F447409

General Info

Members Datasets Scaffolds Average Seq Length
454 290 908 125

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100200117|Ga0307408_1002001172
Length 129
Sequence MPTPETLERFIARVEENAHVEAILEFYSEDATMRENFKPARGPRAALAEREGKTMDRARSVRSTCVRPVLVNGDIVVVRWIFEFEWKDGAPPTRMEELAYQRWEGERIAQEQFFYDPAQLAQNVDSGRT

Samples

Sample ID Description Type Environment
1 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
6 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
7 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
104 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
107 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
156 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
160 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
163 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
164 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
165 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
168 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
169 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
182 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
183 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
184 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
185 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
186 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
187 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
188 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
189 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
190 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
191 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
192 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
193 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
196 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
197 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
198 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
199 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
200 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
201 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
202 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
203 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
207 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
210 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
211 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
214 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
215 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
216 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
222 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
229 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
230 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
234 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
235 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
236 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
237 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
238 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
239 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
242 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
243 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
244 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
245 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
246 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
247 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
251 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
252 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
253 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
254 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
255 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
256 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
257 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
265 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
266 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
267 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
268 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
269 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
270 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
271 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
272 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
273 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
274 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
275 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
276 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
277 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
278 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
279 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
280 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
281 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
282 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
283 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
284 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
285 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
286 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
288 2738543013 Variovorax sp. BT01 Isolate Unclassified
289 2928051484 Variovorax sp. 1133 Isolate Unclassified
290 2928064002 Variovorax sp. 1140 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.9
Metatranscriptomes 0.44
Isolates 0.66

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.08
Nodule 0
Rhizoplane 1.54
Rhizosphere 77.53
Stem 0
Stem Tuber 0
Unclassified 6.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307408_100200117 3300031548 Bacteria 1616
2 JGI25165J46597_1019594 3300003214 Bacteria 891
3 rootH1_10040968 3300003323 Bacteria 1055
4 rootH1_10114567 3300003323 Bacteria 2429
5 Ga0006562J51391_1020282 3300003578 Bacteria 6010
6 Ga0006562J51391_1020283 3300003578 Bacteria 4340
7 Ga0055532_1011416 3300003758 Bacteria 1046
8 Ga0055535_1000757 3300003761 Bacteria 24045
9 Ga0055542_1000114 3300003762 Bacteria 107058
10 Ga0055534_1026857 3300003784 Bacteria 912
11 Ga0055540_1034496 3300003792 Bacteria 1138
12 Ga0065712_10608734 3300005290 Unclassified 587
13 Ga0070658_10170885 3300005327 Bacteria 1826
14 Ga0070670_100570289 3300005331 Bacteria 1011
15 Ga0070670_100778267 3300005331 Bacteria 863
16 Ga0068869_100043415 3300005334 Bacteria 3229
17 Ga0068869_100191129 3300005334 Bacteria 1610
18 Ga0070666_10274965 3300005335 Bacteria 1196
19 Ga0070666_10604756 3300005335 Bacteria 800
20 Ga0070666_11435795 3300005335 Bacteria 516
21 Ga0070680_100263341 3300005336 Bacteria 1459
22 Ga0068868_100031405 3300005338 Bacteria 4079
23 Ga0068868_100075610 3300005338 Bacteria 2692
24 Ga0068868_101418603 3300005338 Unclassified 648
25 Ga0070660_100479004 3300005339 Bacteria 1034
26 Ga0070689_100020428 3300005340 Bacteria 4914
27 Ga0070687_100293441 3300005343 Bacteria 1029
28 Ga0070668_100140085 3300005347 Bacteria 1949
29 Ga0070668_100983127 3300005347 Bacteria 758
30 Ga0070669_100063288 3300005353 Bacteria 2723
31 Ga0070669_100167563 3300005353 Bacteria 1711
32 Ga0070675_100021265 3300005354 Bacteria 5183
33 Ga0070675_100032084 3300005354 Bacteria 4249
34 Ga0070671_100071446 3300005355 Bacteria 2896
35 Ga0070671_100364407 3300005355 Bacteria 1234
36 Ga0070674_101982682 3300005356 Bacteria 530
37 Ga0070673_100082855 3300005364 Bacteria 2604
38 Ga0070673_100282250 3300005364 Bacteria 1457
39 Ga0070688_100001277 3300005365 Bacteria 12541
40 Ga0070688_100554196 3300005365 Bacteria 874
41 Ga0070667_100223998 3300005367 Bacteria 1675
42 Ga0070667_100416643 3300005367 Bacteria 1224
43 Ga0070667_101870217 3300005367 Bacteria 565
44 Ga0070701_10729815 3300005438 Unclassified 669
45 Ga0070700_100008165 3300005441 Bacteria 5697
46 Ga0070708_100733386 3300005445 Bacteria 929
47 Ga0070663_100121688 3300005455 Unclassified 1972
48 Ga0070663_100773901 3300005455 Bacteria 821
49 Ga0070678_100083155 3300005456 Bacteria 2433
50 Ga0070678_100187041 3300005456 Bacteria 1700
51 Ga0068867_100009704 3300005459 Bacteria 6788
52 Ga0068867_100818333 3300005459 Bacteria 832
53 Ga0070685_10002790 3300005466 Bacteria 8927
54 Ga0070685_10378347 3300005466 Bacteria 975
55 Ga0070698_100551365 3300005471 Unclassified 1092
56 Ga0070684_101860480 3300005535 Bacteria 568
57 Ga0068853_100115252 3300005539 Bacteria 2391
58 Ga0068853_100395223 3300005539 Bacteria 1293
59 Ga0070672_100004468 3300005543 Bacteria 9161
60 Ga0070672_100172374 3300005543 Bacteria 1800
61 Ga0070672_100544021 3300005543 Bacteria 1008
62 Ga0070696_100563669 3300005546 Unclassified 914
63 Ga0070665_100028172 3300005548 Bacteria 5657
64 Ga0070665_100801829 3300005548 Bacteria 955
65 Ga0068855_100078650 3300005563 Bacteria 3826
66 Ga0068855_100564560 3300005563 Bacteria 1231
67 Ga0068854_101218017 3300005578 Bacteria 675
68 Ga0070702_100148898 3300005615 Bacteria 1500
69 Ga0068852_100036833 3300005616 Bacteria 4098
70 Ga0068852_100284658 3300005616 Bacteria 1595
71 Ga0068852_100689631 3300005616 Bacteria 1031
72 Ga0068859_100040031 3300005617 Bacteria 4704
73 Ga0068859_100045434 3300005617 Bacteria 4413
74 Ga0068859_100070370 3300005617 Bacteria 3534
75 Ga0068859_100293543 3300005617 Bacteria 1719
76 Ga0068864_100026952 3300005618 Bacteria 4848
77 Ga0068866_10222622 3300005718 Bacteria 1139
78 Ga0068861_100001145 3300005719 Bacteria 16514
79 Ga0068861_100070264 3300005719 Bacteria 2711
80 Ga0068851_10124328 3300005834 Bacteria 1389
81 Ga0068863_101896573 3300005841 Unclassified 606
82 Ga0068858_100008531 3300005842 Bacteria 9847
83 Ga0068858_100024041 3300005842 Bacteria 5678
84 Ga0068858_100040538 3300005842 Bacteria 4319
85 Ga0068858_101985571 3300005842 Bacteria 575
86 Ga0068860_100003560 3300005843 Bacteria 16016
87 Ga0068860_100109949 3300005843 Bacteria 2634
88 Ga0068862_100012131 3300005844 Bacteria 7122
89 Ga0068862_100021363 3300005844 Bacteria 5408
90 Ga0068862_100823020 3300005844 Bacteria 908
91 Ga0075365_10106370 3300006038 Bacteria 1925
92 Ga0075368_10060006 3300006042 Bacteria 1522
93 Ga0075363_100136743 3300006048 Bacteria 1377
94 Ga0075362_10141059 3300006177 Bacteria 1151
95 Ga0075362_10175094 3300006177 Bacteria 1038
96 Ga0075367_10166613 3300006178 Bacteria 1371
97 Ga0075366_10039085 3300006195 Bacteria 2803
98 Ga0075366_10087602 3300006195 Bacteria 1864
99 Ga0075366_10138807 3300006195 Bacteria 1469
100 Ga0075366_10154511 3300006195 Bacteria 1390
101 Ga0075366_10190357 3300006195 Bacteria 1247
102 Ga0097621_100073224 3300006237 Bacteria 2836
103 Ga0097621_100607433 3300006237 Unclassified 1000
104 Ga0097621_101118050 3300006237 Bacteria 740
105 Ga0075370_10018293 3300006353 Bacteria 3801
106 Ga0075370_10611033 3300006353 Bacteria 661
107 Ga0068871_100061633 3300006358 Bacteria 3064
108 Ga0075428_100013980 3300006844 Bacteria 8936
109 Ga0075434_100305314 3300006871 Unclassified 1612
110 Ga0068865_100098358 3300006881 Bacteria 2138
111 Ga0068865_100614532 3300006881 Bacteria 920
112 Ga0097620_100040032 3300006931 Bacteria 4704
113 Ga0097620_100045434 3300006931 Bacteria 4413
114 Ga0097620_100070368 3300006931 Bacteria 3534
115 Ga0097620_100293529 3300006931 Bacteria 1719
116 Ga0105244_10195701 3300009036 Bacteria 954
117 Ga0105250_10279568 3300009092 Bacteria 718
118 Ga0105240_10000377 3300009093 Bacteria 83854
119 Ga0105240_10095057 3300009093 Bacteria 3634
120 Ga0105240_11004374 3300009093 Bacteria 892
121 Ga0111539_10003384 3300009094 Bacteria 21018
122 Ga0111539_12227022 3300009094 Bacteria 636
123 Ga0105245_10074928 3300009098 Bacteria 3080
124 Ga0105245_10118826 3300009098 Bacteria 2467
125 Ga0105245_10281234 3300009098 Bacteria 1626
126 Ga0105245_10447941 3300009098 Bacteria 1299
127 Ga0114129_10107425 3300009147 Bacteria 3855
128 Ga0114129_10615856 3300009147 Bacteria 1405
129 Ga0105243_10289543 3300009148 Bacteria 1479
130 Ga0105243_10763160 3300009148 Bacteria 949
131 Ga0105241_10290959 3300009174 Bacteria 1398
132 Ga0105242_10010423 3300009176 Bacteria 7131
133 Ga0105242_10197931 3300009176 Bacteria 1783
134 Ga0105242_11559097 3300009176 Bacteria 693
135 Ga0105248_10003365 3300009177 Bacteria 17772
136 Ga0105248_10011910 3300009177 Bacteria 9592
137 Ga0105248_10019238 3300009177 Bacteria 7555
138 Ga0105237_10065910 3300009545 Bacteria 3616
139 Ga0105237_10197164 3300009545 Bacteria 2013
140 Ga0105238_10006002 3300009551 Bacteria 12042
141 Ga0105238_10224809 3300009551 Bacteria 1854
142 Ga0105238_10853472 3300009551 Bacteria 928
143 Ga0105238_10994285 3300009551 Bacteria 860
144 Ga0105238_11187453 3300009551 Bacteria 787
145 Ga0105249_10045333 3300009553 Bacteria 3999
146 Ga0105239_10206711 3300010375 Bacteria 2200
147 Ga0105246_10012522 3300011119 Bacteria 5297
148 Ga0105246_10281638 3300011119 Bacteria 1334
149 Ga0105246_10352802 3300011119 Bacteria 1206
150 Ga0105246_10412703 3300011119 Bacteria 1124
151 Ga0157373_10068079 3300013100 Bacteria 2517
152 Ga0157371_10172063 3300013102 Bacteria 1548
153 Ga0157369_10013176 3300013105 Bacteria 9356
154 Ga0157369_10567688 3300013105 Bacteria 1172
155 Ga0157374_10117551 3300013296 Bacteria 2563
156 Ga0157374_10423460 3300013296 Bacteria 1330
157 Ga0157374_10995261 3300013296 Unclassified 857
158 Ga0157378_10025211 3300013297 Bacteria 5238
159 Ga0163162_10009102 3300013306 Bacteria 9654
160 Ga0163162_11958997 3300013306 Bacteria 671
161 Ga0157372_10567916 3300013307 Bacteria 1322
162 Ga0157375_10140503 3300013308 Bacteria 2542
163 Ga0157375_10985111 3300013308 Unclassified 983
164 Ga0163163_10064287 3300014325 Bacteria 3641
165 Ga0163163_12283079 3300014325 Unclassified 600
166 Ga0157380_10018756 3300014326 Bacteria 5143
167 Ga0157380_10731724 3300014326 Bacteria 998
168 Ga0157377_10064879 3300014745 Bacteria 2096
169 Ga0157377_10434855 3300014745 Bacteria 902
170 Ga0157379_10132206 3300014968 Bacteria 2246
171 Ga0157379_10173331 3300014968 Bacteria 1947
172 Ga0157379_10252795 3300014968 Bacteria 1600
173 Ga0157376_10024201 3300014969 Bacteria 4764
174 Ga0157376_10095616 3300014969 Bacteria 2584
175 Ga0157376_10812216 3300014969 Bacteria 948
176 Ga0157376_11280388 3300014969 Bacteria 763
177 Ga0182006_1254779 3300015261 Bacteria 576
178 Ga0163161_10066955 3300017792 Bacteria 2623
179 Ga0209672_100157 3300025228 Bacteria 59454
180 Ga0209147_100797 3300025229 Bacteria 15243
181 Ga0209258_100225 3300025242 Bacteria 107138
182 Ga0209148_1000040 3300025254 Bacteria 473531
183 Ga0209759_1008638 3300025256 Bacteria 3157
184 Ga0209233_1001616 3300025261 Bacteria 8769
185 Ga0209130_1000828 3300025284 Bacteria 26047
186 Ga0209675_1001057 3300025291 Bacteria 17066
187 Ga0209675_1008734 3300025291 Bacteria 3673
188 Ga0209025_1027955 3300025294 Bacteria 2779
189 Ga0209050_1044894 3300025298 Bacteria 1177
190 Ga0209050_1052228 3300025298 Bacteria 1025
191 Ga0209051_1001991 3300025303 Bacteria 15655
192 Ga0209257_1059261 3300025304 Bacteria 1046
193 Ga0207697_10184798 3300025315 Bacteria 914
194 Ga0207656_10662008 3300025321 Bacteria 534
195 Ga0207682_10112853 3300025893 Bacteria 1198
196 Ga0207642_10686623 3300025899 Unclassified 644
197 Ga0207688_10050702 3300025901 Bacteria 2324
198 Ga0207680_10686268 3300025903 Bacteria 734
199 Ga0207654_10221470 3300025911 Bacteria 1255
200 Ga0207695_10000007 3300025913 Bacteria 1092551
201 Ga0207695_10463198 3300025913 Bacteria 1150
202 Ga0207695_11518847 3300025913 Bacteria 550
203 Ga0207671_10270876 3300025914 Bacteria 1338
204 Ga0207671_10654131 3300025914 Bacteria 837
205 Ga0207660_10335380 3300025917 Bacteria 1210
206 Ga0207681_10049313 3300025923 Bacteria 2846
207 Ga0207681_10340859 3300025923 Bacteria 1197
208 Ga0207694_10002131 3300025924 Bacteria 16262
209 Ga0207694_10403146 3300025924 Bacteria 1137
210 Ga0207694_10534559 3300025924 Unclassified 983
211 Ga0207694_10711535 3300025924 Bacteria 847
212 Ga0207650_10271513 3300025925 Bacteria 1378
213 Ga0207650_10541578 3300025925 Bacteria 975
214 Ga0207659_10034136 3300025926 Bacteria 3506
215 Ga0207687_10027000 3300025927 Bacteria 3848
216 Ga0207687_10053532 3300025927 Bacteria 2820
217 Ga0207644_10078805 3300025931 Bacteria 2429
218 Ga0207690_10087635 3300025932 Bacteria 2191
219 Ga0207686_10026212 3300025934 Bacteria 3399
220 Ga0207686_10641217 3300025934 Bacteria 840
221 Ga0207709_10018390 3300025935 Bacteria 3914
222 Ga0207709_10103588 3300025935 Bacteria 1886
223 Ga0207709_10285929 3300025935 Bacteria 1220
224 Ga0207709_10762003 3300025935 Unclassified 779
225 Ga0207670_10002224 3300025936 Bacteria 10144
226 Ga0207670_10148956 3300025936 Bacteria 1734
227 Ga0207704_10019317 3300025938 Bacteria 3576
228 Ga0207691_10006806 3300025940 Bacteria 11022
229 Ga0207691_10049790 3300025940 Bacteria 3839
230 Ga0207691_10178100 3300025940 Bacteria 1859
231 Ga0207711_10171895 3300025941 Bacteria 1966
232 Ga0207661_12078708 3300025944 Bacteria 514
233 Ga0207667_10051176 3300025949 Bacteria 4356
234 Ga0207667_10969087 3300025949 Bacteria 839
235 Ga0207651_10143989 3300025960 Bacteria 1845
236 Ga0207712_10170415 3300025961 Bacteria 1701
237 Ga0207668_11250153 3300025972 Bacteria 668
238 Ga0207640_11058081 3300025981 Bacteria 716
239 Ga0207640_11219263 3300025981 Bacteria 669
240 Ga0207658_10958598 3300025986 Bacteria 780
241 Ga0207658_11054824 3300025986 Unclassified 742
242 Ga0207677_10090681 3300026023 Bacteria 2222
243 Ga0207677_10182060 3300026023 Bacteria 1654
244 Ga0207677_11232951 3300026023 Bacteria 685
245 Ga0207703_10016889 3300026035 Bacteria 5693
246 Ga0207703_10857920 3300026035 Bacteria 868
247 Ga0207639_10472247 3300026041 Bacteria 1142
248 Ga0207678_10092655 3300026067 Bacteria 2582
249 Ga0207641_10063205 3300026088 Bacteria 3162
250 Ga0207641_10392412 3300026088 Bacteria 1331
251 Ga0207641_11484960 3300026088 Unclassified 679
252 Ga0207641_12522208 3300026088 Unclassified 512
253 Ga0207648_10000556 3300026089 Bacteria 41762
254 Ga0207648_10385873 3300026089 Bacteria 1267
255 Ga0207676_10045329 3300026095 Bacteria 3397
256 Ga0207675_100002028 3300026118 Bacteria 20196
257 Ga0207683_10036689 3300026121 Bacteria 4270
258 Ga0207683_10230634 3300026121 Bacteria 1688
259 Ga0207698_10234067 3300026142 Bacteria 1669
260 Ga0209970_1011219 3300027614 Bacteria 1472
261 Ga0209813_10036057 3300027866 Bacteria 1484
262 Ga0207428_10004349 3300027907 Bacteria 13530
263 Ga0268266_10101984 3300028379 Bacteria 2531
264 Ga0268266_10691781 3300028379 Bacteria 982
265 Ga0268266_11662067 3300028379 Bacteria 614
266 Ga0268265_10099541 3300028380 Bacteria 2344
267 Ga0268265_10194750 3300028380 Bacteria 1753
268 Ga0268264_10003478 3300028381 Bacteria 13579
269 Ga0268264_10111080 3300028381 Bacteria 2401
270 Ga0307515_10361665 3300028794 Bacteria 1092
271 Ga0307513_10647017 3300031456 Bacteria 764
272 Ga0307408_100006044 3300031548 Bacteria 8053
273 Ga0307408_100220333 3300031548 Bacteria 1548
274 Ga0307405_10075105 3300031731 Bacteria 2188
275 Ga0307405_10343655 3300031731 Bacteria 1148
276 Ga0307413_10245955 3300031824 Bacteria 1324
277 Ga0307406_10001342 3300031901 Bacteria 13818
278 Ga0307406_11035070 3300031901 Bacteria 706
279 Ga0307407_11532780 3300031903 Bacteria 528
280 Ga0307412_10518522 3300031911 Bacteria 995
281 Ga0307416_100160231 3300032002 Bacteria 2079
282 Ga0307416_100403058 3300032002 Bacteria 1406
283 Ga0307416_101595786 3300032002 Bacteria 758
284 Ga0307416_101671556 3300032002 Bacteria 742
285 Ga0307414_10179496 3300032004 Bacteria 1701
286 Ga0373930_0134625 3300034816 Bacteria 610
287 Ga0373958_0173509 3300034819 Unclassified 552
288 Ga0373953_0570457 3300035117 Unclassified 504
289 Ga0373957_0180127 3300035120 Bacteria 876
290 Ga0373943_0161469 3300035170 Bacteria 1220
291 Ga0373946_0028464 3300035171 Bacteria 2217
292 Ga0373955_0233090 3300035172 Unclassified 1102
293 Ga0373942_0100192 3300035207 Bacteria 884
294 Ga0373935_0002316 3300035692 Bacteria 10871
295 Ga0373935_0184035 3300035692 Bacteria 1436
296 Ga0373935_0373764 3300035692 Bacteria 1020
297 Ga0373927_0266567 3300035695 Bacteria 1126
298 Ga0373937_0027902 3300036401 Bacteria 5108
299 Ga0373937_0109320 3300036401 Unclassified 2571
300 Ga0373937_0597189 3300036401 Bacteria 1048
301 Ga0373925_0150880 3300037068 Bacteria 1825
302 Ga0373925_0405879 3300037068 Unclassified 1112
303 Ga0373925_0507421 3300037068 Bacteria 990
304 Ga0395899_0072164 3300037312 Bacteria 2526
305 Ga0395900_0035012 3300037418 Bacteria 5171
306 Ga0395900_0185374 3300037418 Bacteria 2112
307 Ga0395900_0802380 3300037418 Bacteria 869
308 Ga0395900_1655480 3300037418 Bacteria 551
309 Ga0395898_0041586 3300037466 Bacteria 4539
310 Ga0395898_0165317 3300037466 Bacteria 2116
311 Ga0395905_0002500 3300037471 Bacteria 20326
312 Ga0395905_0167707 3300037471 Bacteria 2063
313 Ga0395905_0213931 3300037471 Bacteria 1805
314 Ga0395901_0002273 3300038443 Bacteria 19596
315 Ga0395901_0013966 3300038443 Bacteria 8172
316 Ga0242420_059582 3300038996 Bacteria 759
317 Ga0451797_1239823 3300041453 Bacteria 595
318 Ga0451807_0646200 3300041486 Bacteria 1846
319 Ga0451853_1156243 3300041512 Bacteria 1396
320 Ga0439441_084037 3300042001 Bacteria 697
321 Ga0439442_149814 3300042002 Bacteria 519
322 Ga0439455_0008233 3300042012 Bacteria 2231
323 Ga0450921_018799 3300042123 Bacteria 644
324 Ga0450891_027330 3300042129 Bacteria 581
325 Ga0439446_0235294 3300042156 Bacteria 628
326 Ga0466969_0008168 3300044656 Bacteria 5554
327 Ga0466972_0043987 3300044658 Bacteria 2167
328 Ga0466965_0016775 3300044683 Bacteria 3492
329 Ga0466966_0019239 3300044684 Bacteria 4494
330 Ga0466961_0012032 3300044693 Bacteria 5528
331 Ga0466961_0096562 3300044693 Bacteria 1863
332 Ga0466963_0533982 3300044694 Bacteria 828
333 Ga0466964_0128718 3300044706 Bacteria 1150
334 Ga0466968_0023473 3300044735 Bacteria 2513
335 Ga0466970_0050304 3300044765 Bacteria 2222
336 Ga0466957_0234887 3300044842 Bacteria 1215
337 Ga0466960_0221541 3300044901 Bacteria 1041
338 Ga0466960_0287289 3300044901 Bacteria 923
339 Ga0466959_0011234 3300045049 Bacteria 6425
340 Ga0495627_035249 3300046453 Bacteria 1560
341 Ga0495629_0096912 3300046459 Bacteria 2057
342 Ga0495629_0466432 3300046459 Bacteria 854
343 Ga0495638_0070353 3300046460 Bacteria 2142
344 Ga0495585_0018519 3300046492 Bacteria 4016
345 Ga0495606_0029288 3300046507 Bacteria 3869
346 Ga0495608_0504779 3300046511 Unclassified 732
347 Ga0495610_0062544 3300046512 Bacteria 1765
348 Ga0495616_0005489 3300046513 Bacteria 7795
349 Ga0495620_0018364 3300046515 Bacteria 3464
350 Ga0495620_0085254 3300046515 Bacteria 1273
351 Ga0495631_0000944 3300046518 Bacteria 18151
352 Ga0495637_0003665 3300046520 Bacteria 8134
353 Ga0495654_0087042 3300046530 Bacteria 1455
354 Ga0495654_0143246 3300046530 Bacteria 1063
355 Ga0495587_0386830 3300046536 Bacteria 778
356 Ga0495621_0174148 3300046539 Bacteria 856
357 Ga0495622_0158339 3300046557 Bacteria 1022
358 Ga0495622_0303275 3300046557 Unclassified 696
359 Ga0495668_0085582 3300046616 Bacteria 1729
360 Ga0495625_0122908 3300046660 Bacteria 1765
361 Ga0495625_0400510 3300046660 Bacteria 857
362 Ga0495635_0077792 3300046663 Bacteria 2272
363 Ga0495635_0406967 3300046663 Bacteria 903
364 Ga0495659_0179496 3300046664 Bacteria 862
365 Ga0495661_0067341 3300046665 Bacteria 2104
366 Ga0495588_0129082 3300046674 Bacteria 1333
367 Ga0495588_0217174 3300046674 Bacteria 1009
368 Ga0495646_0431503 3300046680 Bacteria 682
369 Ga0495647_0100909 3300046681 Unclassified 1195
370 Ga0495658_0009696 3300046683 Bacteria 4802
371 Ga0495658_0030407 3300046683 Bacteria 2932
372 Ga0495624_0608197 3300046690 Bacteria 651
373 Ga0495670_0071714 3300046691 Bacteria 1754
374 Ga0495670_0122522 3300046691 Bacteria 1351
375 Ga0495671_0021800 3300046692 Bacteria 3360
376 Ga0495660_0087852 3300046810 Bacteria 1621
377 Ga0495660_0330239 3300046810 Bacteria 683
378 Ga0495676_0017712 3300047321 Bacteria 6291
379 Ga0495680_0068691 3300047322 Bacteria 2706
380 Ga0495684_0029556 3300047471 Bacteria 4207
381 Ga0495686_0256856 3300047472 Bacteria 980
382 Ga0495602_0630085 3300048088 Bacteria 734
383 Ga0495614_0110717 3300048089 Bacteria 1205
384 Ga0495614_0192777 3300048089 Bacteria 920
385 Ga0496103_0701272 3300048906 Bacteria 642
386 Ga0496104_1787812 3300048907 Unclassified 517
387 Ga0496109_0485389 3300048912 Bacteria 1166
388 Ga0496112_0005094 3300048915 Bacteria 11290
389 Ga0496114_0891392 3300048917 Bacteria 770
390 Ga0496117_0025487 3300048920 Bacteria 4649
391 Ga0496117_0122363 3300048920 Bacteria 1596
392 Ga0496118_0066134 3300048921 Bacteria 2640
393 Ga0496118_0124597 3300048921 Bacteria 1671
394 Ga0496121_0247716 3300048924 Bacteria 1237
395 Ga0496121_0596295 3300048924 Bacteria 682
396 Ga0496122_0000034 3300048925 Bacteria 320661
397 Ga0496122_0195173 3300048925 Bacteria 1190
398 Ga0496123_0070664 3300048926 Bacteria 2183
399 Ga0496123_0233682 3300048926 Bacteria 918
400 Ga0496125_0329139 3300048928 Bacteria 922
401 Ga0496126_0534585 3300048929 Bacteria 932
402 Ga0501047_0933558 3300049581 Unclassified 681
403 Ga0501070_0572232 3300049586 Bacteria 903
404 nmdc:mga03683_207562_c1 3300050489 Bacteria 900
405 nmdc:mga03n38_904802_c1 3300050490 Bacteria 519
406 nmdc:mga00v17_106679_c1 3300050491 Bacteria 1773
407 nmdc:mga0yw44_237866_c1 3300050492 Bacteria 1210
408 nmdc:mga0k408_159894_c1 3300050493 Bacteria 1342
409 nmdc:mga0k408_238675_c1 3300050493 Bacteria 1085
410 nmdc:mga0k408_370176_c1 3300050493 Bacteria 854
411 nmdc:mga0k408_569392_c1 3300050493 Bacteria 669
412 nmdc:mga0k408_5842_c1 3300050493 Bacteria 6557
413 nmdc:mga06z11_137716_c1 3300050494 Bacteria 1377
414 nmdc:mga06z11_178797_c1 3300050494 Bacteria 1222
415 nmdc:mga07m45_131840_c1 3300050496 Bacteria 1446
416 nmdc:mga07m45_289240_c1 3300050496 Bacteria 953
417 nmdc:mga05p37_451386_c1 3300050507 Bacteria 1488
418 nmdc:mga05p37_548951_c1 3300050507 Bacteria 1316
419 nmdc:mga08y16_24293_c1 3300050511 Bacteria 6398
420 nmdc:mga0n895_281178_c1 3300050512 Unclassified 1687
421 Ga0495601_0026640 3300053077 Bacteria 3571
422 Ga0500610_0002334 3300053079 Bacteria 6944
423 Ga0500610_0008738 3300053079 Bacteria 4433
424 Ga0500610_0016537 3300053079 Bacteria 3519
425 Ga0495619_0047274 3300053085 Bacteria 2833
426 Ga0495619_0129615 3300053085 Unclassified 1733
427 Ga0500651_0000324 3300053093 Bacteria 27187
428 Ga0500566_0218053 3300053094 Bacteria 950
429 Ga0500562_099183 3300053108 Bacteria 793
430 Ga0500569_201087 3300053109 Bacteria 677
431 Ga0500571_000080 3300053110 Bacteria 30359
432 Ga0500592_035520 3300053116 Bacteria 805
433 Ga0500593_000136 3300053117 Bacteria 29187
434 Ga0500594_0018966 3300053118 Bacteria 1700
435 Ga0500608_137064 3300053122 Bacteria 1090
436 Ga0500626_159277 3300053128 Bacteria 929
437 Ga0500655_000634 3300053133 Bacteria 7066
438 Ga0500658_0001352 3300053134 Bacteria 9921
439 Ga0500658_0003716 3300053134 Bacteria 5747
440 Ga0500559_0022004 3300053136 Bacteria 2704
441 Ga0500564_131131 3300053138 Bacteria 1084
442 Ga0500568_0027122 3300053139 Bacteria 2397
443 Ga0500574_069244 3300053141 Bacteria 1032
444 Ga0500616_0068264 3300053153 Bacteria 1821
445 Ga0500620_295991 3300053155 Bacteria 526
446 Ga0500627_0018314 3300053158 Bacteria 2770
447 Ga0500633_0111985 3300053160 Bacteria 1011
448 Ga0500634_0014027 3300053161 Bacteria 4220
449 Ga0500638_024442 3300053162 Bacteria 2880
450 Ga0500596_014234 3300053735 Bacteria 1198
451 Ga0466962_0333984 3300061719 Bacteria 753
452 2739250753 2738543013 Bacteria 5618633
453 2928052916 2928051484 Bacteria 7773759
454 2928064413 2928064002 Bacteria 7419480
455 Ga0307408_100200117
456 JGI25165J46597_1019594
457 rootH1_10040968
458 rootH1_10114567
459 Ga0006562J51391_1020282
460 Ga0006562J51391_1020283
461 Ga0055532_1011416
462 Ga0055535_1000757
463 Ga0055542_1000114
464 Ga0055534_1026857
465 Ga0055540_1034496
466 Ga0065712_10608734
467 Ga0070658_10170885
468 Ga0070670_100570289
469 Ga0070670_100778267
470 Ga0068869_100043415
471 Ga0068869_100191129
472 Ga0070666_10274965
473 Ga0070666_10604756
474 Ga0070666_11435795
475 Ga0070680_100263341
476 Ga0068868_100031405
477 Ga0068868_100075610
478 Ga0068868_101418603
479 Ga0070660_100479004
480 Ga0070689_100020428
481 Ga0070687_100293441
482 Ga0070668_100140085
483 Ga0070668_100983127
484 Ga0070669_100063288
485 Ga0070669_100167563
486 Ga0070675_100021265
487 Ga0070675_100032084
488 Ga0070671_100071446
489 Ga0070671_100364407
490 Ga0070674_101982682
491 Ga0070673_100082855
492 Ga0070673_100282250
493 Ga0070688_100001277
494 Ga0070688_100554196
495 Ga0070667_100223998
496 Ga0070667_100416643
497 Ga0070667_101870217
498 Ga0070701_10729815
499 Ga0070700_100008165
500 Ga0070708_100733386
501 Ga0070663_100121688
502 Ga0070663_100773901
503 Ga0070678_100083155
504 Ga0070678_100187041
505 Ga0068867_100009704
506 Ga0068867_100818333
507 Ga0070685_10002790
508 Ga0070685_10378347
509 Ga0070698_100551365
510 Ga0070684_101860480
511 Ga0068853_100115252
512 Ga0068853_100395223
513 Ga0070672_100004468
514 Ga0070672_100172374
515 Ga0070672_100544021
516 Ga0070696_100563669
517 Ga0070665_100028172
518 Ga0070665_100801829
519 Ga0068855_100078650
520 Ga0068855_100564560
521 Ga0068854_101218017
522 Ga0070702_100148898
523 Ga0068852_100036833
524 Ga0068852_100284658
525 Ga0068852_100689631
526 Ga0068859_100040031
527 Ga0068859_100045434
528 Ga0068859_100070370
529 Ga0068859_100293543
530 Ga0068864_100026952
531 Ga0068866_10222622
532 Ga0068861_100001145
533 Ga0068861_100070264
534 Ga0068851_10124328
535 Ga0068863_101896573
536 Ga0068858_100008531
537 Ga0068858_100024041
538 Ga0068858_100040538
539 Ga0068858_101985571
540 Ga0068860_100003560
541 Ga0068860_100109949
542 Ga0068862_100012131
543 Ga0068862_100021363
544 Ga0068862_100823020
545 Ga0075365_10106370
546 Ga0075368_10060006
547 Ga0075363_100136743
548 Ga0075362_10141059
549 Ga0075362_10175094
550 Ga0075367_10166613
551 Ga0075366_10039085
552 Ga0075366_10087602
553 Ga0075366_10138807
554 Ga0075366_10154511
555 Ga0075366_10190357
556 Ga0097621_100073224
557 Ga0097621_100607433
558 Ga0097621_101118050
559 Ga0075370_10018293
560 Ga0075370_10611033
561 Ga0068871_100061633
562 Ga0075428_100013980
563 Ga0075434_100305314
564 Ga0068865_100098358
565 Ga0068865_100614532
566 Ga0097620_100040032
567 Ga0097620_100045434
568 Ga0097620_100070368
569 Ga0097620_100293529
570 Ga0105244_10195701
571 Ga0105250_10279568
572 Ga0105240_10000377
573 Ga0105240_10095057
574 Ga0105240_11004374
575 Ga0111539_10003384
576 Ga0111539_12227022
577 Ga0105245_10074928
578 Ga0105245_10118826
579 Ga0105245_10281234
580 Ga0105245_10447941
581 Ga0114129_10107425
582 Ga0114129_10615856
583 Ga0105243_10289543
584 Ga0105243_10763160
585 Ga0105241_10290959
586 Ga0105242_10010423
587 Ga0105242_10197931
588 Ga0105242_11559097
589 Ga0105248_10003365
590 Ga0105248_10011910
591 Ga0105248_10019238
592 Ga0105237_10065910
593 Ga0105237_10197164
594 Ga0105238_10006002
595 Ga0105238_10224809
596 Ga0105238_10853472
597 Ga0105238_10994285
598 Ga0105238_11187453
599 Ga0105249_10045333
600 Ga0105239_10206711
601 Ga0105246_10012522
602 Ga0105246_10281638
603 Ga0105246_10352802
604 Ga0105246_10412703
605 Ga0157373_10068079
606 Ga0157371_10172063
607 Ga0157369_10013176
608 Ga0157369_10567688
609 Ga0157374_10117551
610 Ga0157374_10423460
611 Ga0157374_10995261
612 Ga0157378_10025211
613 Ga0163162_10009102
614 Ga0163162_11958997
615 Ga0157372_10567916
616 Ga0157375_10140503
617 Ga0157375_10985111
618 Ga0163163_10064287
619 Ga0163163_12283079
620 Ga0157380_10018756
621 Ga0157380_10731724
622 Ga0157377_10064879
623 Ga0157377_10434855
624 Ga0157379_10132206
625 Ga0157379_10173331
626 Ga0157379_10252795
627 Ga0157376_10024201
628 Ga0157376_10095616
629 Ga0157376_10812216
630 Ga0157376_11280388
631 Ga0182006_1254779
632 Ga0163161_10066955
633 Ga0209672_100157
634 Ga0209147_100797
635 Ga0209258_100225
636 Ga0209148_1000040
637 Ga0209759_1008638
638 Ga0209233_1001616
639 Ga0209130_1000828
640 Ga0209675_1001057
641 Ga0209675_1008734
642 Ga0209025_1027955
643 Ga0209050_1044894
644 Ga0209050_1052228
645 Ga0209051_1001991
646 Ga0209257_1059261
647 Ga0207697_10184798
648 Ga0207656_10662008
649 Ga0207682_10112853
650 Ga0207642_10686623
651 Ga0207688_10050702
652 Ga0207680_10686268
653 Ga0207654_10221470
654 Ga0207695_10000007
655 Ga0207695_10463198
656 Ga0207695_11518847
657 Ga0207671_10270876
658 Ga0207671_10654131
659 Ga0207660_10335380
660 Ga0207681_10049313
661 Ga0207681_10340859
662 Ga0207694_10002131
663 Ga0207694_10403146
664 Ga0207694_10534559
665 Ga0207694_10711535
666 Ga0207650_10271513
667 Ga0207650_10541578
668 Ga0207659_10034136
669 Ga0207687_10027000
670 Ga0207687_10053532
671 Ga0207644_10078805
672 Ga0207690_10087635
673 Ga0207686_10026212
674 Ga0207686_10641217
675 Ga0207709_10018390
676 Ga0207709_10103588
677 Ga0207709_10285929
678 Ga0207709_10762003
679 Ga0207670_10002224
680 Ga0207670_10148956
681 Ga0207704_10019317
682 Ga0207691_10006806
683 Ga0207691_10049790
684 Ga0207691_10178100
685 Ga0207711_10171895
686 Ga0207661_12078708
687 Ga0207667_10051176
688 Ga0207667_10969087
689 Ga0207651_10143989
690 Ga0207712_10170415
691 Ga0207668_11250153
692 Ga0207640_11058081
693 Ga0207640_11219263
694 Ga0207658_10958598
695 Ga0207658_11054824
696 Ga0207677_10090681
697 Ga0207677_10182060
698 Ga0207677_11232951
699 Ga0207703_10016889
700 Ga0207703_10857920
701 Ga0207639_10472247
702 Ga0207678_10092655
703 Ga0207641_10063205
704 Ga0207641_10392412
705 Ga0207641_11484960
706 Ga0207641_12522208
707 Ga0207648_10000556
708 Ga0207648_10385873
709 Ga0207676_10045329
710 Ga0207675_100002028
711 Ga0207683_10036689
712 Ga0207683_10230634
713 Ga0207698_10234067
714 Ga0209970_1011219
715 Ga0209813_10036057
716 Ga0207428_10004349
717 Ga0268266_10101984
718 Ga0268266_10691781
719 Ga0268266_11662067
720 Ga0268265_10099541
721 Ga0268265_10194750
722 Ga0268264_10003478
723 Ga0268264_10111080
724 Ga0307515_10361665
725 Ga0307513_10647017
726 Ga0307408_100006044
727 Ga0307408_100220333
728 Ga0307405_10075105
729 Ga0307405_10343655
730 Ga0307413_10245955
731 Ga0307406_10001342
732 Ga0307406_11035070
733 Ga0307407_11532780
734 Ga0307412_10518522
735 Ga0307416_100160231
736 Ga0307416_100403058
737 Ga0307416_101595786
738 Ga0307416_101671556
739 Ga0307414_10179496
740 Ga0373930_0134625
741 Ga0373958_0173509
742 Ga0373953_0570457
743 Ga0373957_0180127
744 Ga0373943_0161469
745 Ga0373946_0028464
746 Ga0373955_0233090
747 Ga0373942_0100192
748 Ga0373935_0002316
749 Ga0373935_0184035
750 Ga0373935_0373764
751 Ga0373927_0266567
752 Ga0373937_0027902
753 Ga0373937_0109320
754 Ga0373937_0597189
755 Ga0373925_0150880
756 Ga0373925_0405879
757 Ga0373925_0507421
758 Ga0395899_0072164
759 Ga0395900_0035012
760 Ga0395900_0185374
761 Ga0395900_0802380
762 Ga0395900_1655480
763 Ga0395898_0041586
764 Ga0395898_0165317
765 Ga0395905_0002500
766 Ga0395905_0167707
767 Ga0395905_0213931
768 Ga0395901_0002273
769 Ga0395901_0013966
770 Ga0242420_059582
771 Ga0451797_1239823
772 Ga0451807_0646200
773 Ga0451853_1156243
774 Ga0439441_084037
775 Ga0439442_149814
776 Ga0439455_0008233
777 Ga0450921_018799
778 Ga0450891_027330
779 Ga0439446_0235294
780 Ga0466969_0008168
781 Ga0466972_0043987
782 Ga0466965_0016775
783 Ga0466966_0019239
784 Ga0466961_0012032
785 Ga0466961_0096562
786 Ga0466963_0533982
787 Ga0466964_0128718
788 Ga0466968_0023473
789 Ga0466970_0050304
790 Ga0466957_0234887
791 Ga0466960_0221541
792 Ga0466960_0287289
793 Ga0466959_0011234
794 Ga0495627_035249
795 Ga0495629_0096912
796 Ga0495629_0466432
797 Ga0495638_0070353
798 Ga0495585_0018519
799 Ga0495606_0029288
800 Ga0495608_0504779
801 Ga0495610_0062544
802 Ga0495616_0005489
803 Ga0495620_0018364
804 Ga0495620_0085254
805 Ga0495631_0000944
806 Ga0495637_0003665
807 Ga0495654_0087042
808 Ga0495654_0143246
809 Ga0495587_0386830
810 Ga0495621_0174148
811 Ga0495622_0158339
812 Ga0495622_0303275
813 Ga0495668_0085582
814 Ga0495625_0122908
815 Ga0495625_0400510
816 Ga0495635_0077792
817 Ga0495635_0406967
818 Ga0495659_0179496
819 Ga0495661_0067341
820 Ga0495588_0129082
821 Ga0495588_0217174
822 Ga0495646_0431503
823 Ga0495647_0100909
824 Ga0495658_0009696
825 Ga0495658_0030407
826 Ga0495624_0608197
827 Ga0495670_0071714
828 Ga0495670_0122522
829 Ga0495671_0021800
830 Ga0495660_0087852
831 Ga0495660_0330239
832 Ga0495676_0017712
833 Ga0495680_0068691
834 Ga0495684_0029556
835 Ga0495686_0256856
836 Ga0495602_0630085
837 Ga0495614_0110717
838 Ga0495614_0192777
839 Ga0496103_0701272
840 Ga0496104_1787812
841 Ga0496109_0485389
842 Ga0496112_0005094
843 Ga0496114_0891392
844 Ga0496117_0025487
845 Ga0496117_0122363
846 Ga0496118_0066134
847 Ga0496118_0124597
848 Ga0496121_0247716
849 Ga0496121_0596295
850 Ga0496122_0000034
851 Ga0496122_0195173
852 Ga0496123_0070664
853 Ga0496123_0233682
854 Ga0496125_0329139
855 Ga0496126_0534585
856 Ga0501047_0933558
857 Ga0501070_0572232
858 nmdc:mga03683_207562_c1
859 nmdc:mga03n38_904802_c1
860 nmdc:mga00v17_106679_c1
861 nmdc:mga0yw44_237866_c1
862 nmdc:mga0k408_159894_c1
863 nmdc:mga0k408_238675_c1
864 nmdc:mga0k408_370176_c1
865 nmdc:mga0k408_569392_c1
866 nmdc:mga0k408_5842_c1
867 nmdc:mga06z11_137716_c1
868 nmdc:mga06z11_178797_c1
869 nmdc:mga07m45_131840_c1
870 nmdc:mga07m45_289240_c1
871 nmdc:mga05p37_451386_c1
872 nmdc:mga05p37_548951_c1
873 nmdc:mga08y16_24293_c1
874 nmdc:mga0n895_281178_c1
875 Ga0495601_0026640
876 Ga0500610_0002334
877 Ga0500610_0008738
878 Ga0500610_0016537
879 Ga0495619_0047274
880 Ga0495619_0129615
881 Ga0500651_0000324
882 Ga0500566_0218053
883 Ga0500562_099183
884 Ga0500569_201087
885 Ga0500571_000080
886 Ga0500592_035520
887 Ga0500593_000136
888 Ga0500594_0018966
889 Ga0500608_137064
890 Ga0500626_159277
891 Ga0500655_000634
892 Ga0500658_0001352
893 Ga0500658_0003716
894 Ga0500559_0022004
895 Ga0500564_131131
896 Ga0500568_0027122
897 Ga0500574_069244
898 Ga0500616_0068264
899 Ga0500620_295991
900 Ga0500627_0018314
901 Ga0500633_0111985
902 Ga0500634_0014027
903 Ga0500638_024442
904 Ga0500596_014234
905 Ga0466962_0333984
906 2739250753
907 2928052916
908 2928064413

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

7

111

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1oho-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase y16f/d40n mutant complexed with equilenin 0.8671 5 118
2inx-assembly1.cif.gz_A crystal structure of ketosteroid isomerase d40n from pseudomonas putida (pksi) with bound 2,6-difluorophenol 0.8665 5 118
6uad-assembly1.cif.gz_A ketosteroid isomerase (c. testosteroni) with truncated & designed loop for precise positioning of a catalytic e38 0.8641 5 118
1gs3-assembly1.cif.gz_A-2 high resolution crystal structure of pi delta-5-3-ketosteroid isomerase mutants y30f/y55f/y115f/d38n (y32f/y57f/y119f/d40n, pi numbering)complexed with equilenin at 2.1 a resolution 0.862 9 118
3rgr-assembly1.cif.gz_A-2 crystal structure of ketosteroid isomerase m116a from pseudomonas putida 0.8611 5 118
ID Description Score Start End Superfamily
af_Q54WJ8_4_110_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9222 4 113 3.10.450.50
af_Q54WJ8_4_110_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9142 4 113 3.10.450.50
af_Q54FT2_499_621_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.91 5 113 3.10.450.50
af_Q55DR3_11_130_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.904 5 113 3.10.450.50
af_I1LBJ7_116_222_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8473 27 115 3.10.450.50
ID Description Score Start End GO Terms
AF-J3DDU0-F1-model_v4 SnoaL-like domain-containing protein 1.002 1 123
AF-A0A7V8G2H9-F1-model_v4 Nuclear transport factor 2 family protein 1.002 1 124
AF-A0A0Q6XPH0-F1-model_v4 Polyketide cyclase 0.997 1 122
AF-A0A7W5TYJ9-F1-model_v4 deleted 0.9943 1 97
AF-A0A7V8G2H9-F1-model_v4 Nuclear transport factor 2 family protein 0.9937 1 124

Map