ga0207660_10004444
686 Ga0207660_10030986
687 Ga0207660_10070429
688 Ga0207662_10040238
689 Ga0207657_10028037
690 Ga0207657_10030834
691 Ga0207657_10543136
692 Ga0207652_10000409
693 Ga0207652_10014525
694 Ga0207652_10032144
695 Ga0207652_10037033
696 Ga0207652_10094272
697 Ga0207652_10207114
698 Ga0207646_10000002
699 Ga0207646_10174355
700 Ga0207681_10005375
701 Ga0207681_10090087
702 Ga0207659_10009717
703 Ga0207659_10014442
704 Ga0207659_10759673
705 Ga0207700_10152485
706 Ga0207700_10527160
707 Ga0207644_10085264
708 Ga0207686_10143670
709 Ga0207704_10057594
710 Ga0207704_10071834
711 Ga0207691_10027786
712 Ga0207691_10443088
713 Ga0207711_10001046
714 Ga0207711_10005584
715 Ga0207661_10178002
716 Ga0207661_10427531
717 Ga0207679_10039876
718 Ga0207679_10180169
719 Ga0207679_10883745
720 Ga0207667_10018222
721 Ga0207667_10025633
722 Ga0207667_10083451
723 Ga0207651_10029291
724 Ga0207651_10099309
725 Ga0207651_10743573
726 Ga0207640_10006783
727 Ga0207640_10021410
728 Ga0207658_10074378
729 Ga0207703_10052240
730 Ga0207703_10119131
731 Ga0207703_10704462
732 Ga0207639_10031199
733 Ga0207678_10027095
734 Ga0207678_10027981
735 Ga0207702_10013888
736 Ga0207702_10359007
737 Ga0207641_10007504
738 Ga0207641_10049068
739 Ga0207641_10050858
740 Ga0207641_10290929
741 Ga0207676_10292692
742 Ga0207676_10868260
743 Ga0207674_10023347
744 Ga0207674_10080186
745 Ga0207674_10189190
746 Ga0207675_100023820
747 Ga0207683_10152873
748 Ga0207683_10158063
749 Ga0207698_10007530
750 Ga0207698_10931451
751 Ga0209998_10009832
752 Ga0207428_10016919
753 Ga0268266_10391111
754 Ga0268264_10071279
755 Ga0265316_10242217
756 Ga0307513_10032409
757 Ga0373934_0010138
758 Ga0373923_0059413
759 Ga0373923_0092637
760 Ga0373923_0224035
761 Ga0373953_0065087
762 Ga0373956_0026332
763 Ga0373956_0043551
764 Ga0373957_0017799
765 Ga0373957_0067453
766 Ga0373955_0004398
767 Ga0373955_0191606
768 Ga0373924_0023435
769 Ga0373935_0025961
770 Ga0373933_0043873
771 Ga0373933_0146523
772 Ga0373947_0007793
773 Ga0373937_0001043
774 Ga0373937_0243847
775 Ga0395900_0111962
776 Ga0395898_0014272
777 Ga0436364_0912552
778 Ga0395901_0005805
779 Ga0395901_0225744
780 Ga0395901_0828762
781 Ga0436360_0462169
782 Ga0436363_0045766
783 Ga0451853_2843911
784 Ga0451577_0333979
785 Ga0466967_0553190
786 Ga0495629_0020694
787 Ga0495651_0171410
788 Ga0495651_0206154
789 Ga0495580_0002754
790 Ga0495582_0037928
791 Ga0495662_0042952
792 Ga0495594_0008700
793 Ga0495594_0098670
794 Ga0495628_0336337
795 Ga0495640_0012061
796 Ga0495645_0007150
797 Ga0495622_0091672
798 Ga0495659_0111277
799 Ga0495658_0287300
800 Ga0495613_0064246
801 Ga0495613_0239249
802 Ga0495613_0354075
803 Ga0495624_0229032
804 Ga0495581_0023042
805 Ga0495674_0098458
806 Ga0495676_0096007
807 Ga0495680_0066606
808 Ga0495680_0070086
809 Ga0495684_0230299
810 Ga0496100_0122284
811 Ga0496104_0136026
812 Ga0496105_0002438
813 Ga0496106_0177299
814 Ga0496107_0276104
815 Ga0496107_0442535
816 Ga0496108_0019137
817 Ga0496108_0036629
818 Ga0496108_0417599
819 Ga0496109_0003552
820 Ga0496110_0059837
821 Ga0496110_0268994
822 Ga0496111_0433054
823 Ga0496112_0085758
824 Ga0496112_0615970
825 Ga0496113_0072435
826 Ga0501032_0015639
827 Ga0501036_0070531
828 Ga0501036_0109272
829 Ga0501036_0120016
830 Ga0501037_0011548
831 Ga0501037_0032169
832 Ga0501037_0087619
833 Ga0501038_0010581
834 Ga0501038_0175510
835 Ga0501038_0651875
836 Ga0501039_0011926
837 Ga0501039_0023001
838 Ga0501042_0031171
839 Ga0501043_0046093
840 Ga0501043_0148234
841 Ga0501046_0007789
842 Ga0501047_0024335
843 Ga0501047_0106807
844 Ga0501047_0566473
845 Ga0501048_0027001
846 Ga0501048_0027916
847 Ga0501067_0088091
848 Ga0501069_0189888
849 Ga0501070_0002514
850 Ga0501070_0014508
851 Ga0501071_0199874
852 Ga0501072_0198732
853 Ga0501073_0037818
854 Ga0501073_0049596
855 Ga0501074_0002657
856 Ga0501074_0014950
857 Ga0501075_0347934
858 Ga0501076_0042074
859 Ga0501080_0019196
860 Ga0501080_0048108
861 Ga0501080_0052878
862 Ga0501080_0355519
863 Ga0501080_0572496
864 Ga0501081_0019108
865 Ga0501035_0008597
866 Ga0501035_0038165
867 Ga0501035_0123878
868 Ga0501035_0131523
869 Ga0501035_0220978
870 Ga0501035_0338896
871 Ga0501044_0041395
872 Ga0501044_0083169
873 Ga0501044_0314710
874 Ga0501044_0456929
875 Ga0501045_0102926
876 Ga0501045_0176899
877 nmdc:mga05p37_177568_c1
878 nmdc:mga05p37_400_c1
879 nmdc:mga09592_69997_c1
880 nmdc:mga09592_7909_c1
881 nmdc:mga06r32_8886_c1
882 nmdc:mga08y16_23947_c1
883 nmdc:mga08y16_293427_c1
884 nmdc:mga0n895_10889_c1
885 nmdc:mga0n895_161064_c1
886 nmdc:mga0n895_4_c1
887 nmdc:mga0n895_829156_c1
888 nmdc:mga0n895_866830_c1
889 nmdc:mga0rr50_15838_c1
890 nmdc:mga0rr50_17395_c1
891 nmdc:mga0rr50_188792_c1
892 nmdc:mga0rr50_219872_c1
893 nmdc:mga0rr50_4_c1
894 nmdc:mga08x19_102_c1
895 nmdc:mga08x19_155829_c1
896 nmdc:mga08x19_17119_c1
897 nmdc:mga0a205_12962_c1
898 nmdc:mga0a205_160175_c1
899 nmdc:mga0a205_213880_c1
900 Ga0495601_0133900
901 Ga0495601_0160464
902 Ga0495601_0270877
903 Ga0495595_0099852
904 Ga0495619_0080992
905 Ga0495619_0315150
906 Ga0495619_0478178
907 Ga0501084_0044818
908 2643828452

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p11-assembly1.cif.gz_A crystal structure of a putative haloacid dehalogenase-like hydrolase (bxe_b1342) from burkholderia xenovorans lb400 at 2.20 a resolution 0.9348 6 218
2p11-assembly1.cif.gz_B crystal structure of a putative haloacid dehalogenase-like hydrolase (bxe_b1342) from burkholderia xenovorans lb400 at 2.20 a resolution 0.9293 6 218
2p11-assembly1.cif.gz_B crystal structure of a putative haloacid dehalogenase-like hydrolase (bxe_b1342) from burkholderia xenovorans lb400 at 2.20 a resolution 0.917 6 218
2p11-assembly1.cif.gz_A crystal structure of a putative haloacid dehalogenase-like hydrolase (bxe_b1342) from burkholderia xenovorans lb400 at 2.20 a resolution 0.9023 6 218
4knv-assembly1.cif.gz_A the crystal structure of apo human hdhd4 from se-mad 0.7552 8 224
ID Description Score Start End Superfamily
2p11B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9469 6 217 3.40.50.1000
2p11B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9265 6 217 3.40.50.1000
2p11B02 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1; 0.8179 19 93 1.10.286.50
2p11B02 Mainly Alpha;Orthogonal Bundle;GTP Cyclohydrolase I; Chain A, domain 1; 0.8085 19 93 1.10.286.50
3ddhB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.7848 5 215 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A2V9XUK4-F1-model_v4 Haloacid dehalogenase 0.9946 123 222
AF-A0A317HL04-F1-model_v4 Haloacid dehalogenase 0.9824 148 215
AF-A0A7V8Z6R2-F1-model_v4 Uncharacterized protein 0.9815 138 222
AF-A0A059WMU8-F1-model_v4 Haloacid dehalogenase-like hydrolase 0.9805 85 224 GO:0016787
AF-A0A366F977-F1-model_v4 Haloacid dehalogenase-like hydrolase 0.9748 6 221 GO:0016787

Map