F447445

General Info

Members Datasets Scaffolds Average Seq Length
454 220 908 263

Family's Representative Sequence

Representative Sequence 3300047320|Ga0495672_0151786|Ga0495672_0151786_252_1106
Length 284
Sequence LIARRRRDEPAVVTPTPEDEAALDATKAPLMEHLIELRKRLIWAVLSFGICFVVSFAFSTQIFNFLTEPLHQALKGKPNDHMIYTALTEVFFTKVKIGMFGGICLGFPAIAAQLWIFVAPGLYKHEKRAFLPFLLWTPVMFTMGAAFVYFIMLPFSIDFFVAYQTSSTDGAMGIELQAKVSDYLGFVMTLIFAFGLTFQLPVLLSLLGKVGIVTSKGLREMRRYAIVGLFAVAAIFTPPDAISMLALAVPLTLLYEVSIWCVIMIERTRAKEDAARAARDLTPA

Samples

Sample ID Description Type Environment
1 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
32 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
69 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
70 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
71 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
72 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
73 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
74 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
75 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
76 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
121 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
122 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
125 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
126 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
127 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
128 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
129 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
130 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
131 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
138 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
139 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
141 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
144 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
151 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
152 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
159 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
162 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
163 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
164 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
165 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
168 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
169 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
172 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
173 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
174 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
197 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
198 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
199 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
200 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
201 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
202 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
203 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
204 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
205 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
210 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
211 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
212 2643221580 Devosia sp. Root635 Isolate Unclassified
213 2643221591 Devosia sp. Root685 Isolate Unclassified
214 2643221674 Devosia sp. Root436 Isolate Unclassified
215 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
216 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
217 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
218 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
219 2932401849 Devosia sp. 2618 Isolate Rhizosphere
220 8054002106 Azospirillum lipoferum 59b Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 0.22
Isolates 2.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.96
Nodule 0
Rhizoplane 0.44
Rhizosphere 89.43
Stem 0
Stem Tuber 0
Unclassified 7.71

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495672_0151786 3300047320 Unclassified 1201
2 JGI25165J46597_1000425 3300003214 Bacteria 43589
3 JGI25153J46596_10000552 3300003215 Bacteria 23376
4 Ga0065704_10234698 3300005289 Bacteria 1032
5 Ga0070658_10002834 3300005327 Bacteria 14407
6 Ga0070658_10139089 3300005327 Bacteria 2027
7 Ga0070658_10193219 3300005327 Bacteria 1716
8 Ga0070658_10363285 3300005327 Bacteria 1240
9 Ga0070658_10381820 3300005327 Bacteria 1209
10 Ga0070676_10156414 3300005328 Bacteria 1463
11 Ga0070683_100091758 3300005329 Bacteria 2852
12 Ga0070690_100026903 3300005330 Bacteria 3552
13 Ga0070670_100268896 3300005331 Bacteria 1487
14 Ga0068869_100035401 3300005334 Bacteria 3538
15 Ga0068869_100431899 3300005334 Bacteria 1088
16 Ga0070666_10004425 3300005335 Bacteria 8558
17 Ga0070666_10006985 3300005335 Bacteria 6960
18 Ga0070666_10059351 3300005335 Bacteria 2587
19 Ga0070680_100002345 3300005336 Bacteria 13991
20 Ga0068868_100019123 3300005338 Bacteria 5130
21 Ga0068868_100145697 3300005338 Unclassified 1947
22 Ga0070660_100034520 3300005339 Bacteria 3822
23 Ga0070660_100246891 3300005339 Bacteria 1455
24 Ga0070660_100297879 3300005339 Unclassified 1322
25 Ga0070689_100288386 3300005340 Bacteria 1363
26 Ga0070661_100000415 3300005344 Bacteria 32936
27 Ga0070661_100237408 3300005344 Bacteria 1402
28 Ga0070669_100258740 3300005353 Bacteria 1388
29 Ga0070675_100290453 3300005354 Unclassified 1439
30 Ga0070688_100014230 3300005365 Bacteria 4504
31 Ga0070659_100196990 3300005366 Bacteria 1657
32 Ga0070667_100008047 3300005367 Bacteria 8745
33 Ga0070667_100023261 3300005367 Bacteria 5140
34 Ga0070667_100225017 3300005367 Bacteria 1671
35 Ga0070678_100024532 3300005456 Unclassified 4040
36 Ga0070678_100093622 3300005456 Bacteria 2311
37 Ga0070678_100268425 3300005456 Bacteria 1438
38 Ga0070662_100083826 3300005457 Unclassified 2380
39 Ga0070681_10000001 3300005458 Bacteria 946857
40 Ga0070681_10073488 3300005458 Bacteria 3381
41 Ga0070681_10391393 3300005458 Unclassified 1301
42 Ga0070681_10544775 3300005458 Bacteria 1074
43 Ga0068867_100004232 3300005459 Bacteria 10099
44 Ga0068867_100069625 3300005459 Bacteria 2628
45 Ga0070699_100346877 3300005518 Bacteria 1337
46 Ga0070679_100000096 3300005530 Bacteria 67304
47 Ga0070679_100006337 3300005530 Bacteria 11018
48 Ga0070679_100070061 3300005530 Bacteria 3498
49 Ga0070679_100316072 3300005530 Bacteria 1511
50 Ga0070679_100430262 3300005530 Bacteria 1265
51 Ga0070679_100589815 3300005530 Bacteria 1055
52 Ga0070684_100098543 3300005535 Bacteria 2608
53 Ga0070684_100195111 3300005535 Bacteria 1843
54 Ga0068853_100060241 3300005539 Bacteria 3279
55 Ga0068853_100082395 3300005539 Bacteria 2818
56 Ga0068853_100170180 3300005539 Bacteria 1971
57 Ga0070695_100233287 3300005545 Unclassified 1331
58 Ga0070693_100168467 3300005547 Bacteria 1401
59 Ga0070665_100002027 3300005548 Bacteria 22781
60 Ga0070665_100004584 3300005548 Bacteria 14471
61 Ga0070665_100042507 3300005548 Unclassified 4568
62 Ga0070665_100067189 3300005548 Bacteria 3595
63 Ga0070665_100092073 3300005548 Bacteria 3036
64 Ga0070665_100207277 3300005548 Bacteria 1961
65 Ga0070665_100377787 3300005548 Bacteria 1424
66 Ga0068855_100201456 3300005563 Bacteria 2240
67 Ga0068855_100251188 3300005563 Bacteria 1973
68 Ga0068855_100332287 3300005563 Bacteria 1678
69 Ga0070664_100317947 3300005564 Bacteria 1410
70 Ga0068857_100045453 3300005577 Bacteria 3896
71 Ga0068856_100142061 3300005614 Bacteria 2408
72 Ga0068856_100271852 3300005614 Bacteria 1711
73 Ga0068856_100327470 3300005614 Bacteria 1550
74 Ga0068852_100015405 3300005616 Bacteria 5929
75 Ga0068852_100118787 3300005616 Bacteria 2416
76 Ga0068852_100246059 3300005616 Bacteria 1711
77 Ga0068859_100057770 3300005617 Bacteria 3908
78 Ga0068859_100113930 3300005617 Bacteria 2768
79 Ga0068851_10084228 3300005834 Bacteria 1665
80 Ga0068863_100026142 3300005841 Bacteria 5570
81 Ga0068863_100074099 3300005841 Bacteria 3220
82 Ga0068858_100059973 3300005842 Bacteria 3517
83 Ga0068858_100315325 3300005842 Unclassified 1494
84 Ga0068860_100032511 3300005843 Bacteria 5012
85 Ga0068860_100202656 3300005843 Bacteria 1923
86 Ga0068860_100277251 3300005843 Bacteria 1638
87 Ga0068862_100093360 3300005844 Bacteria 2624
88 Ga0068862_100306383 3300005844 Bacteria 1463
89 Ga0081539_10003744 3300005985 Bacteria 18082
90 Ga0070712_100049256 3300006175 Bacteria 2925
91 Ga0097621_100000693 3300006237 Bacteria 23626
92 Ga0097621_100051066 3300006237 Bacteria 3364
93 Ga0097621_100324351 3300006237 Bacteria 1365
94 Ga0068871_100000385 3300006358 Bacteria 31027
95 Ga0068871_100017481 3300006358 Bacteria 5428
96 Ga0068871_100112013 3300006358 Bacteria 2296
97 Ga0068871_100187769 3300006358 Bacteria 1779
98 Ga0068871_100246354 3300006358 Bacteria 1555
99 Ga0068871_100369142 3300006358 Bacteria 1272
100 Ga0068865_100019735 3300006881 Bacteria 4364
101 Ga0068865_100049141 3300006881 Unclassified 2906
102 Ga0097620_100057772 3300006931 Bacteria 3908
103 Ga0097620_100113925 3300006931 Bacteria 2768
104 Ga0105240_10000189 3300009093 Bacteria 125396
105 Ga0105240_10022178 3300009093 Bacteria 8424
106 Ga0105240_10040506 3300009093 Bacteria 5957
107 Ga0105240_10047424 3300009093 Bacteria 5436
108 Ga0105240_10064693 3300009093 Bacteria 4543
109 Ga0105240_10200393 3300009093 Bacteria 2339
110 Ga0105240_10215857 3300009093 Bacteria 2238
111 Ga0105240_10300617 3300009093 Bacteria 1836
112 Ga0105240_10324358 3300009093 Bacteria 1754
113 Ga0105240_10376010 3300009093 Bacteria 1605
114 Ga0105245_10036515 3300009098 Bacteria 4366
115 Ga0105245_10115751 3300009098 Bacteria 2499
116 Ga0105245_10188189 3300009098 Bacteria 1976
117 Ga0105245_10451638 3300009098 Bacteria 1294
118 Ga0105243_10050578 3300009148 Bacteria 3284
119 Ga0105243_10211188 3300009148 Bacteria 1709
120 Ga0105241_10016603 3300009174 Bacteria 5402
121 Ga0105241_10073163 3300009174 Bacteria 2665
122 Ga0105241_10106541 3300009174 Bacteria 2237
123 Ga0105242_10002477 3300009176 Bacteria 14478
124 Ga0105242_10004737 3300009176 Bacteria 10535
125 Ga0105242_10064993 3300009176 Bacteria 3009
126 Ga0105248_10000001 3300009177 Bacteria 1881304
127 Ga0105248_10030640 3300009177 Bacteria 6008
128 Ga0105248_10092485 3300009177 Bacteria 3406
129 Ga0105237_10044071 3300009545 Bacteria 4492
130 Ga0105237_10087383 3300009545 Bacteria 3107
131 Ga0105237_10143878 3300009545 Bacteria 2379
132 Ga0105237_10200544 3300009545 Bacteria 1995
133 Ga0105237_10233619 3300009545 Bacteria 1840
134 Ga0105237_10344348 3300009545 Unclassified 1495
135 Ga0105237_10480194 3300009545 Bacteria 1249
136 Ga0105238_10051825 3300009551 Bacteria 4126
137 Ga0105238_10060499 3300009551 Bacteria 3792
138 Ga0105238_10124164 3300009551 Unclassified 2561
139 Ga0105238_10126559 3300009551 Bacteria 2533
140 Ga0105238_10180964 3300009551 Bacteria 2085
141 Ga0105238_10181116 3300009551 Bacteria 2084
142 Ga0105238_10234543 3300009551 Bacteria 1812
143 Ga0105238_10258623 3300009551 Bacteria 1720
144 Ga0105238_10262774 3300009551 Bacteria 1706
145 Ga0105249_10003440 3300009553 Bacteria 13707
146 Ga0105249_10137287 3300009553 Bacteria 2341
147 Ga0105249_10197808 3300009553 Bacteria 1965
148 Ga0105239_10007355 3300010375 Bacteria 12647
149 Ga0105239_10021044 3300010375 Bacteria 7198
150 Ga0105239_10076188 3300010375 Bacteria 3689
151 Ga0105246_10004555 3300011119 Bacteria 8435
152 Ga0105246_10016138 3300011119 Unclassified 4726
153 Ga0157370_10032355 3300013104 Bacteria 5107
154 Ga0157370_10043367 3300013104 Bacteria 4330
155 Ga0157370_10063278 3300013104 Bacteria 3506
156 Ga0157370_10284578 3300013104 Bacteria 1527
157 Ga0157369_10054498 3300013105 Bacteria 4318
158 Ga0157369_10239529 3300013105 Bacteria 1895
159 Ga0157369_10313354 3300013105 Bacteria 1631
160 Ga0157374_10009118 3300013296 Bacteria 8502
161 Ga0157374_10055681 3300013296 Bacteria 3692
162 Ga0157378_10017840 3300013297 Bacteria 6230
163 Ga0157378_10039888 3300013297 Unclassified 4164
164 Ga0157378_10043102 3300013297 Bacteria 4006
165 Ga0157378_10107892 3300013297 Unclassified 2548
166 Ga0157372_10296708 3300013307 Bacteria 1880
167 Ga0157372_10805973 3300013307 Unclassified 1091
168 Ga0157375_10022429 3300013308 Bacteria 5811
169 Ga0157375_10364595 3300013308 Bacteria 1611
170 Ga0163163_10000007 3300014325 Bacteria 288439
171 Ga0163163_10039975 3300014325 Unclassified 4579
172 Ga0163163_10108259 3300014325 Bacteria 2806
173 Ga0163163_10135522 3300014325 Bacteria 2504
174 Ga0157379_10001375 3300014968 Bacteria 19911
175 Ga0157379_10429018 3300014968 Bacteria 1218
176 Ga0157376_10390137 3300014969 Bacteria 1343
177 Ga0163161_10003454 3300017792 Bacteria 11071
178 Ga0213876_10055206 3300021384 Bacteria 2097
179 Ga0213876_10166735 3300021384 Bacteria 1172
180 Ga0213875_10220188 3300021388 Bacteria 894
181 Ga0209233_1000013 3300025261 Bacteria 1013785
182 Ga0209233_1004067 3300025261 Bacteria 5051
183 Ga0209675_1000873 3300025291 Bacteria 19411
184 Ga0209758_1000036 3300025297 Bacteria 441671
185 Ga0209257_1007643 3300025304 Bacteria 6474
186 Ga0207642_10057097 3300025899 Bacteria 1794
187 Ga0207688_10057611 3300025901 Bacteria 2184
188 Ga0207680_10018406 3300025903 Bacteria 3712
189 Ga0207680_10063774 3300025903 Bacteria 2256
190 Ga0207645_10115778 3300025907 Bacteria 1738
191 Ga0207643_10175676 3300025908 Bacteria 1294
192 Ga0207654_10115617 3300025911 Unclassified 1676
193 Ga0207654_10147452 3300025911 Bacteria 1507
194 Ga0207707_10000001 3300025912 Bacteria 1212482
195 Ga0207707_10378702 3300025912 Bacteria 1217
196 Ga0207695_10000003 3300025913 Bacteria 1368691
197 Ga0207695_10006268 3300025913 Bacteria 15485
198 Ga0207695_10033816 3300025913 Bacteria 5569
199 Ga0207695_10061684 3300025913 Bacteria 3874
200 Ga0207695_10067671 3300025913 Bacteria 3662
201 Ga0207695_10126800 3300025913 Bacteria 2513
202 Ga0207695_10165009 3300025913 Bacteria 2144
203 Ga0207695_10189392 3300025913 Bacteria 1975
204 Ga0207695_10239190 3300025913 Bacteria 1717
205 Ga0207695_10439860 3300025913 Bacteria 1187
206 Ga0207671_10010097 3300025914 Bacteria 7827
207 Ga0207671_10225315 3300025914 Bacteria 1470
208 Ga0207671_10278016 3300025914 Bacteria 1320
209 Ga0207660_10001894 3300025917 Bacteria 13943
210 Ga0207657_10272903 3300025919 Bacteria 1344
211 Ga0207657_10294758 3300025919 Unclassified 1286
212 Ga0207649_10000448 3300025920 Bacteria 29660
213 Ga0207649_10166564 3300025920 Bacteria 1531
214 Ga0207652_10000815 3300025921 Bacteria 29778
215 Ga0207652_10011116 3300025921 Bacteria 7255
216 Ga0207652_10063640 3300025921 Bacteria 3190
217 Ga0207652_10080918 3300025921 Bacteria 2841
218 Ga0207652_10091036 3300025921 Bacteria 2681
219 Ga0207652_10264969 3300025921 Bacteria 1550
220 Ga0207694_10000011 3300025924 Bacteria 417640
221 Ga0207694_10155726 3300025924 Bacteria 1843
222 Ga0207694_10195233 3300025924 Bacteria 1646
223 Ga0207650_10190956 3300025925 Bacteria 1637
224 Ga0207687_10098775 3300025927 Bacteria 2144
225 Ga0207687_10312316 3300025927 Unclassified 1270
226 Ga0207687_10568163 3300025927 Bacteria 953
227 Ga0207700_10078528 3300025928 Bacteria 2568
228 Ga0207644_10210711 3300025931 Bacteria 1536
229 Ga0207706_10134830 3300025933 Unclassified 2172
230 Ga0207686_10021121 3300025934 Unclassified 3731
231 Ga0207709_10086528 3300025935 Bacteria 2035
232 Ga0207711_10000002 3300025941 Bacteria 1228676
233 Ga0207711_10079049 3300025941 Bacteria 2870
234 Ga0207711_10270410 3300025941 Bacteria 1563
235 Ga0207689_10043642 3300025942 Bacteria 3707
236 Ga0207689_10060613 3300025942 Bacteria 3111
237 Ga0207689_10071371 3300025942 Bacteria 2852
238 Ga0207661_10361063 3300025944 Unclassified 1312
239 Ga0207679_10214643 3300025945 Bacteria 1616
240 Ga0207667_10000093 3300025949 Bacteria 145814
241 Ga0207667_10052480 3300025949 Bacteria 4294
242 Ga0207667_10092004 3300025949 Bacteria 3133
243 Ga0207667_10265675 3300025949 Bacteria 1754
244 Ga0207712_10066588 3300025961 Bacteria 2575
245 Ga0207658_10015559 3300025986 Bacteria 5219
246 Ga0207658_10054660 3300025986 Bacteria 2955
247 Ga0207658_10056216 3300025986 Bacteria 2919
248 Ga0207677_10019049 3300026023 Unclassified 4135
249 Ga0207677_10281252 3300026023 Bacteria 1366
250 Ga0207677_10372003 3300026023 Bacteria 1203
251 Ga0207703_10055490 3300026035 Unclassified 3223
252 Ga0207703_10136947 3300026035 Bacteria 2120
253 Ga0207639_10010896 3300026041 Bacteria 6305
254 Ga0207639_10026761 3300026041 Bacteria 4193
255 Ga0207639_10251515 3300026041 Bacteria 1541
256 Ga0207641_10020165 3300026088 Bacteria 5473
257 Ga0207641_10065592 3300026088 Bacteria 3106
258 Ga0207648_10010697 3300026089 Bacteria 8672
259 Ga0207648_10122728 3300026089 Bacteria 2284
260 Ga0207676_10070593 3300026095 Bacteria 2801
261 Ga0207674_10105482 3300026116 Bacteria 2796
262 Ga0207674_10424121 3300026116 Unclassified 1285
263 Ga0207675_100182889 3300026118 Bacteria 2008
264 Ga0207683_10012094 3300026121 Bacteria 7366
265 Ga0207683_10047613 3300026121 Bacteria 3755
266 Ga0207683_10280156 3300026121 Bacteria 1524
267 Ga0207698_10002935 3300026142 Bacteria 10197
268 Ga0268266_10004374 3300028379 Bacteria 13565
269 Ga0268266_10004626 3300028379 Bacteria 13123
270 Ga0268266_10032159 3300028379 Bacteria 4457
271 Ga0268266_10382226 3300028379 Bacteria 1328
272 Ga0268265_10072493 3300028380 Bacteria 2687
273 Ga0268264_10224027 3300028381 Bacteria 1733
274 Ga0265334_10001027 3300028573 Bacteria 13760
275 Ga0265334_10008058 3300028573 Bacteria 4496
276 Ga0265338_10000014 3300028800 Bacteria 378751
277 Ga0265338_10003602 3300028800 Bacteria 21622
278 Ga0265338_10021187 3300028800 Bacteria 6790
279 Ga0265338_10142079 3300028800 Bacteria 1879
280 Ga0265324_10056615 3300029957 Bacteria 1343
281 Ga0265332_10052915 3300031238 Bacteria 1743
282 Ga0265332_10099233 3300031238 Bacteria 1229
283 Ga0265332_10165601 3300031238 Bacteria 923
284 Ga0265328_10036067 3300031239 Bacteria 1827
285 Ga0265325_10000001 3300031241 Bacteria 726814
286 Ga0265329_10045976 3300031242 Bacteria 1395
287 Ga0265340_10001172 3300031247 Bacteria 15004
288 Ga0265339_10000941 3300031249 Bacteria 22348
289 Ga0265339_10018579 3300031249 Bacteria 4094
290 Ga0265331_10001093 3300031250 Bacteria 20883
291 Ga0265331_10065078 3300031250 Bacteria 1715
292 Ga0265331_10113102 3300031250 Bacteria 1244
293 Ga0265327_10000365 3300031251 Bacteria 86000
294 Ga0265316_10271413 3300031344 Bacteria 1241
295 Ga0265316_10354507 3300031344 Bacteria 1062
296 Ga0307513_10205817 3300031456 Bacteria 1804
297 Ga0265313_10000660 3300031595 Bacteria 35564
298 Ga0265313_10007050 3300031595 Bacteria 7777
299 Ga0265313_10009639 3300031595 Bacteria 6240
300 Ga0265314_10005627 3300031711 Bacteria 11255
301 Ga0265314_10038179 3300031711 Bacteria 3473
302 Ga0265314_10059506 3300031711 Bacteria 2613
303 Ga0265314_10067857 3300031711 Bacteria 2400
304 Ga0265314_10131459 3300031711 Bacteria 1561
305 Ga0265342_10129748 3300031712 Unclassified 1413
306 Ga0307516_10009774 3300031730 Bacteria 10642
307 Ga0307516_10016615 3300031730 Bacteria 7691
308 Ga0307516_10344351 3300031730 Bacteria 1157
309 Ga0307414_10190335 3300032004 Bacteria 1659
310 Ga0307414_10260435 3300032004 Bacteria 1447
311 Ga0307414_10262350 3300032004 Bacteria 1442
312 Ga0307411_10127308 3300032005 Bacteria 1855
313 Ga0373926_0071191 3300035083 Bacteria 1278
314 Ga0373940_0006817 3300035088 Bacteria 2554
315 Ga0373923_0042153 3300035111 Unclassified 1884
316 Ga0373956_0023955 3300035119 Bacteria 2625
317 Ga0373924_0241608 3300035410 Unclassified 799
318 Ga0373931_0079270 3300035691 Unclassified 1809
319 Ga0373933_0136746 3300035724 Unclassified 1544
320 Ga0373937_0075606 3300036401 Bacteria 3110
321 Ga0373937_0197195 3300036401 Unclassified 1892
322 Ga0373937_0215550 3300036401 Bacteria 1807
323 Ga0395899_0099216 3300037312 Bacteria 2104
324 Ga0395900_0095982 3300037418 Bacteria 3046
325 Ga0395898_0005472 3300037466 Bacteria 13720
326 Ga0436364_0284869 3300037853 Bacteria 1233
327 Ga0436364_0540739 3300037853 Bacteria 1003
328 Ga0436364_0940060 3300037853 Bacteria 2245
329 Ga0395901_0009138 3300038443 Bacteria 10038
330 Ga0395901_0049255 3300038443 Bacteria 4377
331 Ga0436365_0219856 3300039437 Bacteria 1556
332 Ga0436365_1093582 3300039437 Bacteria 8078
333 Ga0436365_1372603 3300039437 Bacteria 2292
334 Ga0436360_0185446 3300039438 Bacteria 3060
335 Ga0436360_0697891 3300039438 Bacteria 1354
336 Ga0436363_0133426 3300039450 Bacteria 5530
337 Ga0453684_0015381 3300044712 Bacteria 12111
338 Ga0466959_0137735 3300045049 Bacteria 1727
339 Ga0451576_0000209 3300045051 Bacteria 147227
340 Ga0466967_0184763 3300045976 Bacteria 1968
341 Ga0495606_0250651 3300046507 Bacteria 982
342 Ga0495642_0022385 3300046528 Bacteria 2490
343 Ga0495654_0152437 3300046530 Bacteria 1021
344 Ga0495622_0005156 3300046557 Bacteria 6060
345 Ga0495622_0006284 3300046557 Bacteria 5516
346 Ga0495611_0186493 3300046648 Bacteria 968
347 Ga0495661_0113885 3300046665 Bacteria 1504
348 Ga0495657_0006296 3300046675 Bacteria 9298
349 Ga0495658_0061515 3300046683 Bacteria 2156
350 Ga0495670_0109414 3300046691 Bacteria 1429
351 Ga0495675_0152288 3300047444 Bacteria 1428
352 Ga0495684_0034910 3300047471 Bacteria 3858
353 Ga0495602_0066681 3300048088 Unclassified 3100
354 Ga0496108_0008434 3300048911 Bacteria 8359
355 Ga0496111_0037367 3300048914 Bacteria 3475
356 Ga0496122_0203484 3300048925 Bacteria 1155
357 Ga0496125_0000217 3300048928 Bacteria 117498
358 Ga0496126_0097213 3300048929 Bacteria 2581
359 Ga0496126_0182783 3300048929 Bacteria 1780
360 Ga0495682_0033419 3300049460 Bacteria 1898
361 Ga0501031_0001115 3300049568 Bacteria 16394
362 Ga0501032_0001583 3300049569 Bacteria 18137
363 Ga0501032_0025446 3300049569 Bacteria 4080
364 Ga0501033_0003945 3300049570 Bacteria 12027
365 Ga0501033_0018570 3300049570 Bacteria 5255
366 Ga0501033_0038593 3300049570 Bacteria 3569
367 Ga0501033_0044543 3300049570 Bacteria 3303
368 Ga0501033_0078303 3300049570 Bacteria 2426
369 Ga0501033_0084225 3300049570 Bacteria 2330
370 Ga0501034_0001102 3300049571 Bacteria 37998
371 Ga0501034_0004847 3300049571 Bacteria 14856
372 Ga0501034_0094110 3300049571 Bacteria 2993
373 Ga0501034_0216059 3300049571 Bacteria 1871
374 Ga0501034_0224917 3300049571 Bacteria 1828
375 Ga0501036_0006677 3300049572 Bacteria 9377
376 Ga0501036_0212356 3300049572 Unclassified 1626
377 Ga0501037_0020887 3300049573 Bacteria 4834
378 Ga0501037_0056341 3300049573 Bacteria 2871
379 Ga0501037_0058329 3300049573 Bacteria 2817
380 Ga0501037_0216790 3300049573 Bacteria 1348
381 Ga0501038_0011078 3300049574 Bacteria 8234
382 Ga0501038_0028541 3300049574 Bacteria 4957
383 Ga0501038_0281856 3300049574 Bacteria 1308
384 Ga0501039_0002480 3300049575 Bacteria 13740
385 Ga0501042_0010670 3300049578 Bacteria 6173
386 Ga0501042_0023797 3300049578 Bacteria 4290
387 Ga0501043_0037752 3300049579 Bacteria 3799
388 Ga0501043_0073355 3300049579 Bacteria 2688
389 Ga0501046_0039490 3300049580 Bacteria 3779
390 Ga0501046_0048572 3300049580 Bacteria 3360
391 Ga0501047_0009499 3300049581 Bacteria 9190
392 Ga0501047_0049719 3300049581 Bacteria 4047
393 Ga0501047_0077962 3300049581 Bacteria 3186
394 Ga0501047_0184767 3300049581 Bacteria 1950
395 Ga0501067_0001187 3300049583 Bacteria 14142
396 Ga0501067_0011104 3300049583 Bacteria 4983
397 Ga0501070_0012654 3300049586 Bacteria 7115
398 Ga0501070_0023578 3300049586 Bacteria 5156
399 Ga0501070_0176077 3300049586 Bacteria 1761
400 Ga0501070_0205860 3300049586 Bacteria 1615
401 Ga0501073_0009949 3300049589 Bacteria 6996
402 Ga0501073_0053517 3300049589 Bacteria 2825
403 Ga0501074_0001610 3300049590 Bacteria 15287
404 Ga0501079_0006955 3300049741 Bacteria 8528
405 Ga0501079_0028285 3300049741 Bacteria 4301
406 Ga0501080_0007694 3300049742 Bacteria 9737
407 Ga0501080_0020002 3300049742 Bacteria 6196
408 Ga0501080_0043541 3300049742 Bacteria 4180
409 Ga0501080_0353149 3300049742 Bacteria 1327
410 Ga0501083_0028788 3300049744 Bacteria 3827
411 Ga0501083_0067576 3300049744 Bacteria 2379
412 Ga0501035_0013193 3300049822 Bacteria 7627
413 Ga0501035_0013598 3300049822 Bacteria 7509
414 Ga0501035_0021943 3300049822 Bacteria 5866
415 Ga0501035_0025262 3300049822 Bacteria 5446
416 Ga0501035_0136818 3300049822 Bacteria 2132
417 Ga0501044_0008949 3300049823 Bacteria 10943
418 Ga0501044_0016248 3300049823 Bacteria 7999
419 Ga0501044_0030317 3300049823 Bacteria 5702
420 Ga0501044_0037395 3300049823 Bacteria 5074
421 Ga0501044_0045074 3300049823 Bacteria 4573
422 Ga0501044_0137887 3300049823 Bacteria 2429
423 Ga0501044_0148269 3300049823 Bacteria 2329
424 Ga0501045_0057130 3300049824 Bacteria 2855
425 Ga0500643_000014 3300053087 Bacteria 318249
426 Ga0500593_081434 3300053117 Bacteria 1387
427 Ga0500595_000522 3300053119 Bacteria 23191
428 Ga0500595_001419 3300053119 Bacteria 12865
429 Ga0500595_019831 3300053119 Bacteria 2433
430 Ga0500559_0147812 3300053136 Bacteria 1102
431 Ga0500573_0000004 3300053140 Bacteria 341236
432 Ga0500604_0001151 3300053151 Bacteria 7350
433 Ga0500624_003576 3300053157 Bacteria 2035
434 Ga0500634_0000212 3300053161 Bacteria 18816
435 Ga0500637_0023041 3300053178 Bacteria 3399
436 Ga0501084_0022425 3300054114 Bacteria 5269
437 Ga0501084_0030089 3300054114 Bacteria 4541
438 Ga0587111_0001483 3300060346 Bacteria 2835
439 Ga0501082_0011874 3300060353 Bacteria 7485
440 Ga0501082_0012021 3300060353 Bacteria 7444
441 Ga0501082_0078959 3300060353 Bacteria 2839
442 Ga0501082_0086407 3300060353 Bacteria 2705
443 2512036551 2511231221 Bacteria 6846400
444 2523102935 2522572158 Bacteria 6514390
445 2599106272 2597490356 Bacteria 7030811
446 2643912426 2643221580 Bacteria 3816678
447 2643963219 2643221591 Bacteria 4397626
448 2644410746 2643221674 Bacteria 3919126
449 2842700252 2842698319 Bacteria 5190321
450 2846956070 2846952575 Bacteria 6587527
451 2848861702 2848858292 Bacteria 7391279
452 2897805598 2897803580 Bacteria 7000062
453 2932403485 2932401849 Bacteria 4262978
454 8054008411 8054002106 Bacteria 7987183
455 Ga0495672_0151786
456 JGI25165J46597_1000425
457 JGI25153J46596_10000552
458 Ga0065704_10234698
459 Ga0070658_10002834
460 Ga0070658_10139089
461 Ga0070658_10193219
462 Ga0070658_10363285
463 Ga0070658_10381820
464 Ga0070676_10156414
465 Ga0070683_100091758
466 Ga0070690_100026903
467 Ga0070670_100268896
468 Ga0068869_100035401
469 Ga0068869_100431899
470 Ga0070666_10004425
471 Ga0070666_10006985
472 Ga0070666_10059351
473 Ga0070680_100002345
474 Ga0068868_100019123
475 Ga0068868_100145697
476 Ga0070660_100034520
477 Ga0070660_100246891
478 Ga0070660_100297879
479 Ga0070689_100288386
480 Ga0070661_100000415
481 Ga0070661_100237408
482 Ga0070669_100258740
483 Ga0070675_100290453
484 Ga0070688_100014230
485 Ga0070659_100196990
486 Ga0070667_100008047
487 Ga0070667_100023261
488 Ga0070667_100225017
489 Ga0070678_100024532
490 Ga0070678_100093622
491 Ga0070678_100268425
492 Ga0070662_100083826
493 Ga0070681_10000001
494 Ga0070681_10073488
495 Ga0070681_10391393
496 Ga0070681_10544775
497 Ga0068867_100004232
498 Ga0068867_100069625
499 Ga0070699_100346877
500 Ga0070679_100000096
501 Ga0070679_100006337
502 Ga0070679_100070061
503 Ga0070679_100316072
504 Ga0070679_100430262
505 Ga0070679_100589815
506 Ga0070684_100098543
507 Ga0070684_100195111
508 Ga0068853_100060241
509 Ga0068853_100082395
510 Ga0068853_100170180
511 Ga0070695_100233287
512 Ga0070693_100168467
513 Ga0070665_100002027
514 Ga0070665_100004584
515 Ga0070665_100042507
516 Ga0070665_100067189
517 Ga0070665_100092073
518 Ga0070665_100207277
519 Ga0070665_100377787
520 Ga0068855_100201456
521 Ga0068855_100251188
522 Ga0068855_100332287
523 Ga0070664_100317947
524 Ga0068857_100045453
525 Ga0068856_100142061
526 Ga0068856_100271852
527 Ga0068856_100327470
528 Ga0068852_100015405
529 Ga0068852_100118787
530 Ga0068852_100246059
531 Ga0068859_100057770
532 Ga0068859_100113930
533 Ga0068851_10084228
534 Ga0068863_100026142
535 Ga0068863_100074099
536 Ga0068858_100059973
537 Ga0068858_100315325
538 Ga0068860_100032511
539 Ga0068860_100202656
540 Ga0068860_100277251
541 Ga0068862_100093360
542 Ga0068862_100306383
543 Ga0081539_10003744
544 Ga0070712_100049256
545 Ga0097621_100000693
546 Ga0097621_100051066
547 Ga0097621_100324351
548 Ga0068871_100000385
549 Ga0068871_100017481
550 Ga0068871_100112013
551 Ga0068871_100187769
552 Ga0068871_100246354
553 Ga0068871_100369142
554 Ga0068865_100019735
555 Ga0068865_100049141
556 Ga0097620_100057772
557 Ga0097620_100113925
558 Ga0105240_10000189
559 Ga0105240_10022178
560 Ga0105240_10040506
561 Ga0105240_10047424
562 Ga0105240_10064693
563 Ga0105240_10200393
564 Ga0105240_10215857
565 Ga0105240_10300617
566 Ga0105240_10324358
567 Ga0105240_10376010
568 Ga0105245_10036515
569 Ga0105245_10115751
570 Ga0105245_10188189
571 Ga0105245_10451638
572 Ga0105243_10050578
573 Ga0105243_10211188
574 Ga0105241_10016603
575 Ga0105241_10073163
576 Ga0105241_10106541
577 Ga0105242_10002477
578 Ga0105242_10004737
579 Ga0105242_10064993
580 Ga0105248_10000001
581 Ga0105248_10030640
582 Ga0105248_10092485
583 Ga0105237_10044071
584 Ga0105237_10087383
585 Ga0105237_10143878
586 Ga0105237_10200544
587 Ga0105237_10233619
588 Ga0105237_10344348
589 Ga0105237_10480194
590 Ga0105238_10051825
591 Ga0105238_10060499
592 Ga0105238_10124164
593 Ga0105238_10126559
594 Ga0105238_10180964
595 Ga0105238_10181116
596 Ga0105238_10234543
597 Ga0105238_10258623
598 Ga0105238_10262774
599 Ga0105249_10003440
600 Ga0105249_10137287
601 Ga0105249_10197808
602 Ga0105239_10007355
603 Ga0105239_10021044
604 Ga0105239_10076188
605 Ga0105246_10004555
606 Ga0105246_10016138
607 Ga0157370_10032355
608 Ga0157370_10043367
609 Ga0157370_10063278
610 Ga0157370_10284578
611 Ga0157369_10054498
612 Ga0157369_10239529
613 Ga0157369_10313354
614 Ga0157374_10009118
615 Ga0157374_10055681
616 Ga0157378_10017840
617 Ga0157378_10039888
618 Ga0157378_10043102
619 Ga0157378_10107892
620 Ga0157372_10296708
621 Ga0157372_10805973
622 Ga0157375_10022429
623 Ga0157375_10364595
624 Ga0163163_10000007
625 Ga0163163_10039975
626 Ga0163163_10108259
627 Ga0163163_10135522
628 Ga0157379_10001375
629 Ga0157379_10429018
630 Ga0157376_10390137
631 Ga0163161_10003454
632 Ga0213876_10055206
633 Ga0213876_10166735
634 Ga0213875_10220188
635 Ga0209233_1000013
636 Ga0209233_1004067
637 Ga0209675_1000873
638 Ga0209758_1000036
639 Ga0209257_1007643
640 Ga0207642_10057097
641 Ga0207688_10057611
642 Ga0207680_10018406
643 Ga0207680_10063774
644 Ga0207645_10115778
645 Ga0207643_10175676
646 Ga0207654_10115617
647 Ga0207654_10147452
648 Ga0207707_10000001
649 Ga0207707_10378702
650 Ga0207695_10000003
651 Ga0207695_10006268
652 Ga0207695_10033816
653 Ga0207695_10061684
654 Ga0207695_10067671
655 Ga0207695_10126800
656 Ga0207695_10165009
657 Ga0207695_10189392
658 Ga0207695_10239190
659 Ga0207695_10439860
660 Ga0207671_10010097
661 Ga0207671_10225315
662 Ga0207671_10278016
663 Ga0207660_10001894
664 Ga0207657_10272903
665 Ga0207657_10294758
666 Ga0207649_10000448
667 Ga0207649_10166564
668 Ga0207652_10000815
669 Ga0207652_10011116
670 Ga0207652_10063640
671 Ga0207652_10080918
672 Ga0207652_10091036
673 Ga0207652_10264969
674 Ga0207694_10000011
675 Ga0207694_10155726
676 Ga0207694_10195233
677 Ga0207650_10190956
678 Ga0207687_10098775
679 Ga0207687_10312316
680 Ga0207687_10568163
681 Ga0207700_10078528
682 Ga0207644_10210711
683 Ga0207706_10134830
684 Ga0207686_10021121
685 Ga0207709_10086528
686 Ga0207711_10000002
687 Ga0207711_10079049
688 Ga0207711_10270410
689 Ga0207689_10043642
690 Ga0207689_10060613
691 Ga0207689_10071371
692 Ga0207661_10361063
693 Ga0207679_10214643
694 Ga0207667_10000093
695 Ga0207667_10052480
696 Ga0207667_10092004
697 Ga0207667_10265675
698 Ga0207712_10066588
699 Ga0207658_10015559
700 Ga0207658_10054660
701 Ga0207658_10056216
702 Ga0207677_10019049
703 Ga0207677_10281252
704 Ga0207677_10372003
705 Ga0207703_10055490
706 Ga0207703_10136947
707 Ga0207639_10010896
708 Ga0207639_10026761
709 Ga0207639_10251515
710 Ga0207641_10020165
711 Ga0207641_10065592
712 Ga0207648_10010697
713 Ga0207648_10122728
714 Ga0207676_10070593
715 Ga0207674_10105482
716 Ga0207674_10424121
717 Ga0207675_100182889
718 Ga0207683_10012094
719 Ga0207683_10047613
720 Ga0207683_10280156
721 Ga0207698_10002935
722 Ga0268266_10004374
723 Ga0268266_10004626
724 Ga0268266_10032159
725 Ga0268266_10382226
726 Ga0268265_10072493
727 Ga0268264_10224027
728 Ga0265334_10001027
729 Ga0265334_10008058
730 Ga0265338_10000014
731 Ga0265338_10003602
732 Ga0265338_10021187
733 Ga0265338_10142079
734 Ga0265324_10056615
735 Ga0265332_10052915
736 Ga0265332_10099233
737 Ga0265332_10165601
738 Ga0265328_10036067
739 Ga0265325_10000001
740 Ga0265329_10045976
741 Ga0265340_10001172
742 Ga0265339_10000941
743 Ga0265339_10018579
744 Ga0265331_10001093
745 Ga0265331_10065078
746 Ga0265331_10113102
747 Ga0265327_10000365
748 Ga0265316_10271413
749 Ga0265316_10354507
750 Ga0307513_10205817
751 Ga0265313_10000660
752 Ga0265313_10007050
753 Ga0265313_10009639
754 Ga0265314_10005627
755 Ga0265314_10038179
756 Ga0265314_10059506
757 Ga0265314_10067857
758 Ga0265314_10131459
759 Ga0265342_10129748
760 Ga0307516_10009774
761 Ga0307516_10016615
762 Ga0307516_10344351
763 Ga0307414_10190335
764 Ga0307414_10260435
765 Ga0307414_10262350
766 Ga0307411_10127308
767 Ga0373926_0071191
768 Ga0373940_0006817
769 Ga0373923_0042153
770 Ga0373956_0023955
771 Ga0373924_0241608
772 Ga0373931_0079270
773 Ga0373933_0136746
774 Ga0373937_0075606
775 Ga0373937_0197195
776 Ga0373937_0215550
777 Ga0395899_0099216
778 Ga0395900_0095982
779 Ga0395898_0005472
780 Ga0436364_0284869
781 Ga0436364_0540739
782 Ga0436364_0940060
783 Ga0395901_0009138
784 Ga0395901_0049255
785 Ga0436365_0219856
786 Ga0436365_1093582
787 Ga0436365_1372603
788 Ga0436360_0185446
789 Ga0436360_0697891
790 Ga0436363_0133426
791 Ga0453684_0015381
792 Ga0466959_0137735
793 Ga0451576_0000209
794 Ga0466967_0184763
795 Ga0495606_0250651
796 Ga0495642_0022385
797 Ga0495654_0152437
798 Ga0495622_0005156
799 Ga0495622_0006284
800 Ga0495611_0186493
801 Ga0495661_0113885
802 Ga0495657_0006296
803 Ga0495658_0061515
804 Ga0495670_0109414
805 Ga0495675_0152288
806 Ga0495684_0034910
807 Ga0495602_0066681
808 Ga0496108_0008434
809 Ga0496111_0037367
810 Ga0496122_0203484
811 Ga0496125_0000217
812 Ga0496126_0097213
813 Ga0496126_0182783
814 Ga0495682_0033419
815 Ga0501031_0001115
816 Ga0501032_0001583
817 Ga0501032_0025446
818 Ga0501033_0003945
819 Ga0501033_0018570
820 Ga0501033_0038593
821 Ga0501033_0044543
822 Ga0501033_0078303
823 Ga0501033_0084225
824 Ga0501034_0001102
825 Ga0501034_0004847
826 Ga0501034_0094110
827 Ga0501034_0216059
828 Ga0501034_0224917
829 Ga0501036_0006677
830 Ga0501036_0212356
831 Ga0501037_0020887
832 Ga0501037_0056341
833 Ga0501037_0058329
834 Ga0501037_0216790
835 Ga0501038_0011078
836 Ga0501038_0028541
837 Ga0501038_0281856
838 Ga0501039_0002480
839 Ga0501042_0010670
840 Ga0501042_0023797
841 Ga0501043_0037752
842 Ga0501043_0073355
843 Ga0501046_0039490
844 Ga0501046_0048572
845 Ga0501047_0009499
846 Ga0501047_0049719
847 Ga0501047_0077962
848 Ga0501047_0184767
849 Ga0501067_0001187
850 Ga0501067_0011104
851 Ga0501070_0012654
852 Ga0501070_0023578
853 Ga0501070_0176077
854 Ga0501070_0205860
855 Ga0501073_0009949
856 Ga0501073_0053517
857 Ga0501074_0001610
858 Ga0501079_0006955
859 Ga0501079_0028285
860 Ga0501080_0007694
861 Ga0501080_0020002
862 Ga0501080_0043541
863 Ga0501080_0353149
864 Ga0501083_0028788
865 Ga0501083_0067576
866 Ga0501035_0013193
867 Ga0501035_0013598
868 Ga0501035_0021943
869 Ga0501035_0025262
870 Ga0501035_0136818
871 Ga0501044_0008949
872 Ga0501044_0016248
873 Ga0501044_0030317
874 Ga0501044_0037395
875 Ga0501044_0045074
876 Ga0501044_0137887
877 Ga0501044_0148269
878 Ga0501045_0057130
879 Ga0500643_000014
880 Ga0500593_081434
881 Ga0500595_000522
882 Ga0500595_001419
883 Ga0500595_019831
884 Ga0500559_0147812
885 Ga0500573_0000004
886 Ga0500604_0001151
887 Ga0500624_003576
888 Ga0500634_0000212
889 Ga0500637_0023041
890 Ga0501084_0022425
891 Ga0501084_0030089
892 Ga0587111_0001483
893 Ga0501082_0011874
894 Ga0501082_0012021
895 Ga0501082_0078959
896 Ga0501082_0086407
897 2512036551
898 2523102935
899 2599106272
900 2643912426
901 2643963219
902 2644410746
903 2842700252
904 2846956070
905 2848861702
906 2897805598
907 2932403485
908 8054008411

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00902

TatC

Sec-independent protein translocase protein (TatC)

32

250

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4htt-assembly2.cif.gz_B crystal structure of twin arginine translocase receptor- tatc in ddm 0.8091 22 231
4hts-assembly1.cif.gz_A crystal structure of twin arginine translocase receptor- tatc 0.7664 12 237
4htt-assembly2.cif.gz_B crystal structure of twin arginine translocase receptor- tatc in ddm 0.755 22 231
4hts-assembly1.cif.gz_A crystal structure of twin arginine translocase receptor- tatc 0.7541 12 237
4uiq-assembly2.cif.gz_A isolated globin domain of the bordetella pertussis globin-coupled sensor with a heme at the dimer interface 0.3654 83 233
ID Description Score Start End Superfamily
af_A4I3B9_9_100_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5991 155 244 1.20.1280.290
af_A4I3B9_9_100_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.5737 155 244 1.20.1280.290
af_Q8C6U2_90_202_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.4775 123 243 1.20.1280.290
af_Q8C6U2_90_202_1.20.1280.290 Mainly Alpha;Up-down Bundle;Monooxygenase; 0.461 123 243 1.20.1280.290
af_P0AG90_434_612_1.20.1640.10 Mainly Alpha;Up-down Bundle;Multidrug efflux transporter AcrB transmembrane fold;Multidrug efflux transporter AcrB transmembrane domain 0.46 66 238 1.20.1640.10
ID Description Score Start End GO Terms
AF-A0A530C768-F1-model_v4 Twin-arginine translocase subunit TatC 0.9551 54 254 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A090X5C8-F1-model_v4 Twin-arginine translocation protein TatC 0.954 145 243 GO:0009977
GO:0033281
GO:0043953
GO:0051920
GO:0065002
AF-A0A2M7GVC1-F1-model_v4 Twin-arginine translocase subunit TatC 0.9516 24 245 GO:0009977
GO:0033281
GO:0043953
GO:0065002
AF-A0A354TYP4-F1-model_v4 deleted 0.9471 30 250
AF-A0A526QDY1-F1-model_v4 Twin-arginine translocase subunit TatC 0.9469 54 229 GO:0009977
GO:0033281
GO:0043953
GO:0065002

Map