F447411

General Info

Members Datasets Scaffolds Average Seq Length
454 245 453 142

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10284007|Ga0307516_102840072
Length 164
Sequence MAISKILAKIAPGRLTFGLLRQTMRRIRPDVDIIMDVLKAVTAAQPHSSFAQSLLQQYQERGGLSKKQLEGLYGKAQKVGSIPENKLATLQAIILRKPAKHRSELPASTPLYSKDEDTGKMIIAILDKYPQHKQVLFLRSKYDNNELLSPAEKTELLRLSKLLK

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 2738541278 Niastella sp. CF465 Isolate Unclassified
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
138 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
141 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
142 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
143 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
144 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
152 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
153 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
159 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
160 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
161 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
165 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
166 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
180 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
181 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
182 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
193 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
194 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
195 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
200 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
201 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
202 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
203 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
204 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
205 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
206 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
207 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
208 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
209 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
210 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
211 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
212 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
213 3300049684 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_B_3_control Metagenome Rhizosphere
214 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
215 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
216 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
217 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
218 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
219 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
220 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
221 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
222 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
226 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
227 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
228 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
229 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
237 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
238 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
239 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
240 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
241 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
244 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
245 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.2
Nodule 0
Rhizoplane 0.66
Rhizosphere 94.71
Stem 0
Stem Tuber 0
Unclassified 2.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_13901972 2162886012 Bacteria 873
2 JGI24751J29686_10000484 3300002459 Bacteria 11810
3 JGI24751J29686_10063138 3300002459 Bacteria 763
4 rootH2_10076134 3300003320 Unclassified 1485
5 Ga0065704_10301526 3300005289 Bacteria 884
6 Ga0065712_10069343 3300005290 Bacteria 7454
7 Ga0065715_10778183 3300005293 Bacteria 619
8 Ga0065707_10015426 3300005295 Bacteria 1905
9 Ga0070676_10012802 3300005328 Bacteria 4590
10 Ga0070676_10046866 3300005328 Bacteria 2522
11 Ga0070683_100002588 3300005329 Bacteria 14466
12 Ga0070683_100014509 3300005329 Bacteria 6894
13 Ga0070683_100348091 3300005329 Bacteria 1411
14 Ga0070683_100582005 3300005329 Bacteria 1071
15 Ga0070690_101548870 3300005330 Unclassified 536
16 Ga0070670_100006286 3300005331 Bacteria 10058
17 Ga0070670_100096401 3300005331 Bacteria 2545
18 Ga0070670_100106570 3300005331 Bacteria 2415
19 Ga0070670_100479003 3300005331 Bacteria 1105
20 Ga0068869_100016597 3300005334 Bacteria 4966
21 Ga0068869_100341030 3300005334 Unclassified 1219
22 Ga0068869_100346481 3300005334 Bacteria 1210
23 Ga0070666_10007747 3300005335 Bacteria 6632
24 Ga0070666_10363607 3300005335 Bacteria 1037
25 Ga0070682_100085424 3300005337 Bacteria 2053
26 Ga0070682_100356426 3300005337 Bacteria 1092
27 Ga0070682_100391650 3300005337 Bacteria 1048
28 Ga0068868_100057860 3300005338 Unclassified 3063
29 Ga0068868_100058544 3300005338 Bacteria 3045
30 Ga0068868_100251976 3300005338 Bacteria 1486
31 Ga0070660_100127032 3300005339 Bacteria 2038
32 Ga0070660_101185101 3300005339 Bacteria 647
33 Ga0070689_100021596 3300005340 Bacteria 4795
34 Ga0070689_100076713 3300005340 Bacteria 2618
35 Ga0070689_100107693 3300005340 Bacteria 2213
36 Ga0070689_100199806 3300005340 Bacteria 1632
37 Ga0070689_100260426 3300005340 Bacteria 1433
38 Ga0070661_100014433 3300005344 Bacteria 5567
39 Ga0070661_100238114 3300005344 Bacteria 1400
40 Ga0070661_100268658 3300005344 Bacteria 1320
41 Ga0070668_100138981 3300005347 Bacteria 1956
42 Ga0070669_100065502 3300005353 Bacteria 2677
43 Ga0070669_100161721 3300005353 Bacteria 1740
44 Ga0070669_100267315 3300005353 Bacteria 1366
45 Ga0070675_100011641 3300005354 Bacteria 6892
46 Ga0070675_100020442 3300005354 Bacteria 5283
47 Ga0070675_100167158 3300005354 Bacteria 1895
48 Ga0070671_100297730 3300005355 Bacteria 1373
49 Ga0070671_100543237 3300005355 Bacteria 1002
50 Ga0070673_100008798 3300005364 Bacteria 6740
51 Ga0070688_100004087 3300005365 Bacteria 7570
52 Ga0070688_100025512 3300005365 Unclassified 3500
53 Ga0070688_100156386 3300005365 Bacteria 1562
54 Ga0070659_100494786 3300005366 Bacteria 1042
55 Ga0070667_100051637 3300005367 Bacteria 3467
56 Ga0070667_100102754 3300005367 Bacteria 2470
57 Ga0070667_100904378 3300005367 Bacteria 822
58 Ga0070701_10226712 3300005438 Bacteria 1117
59 Ga0070701_10478437 3300005438 Bacteria 804
60 Ga0070701_10891506 3300005438 Bacteria 613
61 Ga0070663_100430640 3300005455 Bacteria 1084
62 Ga0070663_101653329 3300005455 Bacteria 572
63 Ga0070678_100253800 3300005456 Bacteria 1476
64 Ga0070662_100013753 3300005457 Bacteria 5390
65 Ga0070662_100118952 3300005457 Bacteria 2023
66 Ga0070662_100284231 3300005457 Bacteria 1339
67 Ga0070662_101042454 3300005457 Bacteria 701
68 Ga0068867_100023843 3300005459 Bacteria 4384
69 Ga0068867_100177774 3300005459 Bacteria 1690
70 Ga0068867_100652143 3300005459 Bacteria 924
71 Ga0068867_101066673 3300005459 Bacteria 736
72 Ga0070685_10414353 3300005466 Bacteria 936
73 Ga0070699_101088038 3300005518 Bacteria 733
74 Ga0070684_100001733 3300005535 Bacteria 15863
75 Ga0070684_100002052 3300005535 Bacteria 14826
76 Ga0068853_100055211 3300005539 Bacteria 3424
77 Ga0068853_101231115 3300005539 Bacteria 723
78 Ga0068853_101248948 3300005539 Bacteria 718
79 Ga0070672_100028856 3300005543 Bacteria 4155
80 Ga0070672_100231665 3300005543 Bacteria 1552
81 Ga0070686_100148714 3300005544 Bacteria 1638
82 Ga0070693_100201809 3300005547 Bacteria 1292
83 Ga0070693_100780754 3300005547 Unclassified 706
84 Ga0070665_100370060 3300005548 Bacteria 1440
85 Ga0070664_100002676 3300005564 Bacteria 14376
86 Ga0070664_100006231 3300005564 Bacteria 9633
87 Ga0070664_100072881 3300005564 Bacteria 2946
88 Ga0070664_100195162 3300005564 Bacteria 1805
89 Ga0068857_100002332 3300005577 Bacteria 15434
90 Ga0068857_100012576 3300005577 Bacteria 7373
91 Ga0068857_100066912 3300005577 Bacteria 3197
92 Ga0068857_100500548 3300005577 Bacteria 1140
93 Ga0068857_100967590 3300005577 Bacteria 818
94 Ga0068857_101867904 3300005577 Bacteria 588
95 Ga0068854_100006604 3300005578 Bacteria 7387
96 Ga0068854_100016906 3300005578 Bacteria 4872
97 Ga0068854_100024858 3300005578 Bacteria 4106
98 Ga0068852_100008627 3300005616 Bacteria 7528
99 Ga0068852_100650975 3300005616 Bacteria 1061
100 Ga0068852_100950740 3300005616 Bacteria 877
101 Ga0068859_100002370 3300005617 Bacteria 19175
102 Ga0068859_100112601 3300005617 Bacteria 2784
103 Ga0068859_100149143 3300005617 Bacteria 2414
104 Ga0068859_100188523 3300005617 Bacteria 2146
105 Ga0068859_100565640 3300005617 Bacteria 1231
106 Ga0068859_100940942 3300005617 Bacteria 948
107 Ga0068859_101243509 3300005617 Bacteria 820
108 Ga0068864_100011830 3300005618 Bacteria 7206
109 Ga0068864_100012331 3300005618 Bacteria 7064
110 Ga0068866_10186809 3300005718 Bacteria 1228
111 Ga0068861_100012016 3300005719 Bacteria 6031
112 Ga0068861_100135863 3300005719 Bacteria 2001
113 Ga0068861_100738804 3300005719 Unclassified 918
114 Ga0068861_102501042 3300005719 Bacteria 520
115 Ga0068851_10268381 3300005834 Bacteria 972
116 Ga0068870_10016913 3300005840 Bacteria 3497
117 Ga0068863_100351408 3300005841 Bacteria 1436
118 Ga0068863_100585324 3300005841 Bacteria 1104
119 Ga0068863_100626530 3300005841 Bacteria 1066
120 Ga0068858_100154955 3300005842 Bacteria 2155
121 Ga0068858_100267911 3300005842 Bacteria 1625
122 Ga0068860_100072398 3300005843 Bacteria 3275
123 Ga0068860_100251957 3300005843 Bacteria 1720
124 Ga0068860_100341485 3300005843 Bacteria 1472
125 Ga0068860_100523337 3300005843 Bacteria 1186
126 Ga0068860_101128713 3300005843 Bacteria 803
127 Ga0068862_100003351 3300005844 Bacteria 13826
128 Ga0068862_100470836 3300005844 Bacteria 1188
129 Ga0068862_100701647 3300005844 Bacteria 980
130 Ga0081539_10124090 3300005985 Bacteria 1278
131 Ga0070715_10473538 3300006163 Bacteria 712
132 Ga0075366_10136724 3300006195 Unclassified 1480
133 Ga0075366_10221438 3300006195 Unclassified 1153
134 Ga0097621_100031895 3300006237 Bacteria 4183
135 Ga0097621_100102299 3300006237 Bacteria 2412
136 Ga0097621_100198437 3300006237 Bacteria 1741
137 Ga0097621_100336122 3300006237 Unclassified 1340
138 Ga0068871_101616315 3300006358 Bacteria 614
139 Ga0075428_102094740 3300006844 Bacteria 585
140 Ga0068865_100099482 3300006881 Bacteria 2126
141 Ga0068865_100176511 3300006881 Bacteria 1642
142 Ga0097620_100002371 3300006931 Bacteria 19175
143 Ga0097620_100112600 3300006931 Bacteria 2784
144 Ga0097620_100149136 3300006931 Bacteria 2414
145 Ga0097620_100188527 3300006931 Bacteria 2146
146 Ga0097620_100565692 3300006931 Bacteria 1231
147 Ga0097620_100941010 3300006931 Bacteria 948
148 Ga0097620_101243750 3300006931 Bacteria 820
149 Ga0105240_10185906 3300009093 Bacteria 2447
150 Ga0111539_10002870 3300009094 Bacteria 22880
151 Ga0105247_10008586 3300009101 Bacteria 6226
152 Ga0114129_10018074 3300009147 Bacteria 10043
153 Ga0105241_10086145 3300009174 Bacteria 2470
154 Ga0105241_10482636 3300009174 Bacteria 1102
155 Ga0105242_10810252 3300009176 Bacteria 928
156 Ga0105242_11393120 3300009176 Bacteria 728
157 Ga0105248_10232304 3300009177 Bacteria 2076
158 Ga0105237_11905651 3300009545 Bacteria 602
159 Ga0105249_10000651 3300009553 Bacteria 31572
160 Ga0105249_10000820 3300009553 Bacteria 28000
161 Ga0105249_10045758 3300009553 Bacteria 3981
162 Ga0105249_10163498 3300009553 Bacteria 2153
163 Ga0105249_10336248 3300009553 Bacteria 1525
164 Ga0105249_10448695 3300009553 Unclassified 1328
165 Ga0105249_13004009 3300009553 Bacteria 542
166 Ga0105239_10082142 3300010375 Bacteria 3548
167 Ga0105239_10417882 3300010375 Bacteria 1519
168 Ga0105239_13139593 3300010375 Bacteria 538
169 Ga0105246_10157373 3300011119 Bacteria 1727
170 Ga0157371_10232852 3300013102 Bacteria 1324
171 Ga0157371_10278650 3300013102 Bacteria 1208
172 Ga0157371_10428485 3300013102 Bacteria 970
173 Ga0157370_10332339 3300013104 Bacteria 1401
174 Ga0157369_10824511 3300013105 Bacteria 953
175 Ga0157374_10000915 3300013296 Bacteria 25668
176 Ga0157374_10009923 3300013296 Bacteria 8175
177 Ga0157378_10592504 3300013297 Bacteria 1119
178 Ga0157378_10803828 3300013297 Bacteria 966
179 Ga0163162_10016056 3300013306 Bacteria 7317
180 Ga0163162_10057690 3300013306 Bacteria 3911
181 Ga0163162_10225898 3300013306 Bacteria 2002
182 Ga0163162_10311989 3300013306 Bacteria 1705
183 Ga0157372_10076444 3300013307 Unclassified 3780
184 Ga0157372_10443485 3300013307 Bacteria 1513
185 Ga0157372_10454231 3300013307 Bacteria 1493
186 Ga0157372_10461118 3300013307 Bacteria 1481
187 Ga0157375_10020800 3300013308 Bacteria 6005
188 Ga0157375_10120986 3300013308 Bacteria 2727
189 Ga0157375_10190419 3300013308 Bacteria 2206
190 Ga0157375_10297049 3300013308 Bacteria 1779
191 Ga0163163_10017886 3300014325 Bacteria 6620
192 Ga0163163_10240409 3300014325 Bacteria 1860
193 Ga0163163_10266206 3300014325 Bacteria 1765
194 Ga0157380_10001482 3300014326 Bacteria 15353
195 Ga0157380_10443765 3300014326 Bacteria 1244
196 Ga0157377_10000309 3300014745 Bacteria 22464
197 Ga0157377_10007399 3300014745 Bacteria 5299
198 Ga0157377_10198516 3300014745 Bacteria 1272
199 Ga0157379_10230288 3300014968 Bacteria 1679
200 Ga0157379_10284096 3300014968 Bacteria 1506
201 Ga0157379_11001118 3300014968 Bacteria 797
202 Ga0157376_10015051 3300014969 Bacteria 5830
203 Ga0157376_10433578 3300014969 Bacteria 1278
204 Ga0157376_10881502 3300014969 Bacteria 912
205 Ga0163161_10028048 3300017792 Bacteria 3996
206 Ga0163161_10133124 3300017792 Bacteria 1877
207 Ga0163161_10407134 3300017792 Bacteria 1092
208 Ga0163161_10428200 3300017792 Bacteria 1066
209 Ga0207697_10037600 3300025315 Bacteria 1983
210 Ga0207642_10184515 3300025899 Bacteria 1139
211 Ga0207642_10265650 3300025899 Bacteria 980
212 Ga0207710_10018240 3300025900 Bacteria 2983
213 Ga0207688_10965813 3300025901 Bacteria 539
214 Ga0207680_10036745 3300025903 Bacteria 2822
215 Ga0207680_10072660 3300025903 Bacteria 2136
216 Ga0207647_10035668 3300025904 Bacteria 3168
217 Ga0207685_10021423 3300025905 Bacteria 2166
218 Ga0207645_10019931 3300025907 Bacteria 4390
219 Ga0207645_10028008 3300025907 Bacteria 3637
220 Ga0207643_10039563 3300025908 Bacteria 2652
221 Ga0207654_10943453 3300025911 Unclassified 626
222 Ga0207654_11229272 3300025911 Unclassified 546
223 Ga0207695_10659153 3300025913 Bacteria 927
224 Ga0207662_10142303 3300025918 Unclassified 1520
225 Ga0207657_10150649 3300025919 Bacteria 1895
226 Ga0207657_10262259 3300025919 Bacteria 1375
227 Ga0207649_10038880 3300025920 Bacteria 2883
228 Ga0207649_10301407 3300025920 Bacteria 1172
229 Ga0207681_10001299 3300025923 Bacteria 16119
230 Ga0207650_10811453 3300025925 Bacteria 793
231 Ga0207650_11220781 3300025925 Bacteria 640
232 Ga0207659_10014170 3300025926 Bacteria 5133
233 Ga0207659_10144760 3300025926 Bacteria 1849
234 Ga0207659_10207819 3300025926 Bacteria 1567
235 Ga0207659_10251387 3300025926 Bacteria 1434
236 Ga0207644_10260326 3300025931 Bacteria 1387
237 Ga0207644_10538050 3300025931 Bacteria 966
238 Ga0207690_10094453 3300025932 Bacteria 2122
239 Ga0207690_10156498 3300025932 Bacteria 1694
240 Ga0207706_10004466 3300025933 Bacteria 13138
241 Ga0207706_10007238 3300025933 Bacteria 10259
242 Ga0207706_10150715 3300025933 Bacteria 2045
243 Ga0207706_10481530 3300025933 Bacteria 1072
244 Ga0207670_10017164 3300025936 Bacteria 4370
245 Ga0207670_10054391 3300025936 Bacteria 2701
246 Ga0207670_10098814 3300025936 Bacteria 2081
247 Ga0207670_10212263 3300025936 Bacteria 1477
248 Ga0207670_10819317 3300025936 Bacteria 776
249 Ga0207704_10035612 3300025938 Bacteria 2854
250 Ga0207691_10045355 3300025940 Bacteria 4041
251 Ga0207691_10155917 3300025940 Bacteria 2005
252 Ga0207689_10004472 3300025942 Bacteria 12677
253 Ga0207689_10007606 3300025942 Bacteria 9491
254 Ga0207689_10024133 3300025942 Bacteria 5102
255 Ga0207689_10032300 3300025942 Bacteria 4355
256 Ga0207661_10018316 3300025944 Bacteria 5203
257 Ga0207661_10072862 3300025944 Bacteria 2811
258 Ga0207661_10250541 3300025944 Bacteria 1574
259 Ga0207679_10003552 3300025945 Bacteria 9658
260 Ga0207679_10024793 3300025945 Bacteria 4115
261 Ga0207679_10252705 3300025945 Bacteria 1499
262 Ga0207679_10383226 3300025945 Bacteria 1233
263 Ga0207651_10019675 3300025960 Bacteria 4053
264 Ga0207651_10023306 3300025960 Bacteria 3805
265 Ga0207651_10043099 3300025960 Bacteria 3009
266 Ga0207712_10003291 3300025961 Bacteria 10245
267 Ga0207712_10003360 3300025961 Bacteria 10123
268 Ga0207712_10017369 3300025961 Bacteria 4671
269 Ga0207712_10217201 3300025961 Bacteria 1526
270 Ga0207712_10409826 3300025961 Unclassified 1141
271 Ga0207668_10061463 3300025972 Bacteria 2642
272 Ga0207668_11263794 3300025972 Bacteria 664
273 Ga0207640_10049385 3300025981 Bacteria 2724
274 Ga0207640_10281972 3300025981 Bacteria 1305
275 Ga0207640_10465479 3300025981 Bacteria 1045
276 Ga0207658_10166299 3300025986 Bacteria 1812
277 Ga0207658_10184274 3300025986 Bacteria 1730
278 Ga0207658_10343901 3300025986 Bacteria 1297
279 Ga0207658_10991551 3300025986 Bacteria 766
280 Ga0207677_10046980 3300026023 Unclassified 2895
281 Ga0207677_10153645 3300026023 Bacteria 1779
282 Ga0207703_10231865 3300026035 Bacteria 1655
283 Ga0207703_10665284 3300026035 Bacteria 989
284 Ga0207639_10332605 3300026041 Bacteria 1352
285 Ga0207639_11040890 3300026041 Unclassified 767
286 Ga0207678_10166835 3300026067 Bacteria 1880
287 Ga0207678_10787636 3300026067 Unclassified 839
288 Ga0207708_10521696 3300026075 Bacteria 998
289 Ga0207641_10018617 3300026088 Bacteria 5694
290 Ga0207641_10149159 3300026088 Bacteria 2117
291 Ga0207641_10287819 3300026088 Bacteria 1548
292 Ga0207641_11526755 3300026088 Bacteria 670
293 Ga0207641_12102649 3300026088 Bacteria 565
294 Ga0207648_10016877 3300026089 Bacteria 6657
295 Ga0207648_10026913 3300026089 Bacteria 5108
296 Ga0207648_10054596 3300026089 Unclassified 3489
297 Ga0207648_10234010 3300026089 Bacteria 1635
298 Ga0207648_11421044 3300026089 Unclassified 652
299 Ga0207676_10006423 3300026095 Bacteria 8306
300 Ga0207676_10113785 3300026095 Bacteria 2269
301 Ga0207674_10001527 3300026116 Bacteria 29820
302 Ga0207674_10003496 3300026116 Bacteria 19183
303 Ga0207674_10004662 3300026116 Bacteria 16459
304 Ga0207674_10058649 3300026116 Bacteria 3899
305 Ga0207674_10303876 3300026116 Bacteria 1545
306 Ga0207674_10557755 3300026116 Bacteria 1107
307 Ga0207674_11455018 3300026116 Bacteria 654
308 Ga0207675_100000609 3300026118 Bacteria 34912
309 Ga0207675_100022091 3300026118 Bacteria 5924
310 Ga0207675_100195576 3300026118 Bacteria 1941
311 Ga0207675_100424813 3300026118 Bacteria 1313
312 Ga0207675_100574803 3300026118 Unclassified 1128
313 Ga0207683_10032310 3300026121 Bacteria 4547
314 Ga0207698_10047776 3300026142 Bacteria 3245
315 Ga0207698_12019250 3300026142 Bacteria 591
316 Ga0268265_10125182 3300028380 Bacteria 2125
317 Ga0268265_10260313 3300028380 Bacteria 1542
318 Ga0268264_10293459 3300028381 Bacteria 1528
319 Ga0268264_10843114 3300028381 Bacteria 918
320 Ga0307515_10798996 3300028794 Unclassified 566
321 Ga0307513_10131388 3300031456 Bacteria 2449
322 Ga0307513_10228709 3300031456 Bacteria 1674
323 Ga0307509_10223316 3300031507 Bacteria 1694
324 Ga0307509_10292315 3300031507 Bacteria 1383
325 Ga0307516_10284007 3300031730 Bacteria 1336
326 Ga0307406_10129572 3300031901 Bacteria 1769
327 Ga0307406_11750792 3300031901 Bacteria 552
328 Ga0307414_10100792 3300032004 Bacteria 2173
329 Ga0307414_10137233 3300032004 Bacteria 1909
330 Ga0307414_12056192 3300032004 Unclassified 533
331 Ga0307415_100326371 3300032126 Bacteria 1282
332 Ga0307415_100710878 3300032126 Bacteria 908
333 Ga0373934_0116720 3300035086 Bacteria 1085
334 Ga0373923_0179390 3300035111 Bacteria 973
335 Ga0373941_0488283 3300035115 Bacteria 522
336 Ga0373953_0323157 3300035117 Bacteria 675
337 Ga0373954_0163713 3300035118 Bacteria 1089
338 Ga0373956_0332334 3300035119 Bacteria 724
339 Ga0373943_0385143 3300035170 Bacteria 808
340 Ga0373946_0435424 3300035171 Bacteria 666
341 Ga0373924_0112667 3300035410 Bacteria 1177
342 Ga0373931_0718554 3300035691 Bacteria 661
343 Ga0373935_0821245 3300035692 Bacteria 687
344 Ga0373933_0028788 3300035724 Bacteria 3207
345 Ga0373947_0242300 3300035725 Unclassified 1190
346 Ga0373947_0400379 3300035725 Unclassified 926
347 Ga0373925_0237169 3300037068 Bacteria 1460
348 Ga0373925_0330494 3300037068 Bacteria 1235
349 Ga0373925_1166192 3300037068 Unclassified 633
350 Ga0395899_0890047 3300037312 Bacteria 544
351 Ga0395900_0044904 3300037418 Bacteria 4551
352 Ga0395905_0005396 3300037471 Bacteria 13065
353 Ga0436365_0522919 3300039437 Bacteria 1842
354 Ga0439439_0234899 3300041406 Bacteria 540
355 Ga0451807_1962992 3300041486 Bacteria 722
356 Ga0451853_2186023 3300041512 Bacteria 754
357 Ga0451853_3223251 3300041512 Bacteria 1345
358 Ga0466957_0011267 3300044842 Bacteria 5151
359 Ga0466957_0654909 3300044842 Bacteria 739
360 Ga0451576_1897054 3300045051 Bacteria 615
361 Ga0495592_0293917 3300046454 Bacteria 1058
362 Ga0495608_0647250 3300046511 Bacteria 632
363 Ga0495628_0176441 3300046516 Bacteria 1618
364 Ga0495640_0500185 3300046533 Bacteria 740
365 Ga0495586_0133659 3300046535 Bacteria 1390
366 Ga0495634_0277690 3300046642 Bacteria 1018
367 Ga0495657_0363448 3300046675 Bacteria 855
368 Ga0495599_0331197 3300046678 Bacteria 915
369 Ga0495646_0391023 3300046680 Bacteria 724
370 Ga0495624_0527390 3300046690 Bacteria 706
371 Ga0495600_0413235 3300046809 Bacteria 838
372 Ga0495604_0358374 3300047317 Bacteria 968
373 Ga0495684_0144054 3300047471 Bacteria 1785
374 Ga0495686_0138280 3300047472 Bacteria 1439
375 Ga0496110_0011801 3300048913 Bacteria 7172
376 Ga0496114_0073695 3300048917 Bacteria 2874
377 Ga0501290_060558 3300049513 Unclassified 609
378 Ga0501297_001732 3300049520 Bacteria 2041
379 Ga0501298_000129 3300049521 Bacteria 9056
380 Ga0501300_006914 3300049523 Bacteria 1664
381 Ga0501032_0013058 3300049569 Bacteria 5914
382 Ga0501034_0008720 3300049571 Bacteria 10675
383 Ga0501034_0014195 3300049571 Bacteria 8210
384 Ga0501034_0130791 3300049571 Bacteria 2493
385 Ga0501036_0640956 3300049572 Bacteria 880
386 Ga0501038_0042009 3300049574 Bacteria 3984
387 Ga0501043_0013717 3300049579 Bacteria 6339
388 Ga0501046_0004460 3300049580 Bacteria 12696
389 Ga0501047_0027226 3300049581 Bacteria 5506
390 Ga0501047_0592730 3300049581 Unclassified 930
391 Ga0501048_0020793 3300049582 Bacteria 4809
392 Ga0501067_0068415 3300049583 Bacteria 1966
393 Ga0501069_0860414 3300049585 Unclassified 551
394 Ga0501070_0016632 3300049586 Bacteria 6179
395 Ga0501071_1016886 3300049587 Unclassified 640
396 Ga0501072_0193032 3300049588 Bacteria 1624
397 Ga0501073_0021509 3300049589 Bacteria 4650
398 Ga0501074_0011049 3300049590 Bacteria 6554
399 Ga0501077_0335442 3300049593 Unclassified 964
400 Ga0501198_000488 3300049649 Bacteria 4928
401 Ga0501198_053498 3300049649 Bacteria 724
402 Ga0501201_000366 3300049651 Bacteria 4153
403 Ga0501202_000240 3300049652 Bacteria 7271
404 Ga0501206_000629 3300049653 Bacteria 4240
405 Ga0501207_043822 3300049654 Bacteria 784
406 Ga0501216_026224 3300049660 Bacteria 1051
407 Ga0501223_012387 3300049663 Bacteria 1705
408 Ga0501224_005992 3300049664 Bacteria 1756
409 Ga0501233_010247 3300049668 Bacteria 1843
410 Ga0501235_000837 3300049669 Bacteria 6317
411 Ga0501235_045334 3300049669 Bacteria 1011
412 Ga0501243_000627 3300049675 Bacteria 4791
413 Ga0501243_012537 3300049675 Bacteria 1339
414 Ga0501251_001476 3300049681 Bacteria 2198
415 Ga0501252_028561 3300049682 Bacteria 764
416 Ga0501253_016970 3300049683 Bacteria 1220
417 Ga0501255_045903 3300049684 Bacteria 655
418 Ga0501256_019138 3300049685 Bacteria 708
419 Ga0501257_009944 3300049686 Bacteria 2153
420 Ga0501259_007279 3300049688 Bacteria 1770
421 Ga0501260_020877 3300049689 Bacteria 710
422 Ga0501261_001135 3300049690 Bacteria 3266
423 Ga0501221_000502 3300049704 Bacteria 6172
424 Ga0501225_0007046 3300049705 Bacteria 3271
425 Ga0501229_066802 3300049706 Unclassified 557
426 Ga0501245_000683 3300049708 Bacteria 4192
427 Ga0501079_0169264 3300049741 Bacteria 1704
428 Ga0501080_0108595 3300049742 Bacteria 2571
429 Ga0501083_0019298 3300049744 Bacteria 4749
430 Ga0501264_006089 3300049761 Bacteria 1108
431 Ga0501268_020077 3300049765 Bacteria 1135
432 Ga0501268_022834 3300049765 Bacteria 1083
433 Ga0501270_029624 3300049767 Bacteria 894
434 Ga0501271_005148 3300049768 Bacteria 1264
435 Ga0501035_0035219 3300049822 Bacteria 4544
436 Ga0501035_0359186 3300049822 Unclassified 1218
437 Ga0501044_0014176 3300049823 Bacteria 8608
438 Ga0501044_0544098 3300049823 Bacteria 1059
439 Ga0501212_019679 3300049851 Bacteria 1035
440 Ga0501212_024767 3300049851 Bacteria 946
441 nmdc:mga05p37_3226_c1 3300050507 Bacteria 19004
442 nmdc:mga08y16_240899_c1 3300050511 Bacteria 1870
443 Ga0495619_0639301 3300053085 Bacteria 726
444 Ga0500646_0043400 3300053090 Unclassified 1273
445 Ga0500583_0000019 3300053092 Bacteria 130534
446 Ga0500641_0103157 3300053096 Bacteria 1224
447 Ga0500655_015156 3300053133 Bacteria 1413
448 Ga0500589_047424 3300053147 Bacteria 2000
449 Ga0500604_0014010 3300053151 Unclassified 2179
450 Ga0500616_0003871 3300053153 Bacteria 11027
451 Ga0500611_000006 3300053727 Bacteria 226069
452 Ga0501084_0593626 3300054114 Unclassified 936
453 Ga0501082_0042021 3300060353 Bacteria 3942

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10557755 Ga0207674_105577553 124
2 3300031901 Ga0307406_11750792 Ga0307406_117507921 136
3 3300025918 Ga0207662_10142303 Ga0207662_101423033 137
4 3300026118 Ga0207675_100022091 Ga0207675_1000220917 137
5 iso_pu_bacteria 2738541278 2738725069 137
6 3300005328 Ga0070676_10046866 Ga0070676_100468662 140
7 3300005367 Ga0070667_100102754 Ga0070667_1001027543 140
8 3300005985 Ga0081539_10124090 Ga0081539_101240903 140
9 3300006237 Ga0097621_100102299 Ga0097621_1001022992 140
10 3300025986 Ga0207658_10166299 Ga0207658_101662991 140
11 3300049649 Ga0501198_053498 Ga0501198_053498_234_656 140
12 3300053153 Ga0500616_0003871 Ga0500616_0003871_7195_7617 140
13 3300053727 Ga0500611_000006 Ga0500611_000006_9248_9700 140
14 3300003320 rootH2_10076134 rootH2_100761342 141
15 3300005329 Ga0070683_100002588 Ga0070683_1000025883 141
16 3300005329 Ga0070683_100014509 Ga0070683_1000145096 141
17 3300005329 Ga0070683_100348091 Ga0070683_1003480913 141
18 3300005329 Ga0070683_100582005 Ga0070683_1005820052 141
19 3300005330 Ga0070690_101548870 Ga0070690_1015488701 141
20 3300005334 Ga0068869_100016597 Ga0068869_1000165975 141
21 3300005335 Ga0070666_10007747 Ga0070666_100077477 141
22 3300005335 Ga0070666_10363607 Ga0070666_103636072 141
23 3300005337 Ga0070682_100085424 Ga0070682_1000854243 141
24 3300005337 Ga0070682_100356426 Ga0070682_1003564262 141
25 3300005337 Ga0070682_100391650 Ga0070682_1003916501 141
26 3300005338 Ga0068868_100057860 Ga0068868_1000578604 141
27 3300005338 Ga0068868_100058544 Ga0068868_1000585444 141
28 3300005339 Ga0070660_100127032 Ga0070660_1001270323 141
29 3300005339 Ga0070660_101185101 Ga0070660_1011851012 141
30 3300005340 Ga0070689_100021596 Ga0070689_1000215964 141
31 3300005340 Ga0070689_100107693 Ga0070689_1001076934 141
32 3300005340 Ga0070689_100199806 Ga0070689_1001998062 141
33 3300005344 Ga0070661_100014433 Ga0070661_1000144337 141
34 3300005344 Ga0070661_100238114 Ga0070661_1002381142 141
35 3300005344 Ga0070661_100268658 Ga0070661_1002686582 141
36 3300005353 Ga0070669_100161721 Ga0070669_1001617212 141
37 3300005353 Ga0070669_100267315 Ga0070669_1002673152 141
38 3300005354 Ga0070675_100011641 Ga0070675_1000116417 141
39 3300005354 Ga0070675_100167158 Ga0070675_1001671581 141
40 3300005355 Ga0070671_100297730 Ga0070671_1002977302 141
41 3300005355 Ga0070671_100543237 Ga0070671_1005432372 141
42 3300005365 Ga0070688_100025512 Ga0070688_1000255123 141
43 3300005365 Ga0070688_100156386 Ga0070688_1001563862 141
44 3300005366 Ga0070659_100494786 Ga0070659_1004947862 141
45 3300005367 Ga0070667_100051637 Ga0070667_1000516373 141
46 3300005367 Ga0070667_100904378 Ga0070667_1009043782 141
47 3300005438 Ga0070701_10478437 Ga0070701_104784372 141
48 3300005438 Ga0070701_10891506 Ga0070701_108915061 141
49 3300005455 Ga0070663_100430640 Ga0070663_1004306402 141
50 3300005455 Ga0070663_101653329 Ga0070663_1016533291 141
51 3300005456 Ga0070678_100253800 Ga0070678_1002538003 141
52 3300005457 Ga0070662_100118952 Ga0070662_1001189523 141
53 3300005457 Ga0070662_100284231 Ga0070662_1002842313 141
54 3300005457 Ga0070662_101042454 Ga0070662_1010424542 141
55 3300005459 Ga0068867_100023843 Ga0068867_1000238432 141
56 3300005459 Ga0068867_101066673 Ga0068867_1010666731 141
57 3300005466 Ga0070685_10414353 Ga0070685_104143532 141
58 3300005518 Ga0070699_101088038 Ga0070699_1010880381 141
59 3300005535 Ga0070684_100001733 Ga0070684_1000017333 141
60 3300005535 Ga0070684_100002052 Ga0070684_10000205212 141
61 3300005539 Ga0068853_100055211 Ga0068853_1000552113 141
62 3300005539 Ga0068853_101231115 Ga0068853_1012311152 141
63 3300005543 Ga0070672_100231665 Ga0070672_1002316652 141
64 3300005544 Ga0070686_100148714 Ga0070686_1001487142 141
65 3300005547 Ga0070693_100201809 Ga0070693_1002018091 141
66 3300005547 Ga0070693_100780754 Ga0070693_1007807541 141
67 3300005548 Ga0070665_100370060 Ga0070665_1003700603 141
68 3300005564 Ga0070664_100002676 Ga0070664_1000026763 141
69 3300005564 Ga0070664_100006231 Ga0070664_1000062315 141
70 3300005564 Ga0070664_100072881 Ga0070664_1000728814 141
71 3300005564 Ga0070664_100195162 Ga0070664_1001951622 141
72 3300005577 Ga0068857_100012576 Ga0068857_1000125762 141
73 3300005577 Ga0068857_100066912 Ga0068857_1000669124 141
74 3300005577 Ga0068857_100500548 Ga0068857_1005005483 141
75 3300005577 Ga0068857_100967590 Ga0068857_1009675901 141
76 3300005577 Ga0068857_101867904 Ga0068857_1018679041 141
77 3300005578 Ga0068854_100006604 Ga0068854_1000066044 141
78 3300005578 Ga0068854_100016906 Ga0068854_1000169063 141
79 3300005616 Ga0068852_100008627 Ga0068852_1000086277 141
80 3300005616 Ga0068852_100650975 Ga0068852_1006509752 141
81 3300005617 Ga0068859_100002370 Ga0068859_1000023708 141
82 3300005617 Ga0068859_100149143 Ga0068859_1001491432 141
83 3300005617 Ga0068859_100188523 Ga0068859_1001885233 141
84 3300005617 Ga0068859_100565640 Ga0068859_1005656401 141
85 3300005617 Ga0068859_101243509 Ga0068859_1012435091 141
86 3300005618 Ga0068864_100011830 Ga0068864_1000118307 141
87 3300005618 Ga0068864_100012331 Ga0068864_1000123312 141
88 3300005718 Ga0068866_10186809 Ga0068866_101868092 141
89 3300005719 Ga0068861_100135863 Ga0068861_1001358633 141
90 3300005719 Ga0068861_100738804 Ga0068861_1007388041 141
91 3300005719 Ga0068861_102501042 Ga0068861_1025010421 141
92 3300005841 Ga0068863_100585324 Ga0068863_1005853242 141
93 3300005841 Ga0068863_100626530 Ga0068863_1006265302 141
94 3300005842 Ga0068858_100154955 Ga0068858_1001549552 141
95 3300005842 Ga0068858_100267911 Ga0068858_1002679112 141
96 3300005843 Ga0068860_100072398 Ga0068860_1000723984 141
97 3300005843 Ga0068860_100341485 Ga0068860_1003414852 141
98 3300005843 Ga0068860_100523337 Ga0068860_1005233372 141
99 3300005843 Ga0068860_101128713 Ga0068860_1011287131 141
100 3300005844 Ga0068862_100470836 Ga0068862_1004708362 141
101 3300006163 Ga0070715_10473538 Ga0070715_104735382 141
102 3300006195 Ga0075366_10136724 Ga0075366_101367242 141
103 3300006195 Ga0075366_10221438 Ga0075366_102214382 141
104 3300006237 Ga0097621_100031895 Ga0097621_1000318954 141
105 3300006237 Ga0097621_100198437 Ga0097621_1001984373 141
106 3300006237 Ga0097621_100336122 Ga0097621_1003361222 141
107 3300006358 Ga0068871_101616315 Ga0068871_1016163152 141
108 3300006844 Ga0075428_102094740 Ga0075428_1020947401 141
109 3300006881 Ga0068865_100099482 Ga0068865_1000994823 141
110 3300006881 Ga0068865_100176511 Ga0068865_1001765113 141
111 3300006931 Ga0097620_100002371 Ga0097620_10000237113 141
112 3300006931 Ga0097620_100149136 Ga0097620_1001491362 141
113 3300006931 Ga0097620_100188527 Ga0097620_1001885273 141
114 3300006931 Ga0097620_100565692 Ga0097620_1005656921 141
115 3300006931 Ga0097620_101243750 Ga0097620_1012437502 141
116 3300009093 Ga0105240_10185906 Ga0105240_101859062 141
117 3300009101 Ga0105247_10008586 Ga0105247_100085864 141
118 3300009147 Ga0114129_10018074 Ga0114129_100180745 141
119 3300009174 Ga0105241_10086145 Ga0105241_100861454 141
120 3300009174 Ga0105241_10482636 Ga0105241_104826362 141
121 3300009176 Ga0105242_10810252 Ga0105242_108102521 141
122 3300009176 Ga0105242_11393120 Ga0105242_113931202 141
123 3300009177 Ga0105248_10232304 Ga0105248_102323043 141
124 3300009545 Ga0105237_11905651 Ga0105237_119056511 141
125 3300009553 Ga0105249_10000820 Ga0105249_100008205 141
126 3300009553 Ga0105249_10163498 Ga0105249_101634983 141
127 3300009553 Ga0105249_10336248 Ga0105249_103362483 141
128 3300009553 Ga0105249_10448695 Ga0105249_104486952 141
129 3300009553 Ga0105249_13004009 Ga0105249_130040091 141
130 3300010375 Ga0105239_10082142 Ga0105239_100821425 141
131 3300010375 Ga0105239_10417882 Ga0105239_104178823 141
132 3300011119 Ga0105246_10157373 Ga0105246_101573733 141
133 3300013102 Ga0157371_10232852 Ga0157371_102328522 141
134 3300013102 Ga0157371_10278650 Ga0157371_102786502 141
135 3300013102 Ga0157371_10428485 Ga0157371_104284852 141
136 3300013296 Ga0157374_10000915 Ga0157374_1000091516 141
137 3300013296 Ga0157374_10009923 Ga0157374_100099234 141
138 3300013297 Ga0157378_10592504 Ga0157378_105925042 141
139 3300013297 Ga0157378_10803828 Ga0157378_108038282 141
140 3300013306 Ga0163162_10016056 Ga0163162_100160566 141
141 3300013306 Ga0163162_10057690 Ga0163162_100576904 141
142 3300013306 Ga0163162_10225898 Ga0163162_102258983 141
143 3300013306 Ga0163162_10311989 Ga0163162_103119892 141
144 3300013307 Ga0157372_10443485 Ga0157372_104434852 141
145 3300013307 Ga0157372_10454231 Ga0157372_104542312 141
146 3300013308 Ga0157375_10020800 Ga0157375_100208004 141
147 3300013308 Ga0157375_10190419 Ga0157375_101904193 141
148 3300013308 Ga0157375_10297049 Ga0157375_102970492 141
149 3300014325 Ga0163163_10017886 Ga0163163_100178863 141
150 3300014325 Ga0163163_10240409 Ga0163163_102404093 141
151 3300014325 Ga0163163_10266206 Ga0163163_102662063 141
152 3300014326 Ga0157380_10443765 Ga0157380_104437653 141
153 3300014745 Ga0157377_10007399 Ga0157377_100073995 141
154 3300014745 Ga0157377_10198516 Ga0157377_101985161 141
155 3300014968 Ga0157379_10230288 Ga0157379_102302883 141
156 3300014968 Ga0157379_10284096 Ga0157379_102840963 141
157 3300014968 Ga0157379_11001118 Ga0157379_110011181 141
158 3300014969 Ga0157376_10015051 Ga0157376_100150513 141
159 3300014969 Ga0157376_10433578 Ga0157376_104335782 141
160 3300014969 Ga0157376_10881502 Ga0157376_108815022 141
161 3300017792 Ga0163161_10028048 Ga0163161_100280482 141
162 3300017792 Ga0163161_10133124 Ga0163161_101331242 141
163 3300017792 Ga0163161_10407134 Ga0163161_104071342 141
164 3300025899 Ga0207642_10184515 Ga0207642_101845152 141
165 3300025899 Ga0207642_10265650 Ga0207642_102656501 141
166 3300025900 Ga0207710_10018240 Ga0207710_100182404 141
167 3300025901 Ga0207688_10965813 Ga0207688_109658131 141
168 3300025903 Ga0207680_10036745 Ga0207680_100367453 141
169 3300025903 Ga0207680_10072660 Ga0207680_100726603 141
170 3300025904 Ga0207647_10035668 Ga0207647_100356682 141
171 3300025905 Ga0207685_10021423 Ga0207685_100214232 141
172 3300025907 Ga0207645_10019931 Ga0207645_100199315 141
173 3300025911 Ga0207654_10943453 Ga0207654_109434532 141
174 3300025911 Ga0207654_11229272 Ga0207654_112292721 141
175 3300025913 Ga0207695_10659153 Ga0207695_106591532 141
176 3300025919 Ga0207657_10150649 Ga0207657_101506491 141
177 3300025919 Ga0207657_10262259 Ga0207657_102622592 141
178 3300025920 Ga0207649_10038880 Ga0207649_100388804 141
179 3300025920 Ga0207649_10301407 Ga0207649_103014072 141
180 3300025926 Ga0207659_10014170 Ga0207659_100141703 141
181 3300025926 Ga0207659_10144760 Ga0207659_101447603 141
182 3300025926 Ga0207659_10207819 Ga0207659_102078192 141
183 3300025931 Ga0207644_10260326 Ga0207644_102603263 141
184 3300025931 Ga0207644_10538050 Ga0207644_105380502 141
185 3300025932 Ga0207690_10094453 Ga0207690_100944532 141
186 3300025932 Ga0207690_10156498 Ga0207690_101564982 141
187 3300025933 Ga0207706_10004466 Ga0207706_1000446612 141
188 3300025933 Ga0207706_10150715 Ga0207706_101507153 141
189 3300025933 Ga0207706_10481530 Ga0207706_104815302 141
190 3300025936 Ga0207670_10017164 Ga0207670_100171645 141
191 3300025936 Ga0207670_10054391 Ga0207670_100543912 141
192 3300025936 Ga0207670_10098814 Ga0207670_100988143 141
193 3300025938 Ga0207704_10035612 Ga0207704_100356124 141
194 3300025940 Ga0207691_10155917 Ga0207691_101559173 141
195 3300025942 Ga0207689_10004472 Ga0207689_1000447210 141
196 3300025942 Ga0207689_10007606 Ga0207689_100076065 141
197 3300025942 Ga0207689_10032300 Ga0207689_100323004 141
198 3300025944 Ga0207661_10018316 Ga0207661_100183165 141
199 3300025944 Ga0207661_10072862 Ga0207661_100728623 141
200 3300025944 Ga0207661_10250541 Ga0207661_102505411 141
201 3300025945 Ga0207679_10003552 Ga0207679_1000355210 141
202 3300025945 Ga0207679_10024793 Ga0207679_100247934 141
203 3300025945 Ga0207679_10252705 Ga0207679_102527052 141
204 3300025945 Ga0207679_10383226 Ga0207679_103832263 141
205 3300025960 Ga0207651_10019675 Ga0207651_100196753 141
206 3300025960 Ga0207651_10023306 Ga0207651_100233063 141
207 3300025961 Ga0207712_10003291 Ga0207712_100032915 141
208 3300025961 Ga0207712_10017369 Ga0207712_100173695 141
209 3300025961 Ga0207712_10217201 Ga0207712_102172012 141
210 3300025961 Ga0207712_10409826 Ga0207712_104098262 141
211 3300025972 Ga0207668_11263794 Ga0207668_112637942 141
212 3300025981 Ga0207640_10281972 Ga0207640_102819722 141
213 3300025986 Ga0207658_10184274 Ga0207658_101842743 141
214 3300025986 Ga0207658_10343901 Ga0207658_103439013 141
215 3300025986 Ga0207658_10991551 Ga0207658_109915512 141
216 3300026023 Ga0207677_10046980 Ga0207677_100469804 141
217 3300026023 Ga0207677_10153645 Ga0207677_101536453 141
218 3300026035 Ga0207703_10231865 Ga0207703_102318652 141
219 3300026035 Ga0207703_10665284 Ga0207703_106652842 141
220 3300026041 Ga0207639_10332605 Ga0207639_103326053 141
221 3300026041 Ga0207639_11040890 Ga0207639_110408902 141
222 3300026067 Ga0207678_10166835 Ga0207678_101668353 141
223 3300026067 Ga0207678_10787636 Ga0207678_107876362 141
224 3300026088 Ga0207641_10018617 Ga0207641_100186172 141
225 3300026088 Ga0207641_10149159 Ga0207641_101491593 141
226 3300026088 Ga0207641_10287819 Ga0207641_102878192 141
227 3300026088 Ga0207641_12102649 Ga0207641_121026491 141
228 3300026089 Ga0207648_10054596 Ga0207648_100545963 141
229 3300026089 Ga0207648_10234010 Ga0207648_102340102 141
230 3300026095 Ga0207676_10006423 Ga0207676_100064236 141
231 3300026095 Ga0207676_10113785 Ga0207676_101137852 141
232 3300026116 Ga0207674_10001527 Ga0207674_1000152710 141
233 3300026116 Ga0207674_10003496 Ga0207674_1000349621 141
234 3300026116 Ga0207674_10058649 Ga0207674_100586495 141
235 3300026116 Ga0207674_11455018 Ga0207674_114550182 141
236 3300026118 Ga0207675_100195576 Ga0207675_1001955762 141
237 3300026118 Ga0207675_100424813 Ga0207675_1004248133 141
238 3300026118 Ga0207675_100574803 Ga0207675_1005748032 141
239 3300026121 Ga0207683_10032310 Ga0207683_100323105 141
240 3300026142 Ga0207698_10047776 Ga0207698_100477762 141
241 3300026142 Ga0207698_12019250 Ga0207698_120192501 141
242 3300028380 Ga0268265_10260313 Ga0268265_102603132 141
243 3300028381 Ga0268264_10843114 Ga0268264_108431142 141
244 3300028794 Ga0307515_10798996 Ga0307515_107989961 141
245 3300031456 Ga0307513_10131388 Ga0307513_101313882 141
246 3300031730 Ga0307516_10284007 Ga0307516_102840072 141
247 3300032004 Ga0307414_10137233 Ga0307414_101372332 141
248 3300032126 Ga0307415_100326371 Ga0307415_1003263712 141
249 3300035086 Ga0373934_0116720 Ga0373934_0116720_312_737 141
250 3300035111 Ga0373923_0179390 Ga0373923_0179390_188_613 141
251 3300035115 Ga0373941_0488283 Ga0373941_0488283_85_510 141
252 3300035117 Ga0373953_0323157 Ga0373953_0323157_128_553 141
253 3300035118 Ga0373954_0163713 Ga0373954_0163713_527_952 141
254 3300035119 Ga0373956_0332334 Ga0373956_0332334_212_637 141
255 3300035171 Ga0373946_0435424 Ga0373946_0435424_191_616 141
256 3300035410 Ga0373924_0112667 Ga0373924_0112667_298_723 141
257 3300035691 Ga0373931_0718554 Ga0373931_0718554_164_589 141
258 3300035692 Ga0373935_0821245 Ga0373935_0821245_223_648 141
259 3300035724 Ga0373933_0028788 Ga0373933_0028788_179_604 141
260 3300037068 Ga0373925_0330494 Ga0373925_0330494_683_1108 141
261 3300039437 Ga0436365_0522919 Ga0436365_0522919_860_1288 141
262 3300041406 Ga0439439_0234899 Ga0439439_0234899_28_453 141
263 3300041486 Ga0451807_1962992 Ga0451807_1962992_114_539 141
264 3300041512 Ga0451853_2186023 Ga0451853_2186023_189_614 141
265 3300041512 Ga0451853_3223251 Ga0451853_3223251_749_1174 141
266 3300044842 Ga0466957_0654909 Ga0466957_0654909_89_514 141
267 3300045051 Ga0451576_1897054 Ga0451576_1897054_176_601 141
268 3300046454 Ga0495592_0293917 Ga0495592_0293917_427_852 141
269 3300046511 Ga0495608_0647250 Ga0495608_0647250_49_474 141
270 3300046516 Ga0495628_0176441 Ga0495628_0176441_155_580 141
271 3300046533 Ga0495640_0500185 Ga0495640_0500185_90_515 141
272 3300046535 Ga0495586_0133659 Ga0495586_0133659_17_442 141
273 3300046642 Ga0495634_0277690 Ga0495634_0277690_330_755 141
274 3300046675 Ga0495657_0363448 Ga0495657_0363448_183_608 141
275 3300046678 Ga0495599_0331197 Ga0495599_0331197_130_555 141
276 3300046680 Ga0495646_0391023 Ga0495646_0391023_243_668 141
277 3300046690 Ga0495624_0527390 Ga0495624_0527390_201_626 141
278 3300046809 Ga0495600_0413235 Ga0495600_0413235_50_475 141
279 3300047317 Ga0495604_0358374 Ga0495604_0358374_90_515 141
280 3300047471 Ga0495684_0144054 Ga0495684_0144054_769_1194 141
281 3300047472 Ga0495686_0138280 Ga0495686_0138280_39_473 141
282 3300048913 Ga0496110_0011801 Ga0496110_0011801_3433_3858 141
283 3300048917 Ga0496114_0073695 Ga0496114_0073695_514_939 141
284 3300049513 Ga0501290_060558 Ga0501290_060558_147_572 141
285 3300049569 Ga0501032_0013058 Ga0501032_0013058_445_870 141
286 3300049571 Ga0501034_0008720 Ga0501034_0008720_5646_6071 141
287 3300049571 Ga0501034_0014195 Ga0501034_0014195_1420_1848 141
288 3300049571 Ga0501034_0130791 Ga0501034_0130791_554_982 141
289 3300049572 Ga0501036_0640956 Ga0501036_0640956_199_627 141
290 3300049574 Ga0501038_0042009 Ga0501038_0042009_2396_2821 141
291 3300049579 Ga0501043_0013717 Ga0501043_0013717_5489_5914 141
292 3300049580 Ga0501046_0004460 Ga0501046_0004460_4984_5409 141
293 3300049581 Ga0501047_0027226 Ga0501047_0027226_2506_2931 141
294 3300049581 Ga0501047_0592730 Ga0501047_0592730_353_778 141
295 3300049582 Ga0501048_0020793 Ga0501048_0020793_1394_1819 141
296 3300049583 Ga0501067_0068415 Ga0501067_0068415_65_490 141
297 3300049585 Ga0501069_0860414 Ga0501069_0860414_65_490 141
298 3300049586 Ga0501070_0016632 Ga0501070_0016632_404_829 141
299 3300049587 Ga0501071_1016886 Ga0501071_1016886_191_616 141
300 3300049589 Ga0501073_0021509 Ga0501073_0021509_1035_1460 141
301 3300049590 Ga0501074_0011049 Ga0501074_0011049_2939_3364 141
302 3300049593 Ga0501077_0335442 Ga0501077_0335442_307_732 141
303 3300049660 Ga0501216_026224 Ga0501216_026224_446_871 141
304 3300049741 Ga0501079_0169264 Ga0501079_0169264_518_943 141
305 3300049742 Ga0501080_0108595 Ga0501080_0108595_1112_1537 141
306 3300049744 Ga0501083_0019298 Ga0501083_0019298_2715_3140 141
307 3300049822 Ga0501035_0035219 Ga0501035_0035219_3141_3566 141
308 3300049822 Ga0501035_0359186 Ga0501035_0359186_17_445 141
309 3300049823 Ga0501044_0014176 Ga0501044_0014176_4693_5118 141
310 3300049823 Ga0501044_0544098 Ga0501044_0544098_469_897 141
311 3300050507 nmdc:mga05p37_3226_c1 nmdc:mga05p37_3226_c1_12773_13198 141
312 3300053085 Ga0495619_0639301 Ga0495619_0639301_180_605 141
313 3300053090 Ga0500646_0043400 Ga0500646_0043400_437_862 141
314 3300053092 Ga0500583_0000019 Ga0500583_0000019_29873_30298 141
315 3300053096 Ga0500641_0103157 Ga0500641_0103157_50_481 141
316 3300053133 Ga0500655_015156 Ga0500655_015156_347_772 141
317 3300053147 Ga0500589_047424 Ga0500589_047424_1085_1510 141
318 3300053151 Ga0500604_0014010 Ga0500604_0014010_1356_1784 141
319 3300054114 Ga0501084_0593626 Ga0501084_0593626_151_576 141
320 3300060353 Ga0501082_0042021 Ga0501082_0042021_424_849 141
321 3300002459 JGI24751J29686_10000484 JGI24751J29686_1000048413 142
322 3300005293 Ga0065715_10778183 Ga0065715_107781831 142
323 3300005331 Ga0070670_100006286 Ga0070670_1000062865 142
324 3300005331 Ga0070670_100106570 Ga0070670_1001065701 142
325 3300005331 Ga0070670_100479003 Ga0070670_1004790032 142
326 3300005334 Ga0068869_100341030 Ga0068869_1003410302 142
327 3300005340 Ga0070689_100260426 Ga0070689_1002604262 142
328 3300005347 Ga0070668_100138981 Ga0070668_1001389813 142
329 3300005459 Ga0068867_100652143 Ga0068867_1006521432 142
330 3300005539 Ga0068853_101248948 Ga0068853_1012489481 142
331 3300005616 Ga0068852_100950740 Ga0068852_1009507402 142
332 3300005617 Ga0068859_100940942 Ga0068859_1009409421 142
333 3300005834 Ga0068851_10268381 Ga0068851_102683811 142
334 3300005841 Ga0068863_100351408 Ga0068863_1003514082 142
335 3300005843 Ga0068860_100251957 Ga0068860_1002519571 142
336 3300005844 Ga0068862_100701647 Ga0068862_1007016471 142
337 3300006931 Ga0097620_100941010 Ga0097620_1009410101 142
338 3300009553 Ga0105249_10000651 Ga0105249_1000065121 142
339 3300013307 Ga0157372_10461118 Ga0157372_104611182 142
340 3300025936 Ga0207670_10212263 Ga0207670_102122632 142
341 3300025961 Ga0207712_10003360 Ga0207712_1000336010 142
342 3300025981 Ga0207640_10465479 Ga0207640_104654792 142
343 3300026088 Ga0207641_11526755 Ga0207641_115267551 142
344 3300026089 Ga0207648_10016877 Ga0207648_100168778 142
345 3300026089 Ga0207648_11421044 Ga0207648_114210441 142
346 3300026116 Ga0207674_10303876 Ga0207674_103038762 142
347 3300031456 Ga0307513_10228709 Ga0307513_102287091 142
348 3300031507 Ga0307509_10223316 Ga0307509_102233161 142
349 3300031507 Ga0307509_10292315 Ga0307509_102923151 142
350 3300044842 Ga0466957_0011267 Ga0466957_0011267_1154_1582 142
351 3300049520 Ga0501297_001732 Ga0501297_001732_449_880 142
352 3300049521 Ga0501298_000129 Ga0501298_000129_7752_8183 142
353 3300049523 Ga0501300_006914 Ga0501300_006914_1104_1535 142
354 3300049649 Ga0501198_000488 Ga0501198_000488_206_637 142
355 3300049651 Ga0501201_000366 Ga0501201_000366_218_649 142
356 3300049652 Ga0501202_000240 Ga0501202_000240_4487_4918 142
357 3300049653 Ga0501206_000629 Ga0501206_000629_1751_2182 142
358 3300049654 Ga0501207_043822 Ga0501207_043822_70_501 142
359 3300049663 Ga0501223_012387 Ga0501223_012387_153_584 142
360 3300049664 Ga0501224_005992 Ga0501224_005992_1046_1477 142
361 3300049668 Ga0501233_010247 Ga0501233_010247_1283_1714 142
362 3300049669 Ga0501235_000837 Ga0501235_000837_1092_1523 142
363 3300049675 Ga0501243_000627 Ga0501243_000627_1930_2361 142
364 3300049675 Ga0501243_012537 Ga0501243_012537_820_1251 142
365 3300049681 Ga0501251_001476 Ga0501251_001476_1160_1591 142
366 3300049682 Ga0501252_028561 Ga0501252_028561_189_620 142
367 3300049683 Ga0501253_016970 Ga0501253_016970_476_907 142
368 3300049684 Ga0501255_045903 Ga0501255_045903_127_558 142
369 3300049685 Ga0501256_019138 Ga0501256_019138_240_671 142
370 3300049686 Ga0501257_009944 Ga0501257_009944_1063_1494 142
371 3300049688 Ga0501259_007279 Ga0501259_007279_1236_1667 142
372 3300049689 Ga0501260_020877 Ga0501260_020877_187_618 142
373 3300049690 Ga0501261_001135 Ga0501261_001135_2207_2638 142
374 3300049704 Ga0501221_000502 Ga0501221_000502_114_545 142
375 3300049705 Ga0501225_0007046 Ga0501225_0007046_2351_2782 142
376 3300049706 Ga0501229_066802 Ga0501229_066802_92_523 142
377 3300049708 Ga0501245_000683 Ga0501245_000683_306_737 142
378 3300049761 Ga0501264_006089 Ga0501264_006089_194_625 142
379 3300049765 Ga0501268_020077 Ga0501268_020077_449_880 142
380 3300049765 Ga0501268_022834 Ga0501268_022834_564_995 142
381 3300049767 Ga0501270_029624 Ga0501270_029624_299_730 142
382 3300049768 Ga0501271_005148 Ga0501271_005148_225_656 142
383 3300049851 Ga0501212_019679 Ga0501212_019679_177_608 142
384 3300049851 Ga0501212_024767 Ga0501212_024767_169_600 142
385 2162886012 MBSR1b_contig_13901972 MBSR1b_0018.00004040 143
386 3300002459 JGI24751J29686_10063138 JGI24751J29686_100631381 143
387 3300005289 Ga0065704_10301526 Ga0065704_103015261 143
388 3300005290 Ga0065712_10069343 Ga0065712_100693432 143
389 3300005295 Ga0065707_10015426 Ga0065707_100154262 143
390 3300005328 Ga0070676_10012802 Ga0070676_100128025 143
391 3300005331 Ga0070670_100096401 Ga0070670_1000964013 143
392 3300005334 Ga0068869_100346481 Ga0068869_1003464811 143
393 3300005338 Ga0068868_100251976 Ga0068868_1002519762 143
394 3300005340 Ga0070689_100076713 Ga0070689_1000767131 143
395 3300005353 Ga0070669_100065502 Ga0070669_1000655022 143
396 3300005354 Ga0070675_100020442 Ga0070675_1000204423 143
397 3300005364 Ga0070673_100008798 Ga0070673_1000087985 143
398 3300005365 Ga0070688_100004087 Ga0070688_1000040879 143
399 3300005438 Ga0070701_10226712 Ga0070701_102267122 143
400 3300005457 Ga0070662_100013753 Ga0070662_1000137535 143
401 3300005459 Ga0068867_100177774 Ga0068867_1001777741 143
402 3300005543 Ga0070672_100028856 Ga0070672_1000288562 143
403 3300005577 Ga0068857_100002332 Ga0068857_1000023324 143
404 3300005578 Ga0068854_100024858 Ga0068854_1000248584 143
405 3300005617 Ga0068859_100112601 Ga0068859_1001126015 143
406 3300005719 Ga0068861_100012016 Ga0068861_1000120167 143
407 3300005840 Ga0068870_10016913 Ga0068870_100169133 143
408 3300005844 Ga0068862_100003351 Ga0068862_1000033519 143
409 3300006931 Ga0097620_100112600 Ga0097620_1001126005 143
410 3300009094 Ga0111539_10002870 Ga0111539_1000287022 143
411 3300009553 Ga0105249_10045758 Ga0105249_100457582 143
412 3300010375 Ga0105239_13139593 Ga0105239_131395931 143
413 3300013104 Ga0157370_10332339 Ga0157370_103323393 143
414 3300013105 Ga0157369_10824511 Ga0157369_108245111 143
415 3300013307 Ga0157372_10076444 Ga0157372_100764442 143
416 3300013308 Ga0157375_10120986 Ga0157375_101209863 143
417 3300014326 Ga0157380_10001482 Ga0157380_1000148210 143
418 3300014745 Ga0157377_10000309 Ga0157377_100003092 143
419 3300017792 Ga0163161_10428200 Ga0163161_104282001 143
420 3300025315 Ga0207697_10037600 Ga0207697_100376004 143
421 3300025907 Ga0207645_10028008 Ga0207645_100280084 143
422 3300025908 Ga0207643_10039563 Ga0207643_100395633 143
423 3300025923 Ga0207681_10001299 Ga0207681_100012999 143
424 3300025925 Ga0207650_10811453 Ga0207650_108114532 143
425 3300025925 Ga0207650_11220781 Ga0207650_112207811 143
426 3300025926 Ga0207659_10251387 Ga0207659_102513872 143
427 3300025933 Ga0207706_10007238 Ga0207706_100072384 143
428 3300025936 Ga0207670_10819317 Ga0207670_108193171 143
429 3300025940 Ga0207691_10045355 Ga0207691_100453554 143
430 3300025942 Ga0207689_10024133 Ga0207689_100241334 143
431 3300025960 Ga0207651_10043099 Ga0207651_100430994 143
432 3300025972 Ga0207668_10061463 Ga0207668_100614633 143
433 3300025981 Ga0207640_10049385 Ga0207640_100493854 143
434 3300026075 Ga0207708_10521696 Ga0207708_105216961 143
435 3300026089 Ga0207648_10026913 Ga0207648_100269133 143
436 3300026116 Ga0207674_10004662 Ga0207674_1000466215 143
437 3300026118 Ga0207675_100000609 Ga0207675_10000060931 143
438 3300028380 Ga0268265_10125182 Ga0268265_101251823 143
439 3300028381 Ga0268264_10293459 Ga0268264_102934593 143
440 3300031901 Ga0307406_10129572 Ga0307406_101295722 143
441 3300032004 Ga0307414_10100792 Ga0307414_101007922 143
442 3300032004 Ga0307414_12056192 Ga0307414_120561921 143
443 3300032126 Ga0307415_100710878 Ga0307415_1007108782 143
444 3300035170 Ga0373943_0385143 Ga0373943_0385143_50_490 143
445 3300035725 Ga0373947_0242300 Ga0373947_0242300_485_919 143
446 3300035725 Ga0373947_0400379 Ga0373947_0400379_188_628 143
447 3300037068 Ga0373925_0237169 Ga0373925_0237169_651_1091 143
448 3300037068 Ga0373925_1166192 Ga0373925_1166192_10_444 143
449 3300037312 Ga0395899_0890047 Ga0395899_0890047_59_493 143
450 3300037418 Ga0395900_0044904 Ga0395900_0044904_465_899 143
451 3300037471 Ga0395905_0005396 Ga0395905_0005396_2365_2799 143
452 3300049588 Ga0501072_0193032 Ga0501072_0193032_596_1030 143
453 3300049669 Ga0501235_045334 Ga0501235_045334_376_828 143
454 3300050511 nmdc:mga08y16_240899_c1 nmdc:mga08y16_240899_c1_393_824 143

Structural Annotation

Top 5 Hits

ID Description Score Start End
4np6-assembly2.cif.gz_C crystal structure of adenylate kinase from vibrio cholerae o1 biovar eltor 0.6016 95 135
5gkk-assembly1.cif.gz_A crystal structure of a homing endonuclease, i-tnai 0.4551 11 71
2ld7-assembly1.cif.gz_B solution structure of the msin3a pah3-sap30 sid complex 0.4492 1 76
2ld7-assembly1.cif.gz_B solution structure of the msin3a pah3-sap30 sid complex 0.4457 1 76
2qzg-assembly1.cif.gz_A crystal structure of unknown function protein mmp1188 0.4046 4 76
ID Description Score Start End Superfamily
af_Q4DS13_201_283_1.10.287.10 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;S15/NS1, RNA-binding 0.5122 10 70 1.10.287.10
af_P35250_258_350_1.20.272.10 Mainly Alpha;Up-down Bundle;Zinc Finger, Delta Prime; domain 3; 0.4906 10 73 1.20.272.10
af_Q9LW84_438_508_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4757 5 74 1.25.40.10
af_Q9LW84_438_508_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4655 5 74 1.25.40.10
af_Q64112_132_192_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.4635 7 82 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A4Q6AMG0-F1-model_v4 Uncharacterized protein 0.73 1 118
AF-A0A4Q6AMG0-F1-model_v4 Uncharacterized protein 0.7129 1 118
AF-A0A1V9EDD8-F1-model_v4 Uncharacterized protein 0.711 77 143
AF-A0A3C1T6R4-F1-model_v4 Uncharacterized protein 0.7097 8 141
AF-A0A3C1T6R4-F1-model_v4 Uncharacterized protein 0.7014 8 141

Feature Viewer

pLDDT pTM Quality
86.31 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map