F447467

General Info

Members Datasets Scaffolds Average Seq Length
454 274 442 80

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_8291_c1|nmdc:mga00v17_8291_c1_3661_3906
Length 81
Sequence MPVVVTLDSMLAERRLTAKELGRRIGLSETQLSLLRTGKVRGMRFSTLAALCAVLECTPGDLLGYELDAADASHTHGMGQS

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
3 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
4 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
5 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
6 2643221583 Caulobacter sp. Root655 Isolate Unclassified
7 2643221584 Caulobacter sp. Root656 Isolate Unclassified
8 2643221640 Caulobacter sp. Root342 Isolate Unclassified
9 2643221642 Caulobacter sp. Root343 Isolate Unclassified
10 2818991435 Caulobacter henricii 536 Isolate Unclassified
11 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
12 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
13 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
14 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
15 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
26 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
85 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
89 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
90 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
131 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
132 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
133 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
135 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
136 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
137 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
138 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
139 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
140 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
154 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
155 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
156 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
159 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
160 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
161 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
162 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
163 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
164 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
165 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
166 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
167 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
170 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
175 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
176 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
177 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
178 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
179 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
180 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
181 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
182 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
186 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
187 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
188 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
189 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
190 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
191 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
194 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
198 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
203 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
204 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
205 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
209 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
210 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
211 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
217 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
218 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
225 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
226 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
227 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
228 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
238 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
239 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
240 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
241 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
248 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
249 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
250 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
251 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
252 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
253 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
254 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
255 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
256 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
257 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
258 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
259 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
260 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
261 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
262 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
263 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
264 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
265 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
266 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
267 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
270 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
271 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
272 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
273 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
274 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 0.22
Isolates 2.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 19.82
Nodule 0
Rhizoplane 5.07
Rhizosphere 68.28
Stem 0
Stem Tuber 0
Unclassified 6.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10054462 3300003215 Bacteria 1126
2 rootH1_10086563 3300003316 Bacteria 1124
3 rootH2_10196150 3300003320 Unclassified 1027
4 rootL2_10153064 3300003322 Bacteria 1158
5 rootL2_10164339 3300003322 Bacteria 1274
6 rootH1_10087495 3300003323 Unclassified 3896
7 Ga0055526_1030707 3300003771 Bacteria 1560
8 Ga0055537_1003999 3300003773 Bacteria 4344
9 Ga0055537_1004006 3300003773 Bacteria 4337
10 Ga0055537_1004009 3300003773 Bacteria 4336
11 Ga0055524_1012548 3300003775 Bacteria 3246
12 Ga0055524_1013082 3300003775 Bacteria 3150
13 Ga0055528_1006543 3300003790 Bacteria 5277
14 Ga0055530_10006758 3300003791 Bacteria 5008
15 Ga0055530_10016431 3300003791 Bacteria 2364
16 Ga0055530_10096868 3300003791 Bacteria 597
17 Ga0055540_1054815 3300003792 Bacteria 812
18 Ga0055531_10006115 3300003794 Bacteria 6892
19 Ga0055531_10006160 3300003794 Bacteria 6860
20 Ga0065165_1001046 3300005262 Bacteria 33350
21 Ga0070658_10207943 3300005327 Bacteria 1653
22 Ga0070670_100128308 3300005331 Bacteria 2189
23 Ga0070680_100078532 3300005336 Bacteria 2719
24 Ga0068868_100467610 3300005338 Bacteria 1099
25 Ga0070660_100020517 3300005339 Bacteria 4857
26 Ga0070660_100828498 3300005339 Bacteria 779
27 Ga0070660_101868369 3300005339 Bacteria 512
28 Ga0070691_10049052 3300005341 Bacteria 2010
29 Ga0070661_100409132 3300005344 Bacteria 1074
30 Ga0070671_100033424 3300005355 Bacteria 4253
31 Ga0070671_100097820 3300005355 Bacteria 2461
32 Ga0070688_100621285 3300005365 Bacteria 829
33 Ga0070659_100002791 3300005366 Bacteria 12431
34 Ga0070713_100566557 3300005436 Unclassified 1077
35 Ga0070713_101629055 3300005436 Bacteria 626
36 Ga0070710_10241981 3300005437 Bacteria 1156
37 Ga0070662_100112144 3300005457 Bacteria 2079
38 Ga0070681_10214174 3300005458 Bacteria 1843
39 Ga0068867_100077759 3300005459 Bacteria 2494
40 Ga0070679_100481216 3300005530 Bacteria 1186
41 Ga0070679_100554289 3300005530 Bacteria 1093
42 Ga0070679_101191749 3300005530 Bacteria 707
43 Ga0070679_101198229 3300005530 Bacteria 705
44 Ga0068853_100005921 3300005539 Bacteria 9651
45 Ga0068853_101177242 3300005539 Bacteria 740
46 Ga0070665_100000116 3300005548 Bacteria 150141
47 Ga0070665_100037973 3300005548 Bacteria 4842
48 Ga0070665_100938428 3300005548 Bacteria 878
49 Ga0068855_100000170 3300005563 Bacteria 83183
50 Ga0068855_100163203 3300005563 Bacteria 2527
51 Ga0068855_100175677 3300005563 Bacteria 2424
52 Ga0068855_100251452 3300005563 Bacteria 1971
53 Ga0068855_100392759 3300005563 Bacteria 1521
54 Ga0068857_100235297 3300005577 Bacteria 1676
55 Ga0068856_101374885 3300005614 Bacteria 721
56 Ga0068852_100484967 3300005616 Bacteria 1229
57 Ga0068864_100007465 3300005618 Bacteria 9005
58 Ga0068863_100113944 3300005841 Bacteria 2576
59 Ga0068863_100426867 3300005841 Bacteria 1299
60 Ga0068860_102785548 3300005843 Bacteria 507
61 Ga0070717_10122089 3300006028 Bacteria 2233
62 Ga0070717_10353992 3300006028 Bacteria 1313
63 Ga0075365_10031646 3300006038 Bacteria 3395
64 Ga0075364_10034351 3300006051 Bacteria 3270
65 Ga0070715_10924954 3300006163 Bacteria 538
66 Ga0070712_101103267 3300006175 Bacteria 689
67 Ga0075362_10444924 3300006177 Bacteria 658
68 Ga0075367_10012025 3300006178 Bacteria 4598
69 Ga0075366_10169211 3300006195 Bacteria 1326
70 Ga0075366_10784260 3300006195 Bacteria 593
71 Ga0097621_100167662 3300006237 Bacteria 1891
72 Ga0097621_100282152 3300006237 Bacteria 1462
73 Ga0097621_101013846 3300006237 Bacteria 777
74 Ga0075370_10076916 3300006353 Bacteria 1915
75 Ga0075370_10913510 3300006353 Bacteria 537
76 Ga0068871_101709177 3300006358 Bacteria 597
77 Ga0075430_100707365 3300006846 Bacteria 830
78 Ga0075431_100404601 3300006847 Bacteria 1366
79 Ga0075429_100480361 3300006880 Bacteria 1089
80 Ga0105240_10010558 3300009093 Bacteria 12971
81 Ga0105240_10054523 3300009093 Bacteria 5010
82 Ga0105240_10488383 3300009093 Bacteria 1371
83 Ga0105240_10627727 3300009093 Bacteria 1180
84 Ga0105240_11028842 3300009093 Bacteria 880
85 Ga0105245_12429945 3300009098 Bacteria 577
86 Ga0105241_10219824 3300009174 Unclassified 1596
87 Ga0105241_12504828 3300009174 Bacteria 517
88 Ga0105242_10292381 3300009176 Bacteria 1484
89 Ga0105248_10000438 3300009177 Bacteria 47263
90 Ga0105248_10106271 3300009177 Bacteria 3165
91 Ga0105248_12024643 3300009177 Unclassified 654
92 Ga0105248_12973948 3300009177 Bacteria 540
93 Ga0105237_10141244 3300009545 Bacteria 2402
94 Ga0105237_10172906 3300009545 Bacteria 2160
95 Ga0105237_10355346 3300009545 Unclassified 1470
96 Ga0105237_12492826 3300009545 Bacteria 528
97 Ga0105237_12743270 3300009545 Bacteria 504
98 Ga0105238_10024507 3300009551 Bacteria 6149
99 Ga0105238_10098910 3300009551 Bacteria 2901
100 Ga0105238_11269331 3300009551 Bacteria 762
101 Ga0105238_11963785 3300009551 Bacteria 618
102 Ga0105238_12593013 3300009551 Bacteria 543
103 Ga0105239_10001120 3300010375 Bacteria 36895
104 Ga0105239_10267147 3300010375 Bacteria 1923
105 Ga0105239_10494854 3300010375 Bacteria 1390
106 Ga0105239_10671555 3300010375 Bacteria 1184
107 Ga0105239_11462528 3300010375 Bacteria 789
108 Ga0105239_11522864 3300010375 Bacteria 773
109 Ga0157327_1063108 3300012512 Bacteria 557
110 Ga0157371_11441063 3300013102 Bacteria 536
111 Ga0157369_10010655 3300013105 Bacteria 10465
112 Ga0157369_10459831 3300013105 Bacteria 1318
113 Ga0157374_10540383 3300013296 Bacteria 1172
114 Ga0163162_10113304 3300013306 Bacteria 2811
115 Ga0163162_11746380 3300013306 Unclassified 711
116 Ga0157372_10918586 3300013307 Bacteria 1015
117 Ga0157372_11269027 3300013307 Bacteria 850
118 Ga0157375_10886508 3300013308 Bacteria 1037
119 Ga0157375_11008665 3300013308 Bacteria 972
120 Ga0157375_11601615 3300013308 Bacteria 770
121 Ga0163163_10011539 3300014325 Bacteria 8023
122 Ga0163163_12742650 3300014325 Bacteria 549
123 Ga0163163_13178434 3300014325 Bacteria 512
124 Ga0157379_10363679 3300014968 Bacteria 1326
125 Ga0157376_11113460 3300014969 Bacteria 816
126 Ga0157376_11948645 3300014969 Bacteria 625
127 Ga0157376_12599710 3300014969 Bacteria 546
128 Ga0157376_12868463 3300014969 Bacteria 522
129 Ga0209148_1015146 3300025254 Bacteria 1353
130 Ga0209565_1000118 3300025263 Bacteria 113196
131 Ga0209673_1002937 3300025273 Bacteria 10727
132 Ga0209673_1020148 3300025273 Bacteria 2370
133 Ga0209675_1006728 3300025291 Bacteria 4549
134 Ga0209676_1000319 3300025292 Bacteria 93542
135 Ga0209676_1000401 3300025292 Bacteria 78968
136 Ga0209564_1002161 3300025295 Bacteria 16571
137 Ga0209564_1014148 3300025295 Bacteria 3339
138 Ga0209564_1025404 3300025295 Bacteria 1993
139 Ga0209758_1002847 3300025297 Bacteria 16797
140 Ga0209758_1003231 3300025297 Bacteria 15149
141 Ga0209050_1005474 3300025298 Bacteria 7958
142 Ga0209050_1006330 3300025298 Bacteria 7047
143 Ga0209050_1018961 3300025298 Bacteria 2644
144 Ga0209050_1032468 3300025298 Bacteria 1605
145 Ga0209256_1002765 3300025299 Bacteria 13526
146 Ga0209256_1003631 3300025299 Bacteria 10571
147 Ga0209256_1003647 3300025299 Bacteria 10542
148 Ga0209051_1004563 3300025303 Bacteria 8480
149 Ga0209257_1000506 3300025304 Bacteria 68402
150 Ga0209257_1006567 3300025304 Bacteria 7417
151 Ga0209257_1008873 3300025304 Bacteria 5551
152 Ga0209257_1111502 3300025304 Bacteria 652
153 Ga0207692_10797305 3300025898 Bacteria 617
154 Ga0207642_10547055 3300025899 Unclassified 714
155 Ga0207699_10594012 3300025906 Bacteria 806
156 Ga0207705_10083086 3300025909 Bacteria 2336
157 Ga0207705_10381030 3300025909 Bacteria 1089
158 Ga0207705_10510635 3300025909 Bacteria 934
159 Ga0207705_10589035 3300025909 Bacteria 865
160 Ga0207705_11435754 3300025909 Bacteria 524
161 Ga0207707_10518463 3300025912 Bacteria 1015
162 Ga0207707_10741383 3300025912 Bacteria 822
163 Ga0207695_10000718 3300025913 Bacteria 64451
164 Ga0207695_10001195 3300025913 Bacteria 44633
165 Ga0207695_10357489 3300025913 Bacteria 1347
166 Ga0207695_10929634 3300025913 Bacteria 749
167 Ga0207671_10615286 3300025914 Unclassified 865
168 Ga0207671_10782846 3300025914 Bacteria 757
169 Ga0207671_11117285 3300025914 Bacteria 619
170 Ga0207693_10199071 3300025915 Bacteria 1575
171 Ga0207693_11012584 3300025915 Bacteria 634
172 Ga0207660_10042635 3300025917 Bacteria 3186
173 Ga0207660_10073840 3300025917 Bacteria 2487
174 Ga0207660_11252512 3300025917 Bacteria 603
175 Ga0207657_10001137 3300025919 Bacteria 28234
176 Ga0207657_10063018 3300025919 Bacteria 3172
177 Ga0207657_10668840 3300025919 Bacteria 808
178 Ga0207652_10427049 3300025921 Bacteria 1195
179 Ga0207652_11554703 3300025921 Bacteria 566
180 Ga0207694_10014979 3300025924 Bacteria 5847
181 Ga0207694_10015440 3300025924 Bacteria 5759
182 Ga0207694_10549220 3300025924 Bacteria 969
183 Ga0207650_10154457 3300025925 Bacteria 1814
184 Ga0207700_10980811 3300025928 Bacteria 756
185 Ga0207700_11739392 3300025928 Bacteria 549
186 Ga0207690_10212337 3300025932 Bacteria 1476
187 Ga0207706_10079305 3300025933 Bacteria 2887
188 Ga0207686_10352576 3300025934 Bacteria 1108
189 Ga0207711_10001604 3300025941 Bacteria 20913
190 Ga0207711_10395649 3300025941 Bacteria 1283
191 Ga0207661_12183919 3300025944 Bacteria 500
192 Ga0207667_10000201 3300025949 Bacteria 86638
193 Ga0207667_10591250 3300025949 Bacteria 1120
194 Ga0207667_11115717 3300025949 Bacteria 771
195 Ga0207667_11163628 3300025949 Bacteria 752
196 Ga0207667_11905683 3300025949 Unclassified 556
197 Ga0207651_11614679 3300025960 Bacteria 584
198 Ga0207640_10493022 3300025981 Bacteria 1018
199 Ga0207658_10111154 3300025986 Bacteria 2167
200 Ga0207658_12114904 3300025986 Bacteria 511
201 Ga0207677_10247358 3300026023 Bacteria 1446
202 Ga0207639_10260736 3300026041 Bacteria 1516
203 Ga0207639_10581345 3300026041 Bacteria 1031
204 Ga0207702_12306385 3300026078 Bacteria 526
205 Ga0207641_10896596 3300026088 Bacteria 880
206 Ga0207641_11881228 3300026088 Bacteria 600
207 Ga0207641_12267054 3300026088 Bacteria 543
208 Ga0207648_10300911 3300026089 Bacteria 1438
209 Ga0207676_10139042 3300026095 Bacteria 2076
210 Ga0207674_10174819 3300026116 Bacteria 2100
211 Ga0207698_10659819 3300026142 Bacteria 1037
212 Ga0209371_1017343 3300027312 Bacteria 1868
213 Ga0268266_10000064 3300028379 Bacteria 249533
214 Ga0268266_10002526 3300028379 Bacteria 19458
215 Ga0268266_10244212 3300028379 Bacteria 1658
216 Ga0268266_10566250 3300028379 Bacteria 1090
217 Ga0268266_11913066 3300028379 Bacteria 567
218 Ga0268264_12318728 3300028381 Bacteria 543
219 Ga0265318_10000037 3300028577 Bacteria 138223
220 Ga0265338_10103592 3300028800 Bacteria 2311
221 Ga0265338_10150804 3300028800 Bacteria 1806
222 Ga0265324_10028146 3300029957 Bacteria 1984
223 Ga0268256_1008010 3300030500 Bacteria 3674
224 Ga0307512_10131020 3300030522 Bacteria 1573
225 Ga0265773_1043574 3300031018 Bacteria 520
226 Ga0265332_10048354 3300031238 Bacteria 1830
227 Ga0265320_10048024 3300031240 Bacteria 2085
228 Ga0265320_10324306 3300031240 Bacteria 681
229 Ga0265320_10531103 3300031240 Bacteria 520
230 Ga0265325_10143144 3300031241 Bacteria 1136
231 Ga0265340_10200870 3300031247 Bacteria 896
232 Ga0265340_10248686 3300031247 Bacteria 793
233 Ga0265340_10434682 3300031247 Bacteria 578
234 Ga0265339_10014421 3300031249 Bacteria 4762
235 Ga0265339_10074033 3300031249 Bacteria 1810
236 Ga0265339_10366191 3300031249 Bacteria 677
237 Ga0265331_10423919 3300031250 Bacteria 597
238 Ga0265327_10003803 3300031251 Bacteria 13969
239 Ga0307513_10005748 3300031456 Bacteria 16317
240 Ga0307513_10614919 3300031456 Bacteria 795
241 Ga0307508_10092085 3300031616 Bacteria 2620
242 Ga0307508_10549185 3300031616 Bacteria 753
243 Ga0265342_10118683 3300031712 Bacteria 1491
244 Ga0307407_11479232 3300031903 Bacteria 537
245 Ga0307409_102050047 3300031995 Bacteria 602
246 Ga0307411_11602717 3300032005 Bacteria 601
247 Ga0373955_0627253 3300035172 Bacteria 659
248 Ga0373955_0838514 3300035172 Bacteria 565
249 Ga0373931_0762789 3300035691 Bacteria 643
250 Ga0373933_0424092 3300035724 Bacteria 869
251 Ga0373937_2082645 3300036401 Bacteria 513
252 Ga0395899_0000167 3300037312 Bacteria 100973
253 Ga0395900_0000009 3300037418 Bacteria 476249
254 Ga0395900_0402161 3300037418 Bacteria 1333
255 Ga0395900_0757794 3300037418 Bacteria 901
256 Ga0395898_0006464 3300037466 Bacteria 12517
257 Ga0395905_0000292 3300037471 Bacteria 73325
258 Ga0395905_0007153 3300037471 Bacteria 11153
259 Ga0395901_0000014 3300038443 Bacteria 375100
260 Ga0436360_0589937 3300039438 Bacteria 631
261 Ga0436361_0176858 3300039447 Bacteria 7421
262 Ga0436361_0229943 3300039447 Bacteria 815
263 Ga0439465_0213534 3300041413 Bacteria 706
264 Ga0451791_1688163 3300041451 Bacteria 601
265 Ga0451795_0519203 3300041456 Bacteria 590
266 Ga0451839_0269995 3300041496 Bacteria 742
267 Ga0451839_0826984 3300041496 Bacteria 594
268 Ga0451841_0419063 3300041498 Bacteria 506
269 Ga0451853_3532279 3300041512 Bacteria 1379
270 Ga0439441_081511 3300042001 Bacteria 705
271 Ga0439435_0004991 3300042436 Bacteria 2892
272 Ga0439459_0138117 3300042438 Bacteria 628
273 Ga0450916_073317 3300042530 Bacteria 574
274 Ga0466966_0802494 3300044684 Bacteria 567
275 Ga0466966_0841285 3300044684 Bacteria 553
276 Ga0495617_121751 3300046452 Bacteria 840
277 Ga0495627_000813 3300046453 Bacteria 22804
278 Ga0495592_0879986 3300046454 Bacteria 527
279 Ga0495590_0238785 3300046457 Bacteria 674
280 Ga0495638_0000805 3300046460 Bacteria 33075
281 Ga0495638_0003370 3300046460 Bacteria 12601
282 Ga0495638_0004076 3300046460 Bacteria 11193
283 Ga0495638_0005600 3300046460 Bacteria 9280
284 Ga0495638_0092421 3300046460 Bacteria 1821
285 Ga0495650_0000237 3300046471 Bacteria 110872
286 Ga0495650_0047607 3300046471 Bacteria 1792
287 Ga0495605_0160068 3300046474 Bacteria 1000
288 Ga0495584_0388785 3300046491 Bacteria 709
289 Ga0495585_0070780 3300046492 Bacteria 1902
290 Ga0495583_0076089 3300046506 Bacteria 1467
291 Ga0495583_0125919 3300046506 Bacteria 1075
292 Ga0495606_0074423 3300046507 Bacteria 2127
293 Ga0495610_0000407 3300046512 Bacteria 44093
294 Ga0495610_0002000 3300046512 Bacteria 17422
295 Ga0495610_0244691 3300046512 Bacteria 713
296 Ga0495616_0000321 3300046513 Bacteria 38323
297 Ga0495616_0198815 3300046513 Bacteria 882
298 Ga0495620_0078210 3300046515 Bacteria 1341
299 Ga0495628_0099701 3300046516 Bacteria 2243
300 Ga0495630_1497900 3300046517 Bacteria 506
301 Ga0495631_0198801 3300046518 Bacteria 857
302 Ga0495632_0004281 3300046519 Bacteria 9745
303 Ga0495632_0015114 3300046519 Bacteria 4340
304 Ga0495632_0146589 3300046519 Bacteria 1093
305 Ga0495637_0009234 3300046520 Bacteria 4813
306 Ga0495637_0010645 3300046520 Bacteria 4441
307 Ga0495643_0047209 3300046522 Bacteria 2333
308 Ga0495648_0049624 3300046524 Bacteria 2571
309 Ga0495648_0072855 3300046524 Bacteria 1986
310 Ga0495663_0112314 3300046525 Bacteria 906
311 Ga0495642_0094948 3300046528 Bacteria 1265
312 Ga0495652_0374197 3300046529 Bacteria 1015
313 Ga0495652_0900251 3300046529 Bacteria 584
314 Ga0495654_0000249 3300046530 Bacteria 49711
315 Ga0495597_0013122 3300046542 Bacteria 3977
316 Ga0495645_0385637 3300046543 Bacteria 895
317 Ga0495668_0000100 3300046616 Bacteria 137684
318 Ga0495668_0009327 3300046616 Bacteria 6033
319 Ga0495668_0106552 3300046616 Bacteria 1533
320 Ga0495668_0189915 3300046616 Bacteria 1125
321 Ga0495668_0341159 3300046616 Bacteria 822
322 Ga0495611_0230044 3300046648 Bacteria 862
323 Ga0495625_0000143 3300046660 Bacteria 110121
324 Ga0495625_0005451 3300046660 Bacteria 11600
325 Ga0495625_0007058 3300046660 Bacteria 9871
326 Ga0495625_0029340 3300046660 Bacteria 4115
327 Ga0495625_0077650 3300046660 Bacteria 2319
328 Ga0495625_0127233 3300046660 Bacteria 1728
329 Ga0495625_0321411 3300046660 Bacteria 985
330 Ga0495599_0640446 3300046678 Bacteria 616
331 Ga0495669_0222250 3300046684 Bacteria 905
332 Ga0495669_0555627 3300046684 Bacteria 558
333 Ga0495613_0003033 3300046689 Bacteria 12563
334 Ga0495670_0132066 3300046691 Bacteria 1302
335 Ga0495670_0810373 3300046691 Bacteria 511
336 Ga0495671_0061917 3300046692 Bacteria 1845
337 Ga0495671_0254069 3300046692 Bacteria 848
338 Ga0495660_0007387 3300046810 Bacteria 6454
339 Ga0495660_0286728 3300046810 Bacteria 751
340 Ga0495636_0112479 3300047318 Bacteria 1199
341 Ga0495674_0299377 3300047319 Bacteria 1314
342 Ga0495672_0002693 3300047320 Bacteria 15980
343 Ga0495683_0049865 3300047323 Bacteria 2096
344 Ga0495683_0407715 3300047323 Bacteria 564
345 Ga0495683_0434331 3300047323 Bacteria 541
346 Ga0495679_003908 3300047446 Bacteria 7047
347 Ga0495673_0000156 3300047469 Bacteria 118831
348 Ga0495673_0001740 3300047469 Bacteria 16612
349 Ga0495681_0071339 3300047470 Bacteria 1573
350 Ga0495681_0255642 3300047470 Bacteria 690
351 Ga0495686_0011016 3300047472 Bacteria 6396
352 Ga0495686_0011749 3300047472 Bacteria 6164
353 Ga0495686_0034429 3300047472 Bacteria 3262
354 Ga0495686_0045061 3300047472 Bacteria 2792
355 Ga0495686_0406978 3300047472 Bacteria 729
356 Ga0495686_0501062 3300047472 Bacteria 639
357 Ga0496101_0395228 3300048904 Bacteria 1088
358 Ga0496101_0816857 3300048904 Bacteria 735
359 Ga0496103_0167794 3300048906 Bacteria 1409
360 Ga0496104_0745515 3300048907 Bacteria 886
361 Ga0496106_0186647 3300048909 Bacteria 1647
362 Ga0496107_0417635 3300048910 Bacteria 997
363 Ga0496108_0156166 3300048911 Bacteria 1970
364 Ga0496109_0011317 3300048912 Bacteria 7664
365 Ga0496110_0487028 3300048913 Bacteria 1123
366 Ga0496111_0517220 3300048914 Bacteria 878
367 Ga0496111_1050603 3300048914 Bacteria 582
368 Ga0496112_0122269 3300048915 Bacteria 2573
369 Ga0496112_1348719 3300048915 Bacteria 628
370 Ga0496112_1675092 3300048915 Bacteria 549
371 Ga0496113_0361990 3300048916 Bacteria 1164
372 Ga0496113_0742204 3300048916 Bacteria 782
373 Ga0496114_1290645 3300048917 Bacteria 617
374 Ga0496115_0000794 3300048918 Bacteria 23158
375 Ga0496115_0012991 3300048918 Bacteria 6283
376 Ga0496115_0361334 3300048918 Bacteria 1183
377 Ga0496115_1142170 3300048918 Bacteria 588
378 Ga0496116_0018160 3300048919 Bacteria 5432
379 Ga0496118_0042122 3300048921 Bacteria 3606
380 Ga0496119_0189109 3300048922 Bacteria 1074
381 Ga0496121_0165726 3300048924 Bacteria 1611
382 Ga0496123_0441908 3300048926 Bacteria 581
383 Ga0496124_0021850 3300048927 Bacteria 5886
384 Ga0496124_0257900 3300048927 Bacteria 1285
385 Ga0496125_0006630 3300048928 Bacteria 12462
386 Ga0496125_0075161 3300048928 Bacteria 2616
387 Ga0496126_0001304 3300048929 Bacteria 39731
388 Ga0496126_1047468 3300048929 Bacteria 609
389 Ga0496126_1063289 3300048929 Bacteria 603
390 Ga0501043_0308978 3300049579 Unclassified 1207
391 Ga0501047_0666865 3300049581 Bacteria 859
392 Ga0501073_0169563 3300049589 Unclassified 1511
393 Ga0501238_001022 3300049671 Bacteria 3201
394 nmdc:mga00v17_8291_c1 3300050491 Bacteria 5589
395 nmdc:mga0yw44_42826_c1 3300050492 Bacteria 2701
396 nmdc:mga0k408_19793_c1 3300050493 Bacteria 3765
397 nmdc:mga0k408_583609_c1 3300050493 Bacteria 660
398 nmdc:mga06z11_18819_c1 3300050494 Bacteria 1672
399 nmdc:mga09592_1052007_c1 3300050508 Bacteria 678
400 nmdc:mga0qj67_88865_c1 3300050509 Bacteria 2481
401 nmdc:mga06r32_532637_c1 3300050510 Bacteria 1150
402 nmdc:mga06r32_629041_c1 3300050510 Bacteria 1043
403 nmdc:mga0sz30_5859_c1 3300050516 Bacteria 4530
404 Ga0495601_0424914 3300053077 Bacteria 861
405 Ga0495601_0979863 3300053077 Bacteria 532
406 Ga0500578_0424026 3300053086 Bacteria 762
407 Ga0500643_007931 3300053087 Bacteria 4225
408 Ga0500643_067765 3300053087 Bacteria 993
409 Ga0500643_102309 3300053087 Bacteria 777
410 Ga0500644_0002145 3300053088 Bacteria 4991
411 Ga0500644_0131004 3300053088 Bacteria 987
412 Ga0500647_0025102 3300053091 Bacteria 2807
413 Ga0500583_0166529 3300053092 Bacteria 1098
414 Ga0500651_0005516 3300053093 Bacteria 7228
415 Ga0500566_0247844 3300053094 Bacteria 868
416 Ga0500566_0323003 3300053094 Bacteria 718
417 Ga0500641_0000523 3300053096 Bacteria 13813
418 Ga0500641_0049319 3300053096 Bacteria 1726
419 Ga0500650_0153763 3300053098 Bacteria 1063
420 Ga0500660_255233 3300053100 Bacteria 535
421 Ga0500554_006648 3300053102 Bacteria 2609
422 Ga0500556_0001327 3300053104 Bacteria 10991
423 Ga0500556_0134747 3300053104 Bacteria 969
424 Ga0500595_013443 3300053119 Bacteria 3135
425 Ga0500595_089094 3300053119 Bacteria 895
426 Ga0500608_032397 3300053122 Bacteria 2484
427 Ga0500614_006224 3300053123 Bacteria 2506
428 Ga0500618_000240 3300053125 Bacteria 43528
429 Ga0500652_153608 3300053131 Bacteria 954
430 Ga0500658_0001685 3300053134 Bacteria 8760
431 Ga0500658_0414853 3300053134 Bacteria 615
432 Ga0500559_0000031 3300053136 Bacteria 114782
433 Ga0500577_0000365 3300053142 Bacteria 11577
434 Ga0500603_159291 3300053150 Bacteria 703
435 Ga0500616_0010493 3300053153 Bacteria 5541
436 Ga0500622_0003880 3300053156 Bacteria 9702
437 Ga0500622_0030979 3300053156 Bacteria 2806
438 Ga0500627_0123465 3300053158 Bacteria 1168
439 Ga0500611_047085 3300053727 Bacteria 972
440 Ga0500645_009516 3300053730 Bacteria 3260
441 Ga0500609_011115 3300053731 Bacteria 1215
442 Ga0500599_096087 3300053736 Bacteria 516

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035724 Ga0373933_0424092 Ga0373933_0424092_242_463 67
2 3300028379 Ga0268266_11913066 Ga0268266_119130661 68
3 3300005459 Ga0068867_100077759 Ga0068867_1000777594 69
4 3300006038 Ga0075365_10031646 Ga0075365_100316463 69
5 3300006178 Ga0075367_10012025 Ga0075367_100120257 69
6 3300006237 Ga0097621_101013846 Ga0097621_1010138461 69
7 3300009177 Ga0105248_12024643 Ga0105248_120246432 69
8 3300025981 Ga0207640_10493022 Ga0207640_104930222 69
9 3300026089 Ga0207648_10300911 Ga0207648_103009112 69
10 3300028800 Ga0265338_10150804 Ga0265338_101508042 69
11 3300031240 Ga0265320_10324306 Ga0265320_103243062 69
12 3300031241 Ga0265325_10143144 Ga0265325_101431442 69
13 3300031249 Ga0265339_10014421 Ga0265339_100144214 69
14 3300031249 Ga0265339_10074033 Ga0265339_100740332 69
15 3300050492 nmdc:mga0yw44_42826_c1 nmdc:mga0yw44_42826_c1_2332_2556 69
16 3300050494 nmdc:mga06z11_18819_c1 nmdc:mga06z11_18819_c1_56_280 69
17 iso_pu_bacteria 2510917020 2511122113 70
18 iso_pu_bacteria 2582581280 2585155328 70
19 iso_pu_bacteria 2582581293 2585198892 70
20 iso_pu_bacteria 2582581305 2585261518 70
21 iso_pu_bacteria 2585428106 2587915369 70
22 iso_pu_bacteria 2643221583 2643923980 70
23 iso_pu_bacteria 2643221584 2643927671 70
24 iso_pu_bacteria 2643221640 2644223924 70
25 iso_pu_bacteria 2643221642 2644232910 70
26 iso_pu_bacteria 2818991435 2819539612 70
27 iso_pu_bacteria 2818991454 2819648820 70
28 iso_pu_bacteria 2884960567 2884964159 70
29 3300003791 Ga0055530_10096868 Ga0055530_100968682 71
30 3300009174 Ga0105241_10219824 Ga0105241_102198242 71
31 3300009545 Ga0105237_10355346 Ga0105237_103553462 71
32 3300010375 Ga0105239_10001120 Ga0105239_1000112030 71
33 3300013105 Ga0157369_10010655 Ga0157369_100106558 71
34 3300025298 Ga0209050_1018961 Ga0209050_10189613 71
35 3300025913 Ga0207695_10357489 Ga0207695_103574892 71
36 3300025914 Ga0207671_10615286 Ga0207671_106152862 71
37 3300027312 Ga0209371_1017343 Ga0209371_10173432 71
38 3300030500 Ga0268256_1008010 Ga0268256_10080102 71
39 3300003323 rootH1_10087495 rootH1_100874953 72
40 3300005436 Ga0070713_100566557 Ga0070713_1005665572 72
41 3300005436 Ga0070713_101629055 Ga0070713_1016290551 72
42 3300005437 Ga0070710_10241981 Ga0070710_102419812 72
43 3300005563 Ga0068855_100000170 Ga0068855_10000017022 72
44 3300005563 Ga0068855_100251452 Ga0068855_1002514522 72
45 3300006028 Ga0070717_10122089 Ga0070717_101220894 72
46 3300006163 Ga0070715_10924954 Ga0070715_109249542 72
47 3300006175 Ga0070712_101103267 Ga0070712_1011032672 72
48 3300006177 Ga0075362_10444924 Ga0075362_104449242 72
49 3300009545 Ga0105237_12743270 Ga0105237_127432702 72
50 3300025898 Ga0207692_10797305 Ga0207692_107973052 72
51 3300025899 Ga0207642_10547055 Ga0207642_105470552 72
52 3300025906 Ga0207699_10594012 Ga0207699_105940121 72
53 3300025915 Ga0207693_10199071 Ga0207693_101990713 72
54 3300025915 Ga0207693_11012584 Ga0207693_110125841 72
55 3300025917 Ga0207660_11252512 Ga0207660_112525121 72
56 3300025921 Ga0207652_11554703 Ga0207652_115547031 72
57 3300025928 Ga0207700_10980811 Ga0207700_109808112 72
58 3300025928 Ga0207700_11739392 Ga0207700_117393921 72
59 3300025949 Ga0207667_10000201 Ga0207667_1000020164 72
60 3300025949 Ga0207667_11905683 Ga0207667_119056831 72
61 3300031018 Ga0265773_1043574 Ga0265773_10435742 72
62 3300031240 Ga0265320_10531103 Ga0265320_105311032 72
63 3300031247 Ga0265340_10434682 Ga0265340_104346822 72
64 3300031250 Ga0265331_10423919 Ga0265331_104239192 72
65 3300032005 Ga0307411_11602717 Ga0307411_116027171 72
66 3300037471 Ga0395905_0000292 Ga0395905_0000292_56434_56667 72
67 3300039438 Ga0436360_0589937 Ga0436360_0589937_24_257 72
68 3300047469 Ga0495673_0000156 Ga0495673_0000156_13015_13272 72
69 3300048921 Ga0496118_0042122 Ga0496118_0042122_1467_1706 72
70 3300048922 Ga0496119_0189109 Ga0496119_0189109_456_695 72
71 3300048928 Ga0496125_0006630 Ga0496125_0006630_8643_8882 72
72 3300053088 Ga0500644_0131004 Ga0500644_0131004_549_806 72
73 3300003320 rootH2_10196150 rootH2_101961502 73
74 3300003322 rootL2_10153064 rootL2_101530641 73
75 3300003775 Ga0055524_1013082 Ga0055524_10130824 73
76 3300005327 Ga0070658_10207943 Ga0070658_102079431 73
77 3300005331 Ga0070670_100128308 Ga0070670_1001283083 73
78 3300005338 Ga0068868_100467610 Ga0068868_1004676102 73
79 3300005339 Ga0070660_100020517 Ga0070660_1000205176 73
80 3300005339 Ga0070660_100828498 Ga0070660_1008284982 73
81 3300005339 Ga0070660_101868369 Ga0070660_1018683691 73
82 3300005355 Ga0070671_100033424 Ga0070671_1000334246 73
83 3300005355 Ga0070671_100097820 Ga0070671_1000978203 73
84 3300005365 Ga0070688_100621285 Ga0070688_1006212852 73
85 3300005366 Ga0070659_100002791 Ga0070659_1000027919 73
86 3300005457 Ga0070662_100112144 Ga0070662_1001121444 73
87 3300005458 Ga0070681_10214174 Ga0070681_102141743 73
88 3300005530 Ga0070679_100554289 Ga0070679_1005542892 73
89 3300005530 Ga0070679_101191749 Ga0070679_1011917493 73
90 3300005539 Ga0068853_100005921 Ga0068853_1000059218 73
91 3300005539 Ga0068853_101177242 Ga0068853_1011772422 73
92 3300005548 Ga0070665_100000116 Ga0070665_100000116118 73
93 3300005548 Ga0070665_100037973 Ga0070665_1000379732 73
94 3300005548 Ga0070665_100938428 Ga0070665_1009384281 73
95 3300005563 Ga0068855_100163203 Ga0068855_1001632033 73
96 3300005563 Ga0068855_100175677 Ga0068855_1001756772 73
97 3300005563 Ga0068855_100392759 Ga0068855_1003927592 73
98 3300005577 Ga0068857_100235297 Ga0068857_1002352972 73
99 3300005614 Ga0068856_101374885 Ga0068856_1013748851 73
100 3300005616 Ga0068852_100484967 Ga0068852_1004849672 73
101 3300005618 Ga0068864_100007465 Ga0068864_1000074659 73
102 3300005841 Ga0068863_100113944 Ga0068863_1001139442 73
103 3300005841 Ga0068863_100426867 Ga0068863_1004268672 73
104 3300006028 Ga0070717_10353992 Ga0070717_103539923 73
105 3300006051 Ga0075364_10034351 Ga0075364_100343513 73
106 3300006237 Ga0097621_100167662 Ga0097621_1001676623 73
107 3300006237 Ga0097621_100282152 Ga0097621_1002821522 73
108 3300006358 Ga0068871_101709177 Ga0068871_1017091772 73
109 3300006846 Ga0075430_100707365 Ga0075430_1007073652 73
110 3300006847 Ga0075431_100404601 Ga0075431_1004046012 73
111 3300006880 Ga0075429_100480361 Ga0075429_1004803612 73
112 3300009093 Ga0105240_10010558 Ga0105240_100105589 73
113 3300009093 Ga0105240_10488383 Ga0105240_104883833 73
114 3300009093 Ga0105240_10627727 Ga0105240_106277272 73
115 3300009093 Ga0105240_11028842 Ga0105240_110288422 73
116 3300009098 Ga0105245_12429945 Ga0105245_124299451 73
117 3300009174 Ga0105241_12504828 Ga0105241_125048281 73
118 3300009177 Ga0105248_10000438 Ga0105248_1000043811 73
119 3300009177 Ga0105248_10106271 Ga0105248_101062712 73
120 3300009545 Ga0105237_10141244 Ga0105237_101412443 73
121 3300009545 Ga0105237_10172906 Ga0105237_101729063 73
122 3300009545 Ga0105237_12492826 Ga0105237_124928262 73
123 3300009551 Ga0105238_10024507 Ga0105238_100245076 73
124 3300009551 Ga0105238_10098910 Ga0105238_100989103 73
125 3300009551 Ga0105238_11269331 Ga0105238_112693312 73
126 3300009551 Ga0105238_11963785 Ga0105238_119637851 73
127 3300009551 Ga0105238_12593013 Ga0105238_125930132 73
128 3300010375 Ga0105239_10267147 Ga0105239_102671473 73
129 3300010375 Ga0105239_10494854 Ga0105239_104948542 73
130 3300010375 Ga0105239_10671555 Ga0105239_106715551 73
131 3300010375 Ga0105239_11462528 Ga0105239_114625281 73
132 3300010375 Ga0105239_11522864 Ga0105239_115228642 73
133 3300013102 Ga0157371_11441063 Ga0157371_114410632 73
134 3300013105 Ga0157369_10459831 Ga0157369_104598313 73
135 3300013306 Ga0163162_10113304 Ga0163162_101133044 73
136 3300013306 Ga0163162_11746380 Ga0163162_117463802 73
137 3300013307 Ga0157372_10918586 Ga0157372_109185863 73
138 3300013307 Ga0157372_11269027 Ga0157372_112690272 73
139 3300013308 Ga0157375_10886508 Ga0157375_108865082 73
140 3300013308 Ga0157375_11008665 Ga0157375_110086651 73
141 3300013308 Ga0157375_11601615 Ga0157375_116016152 73
142 3300014325 Ga0163163_10011539 Ga0163163_100115394 73
143 3300014325 Ga0163163_13178434 Ga0163163_131784341 73
144 3300014968 Ga0157379_10363679 Ga0157379_103636791 73
145 3300014969 Ga0157376_11948645 Ga0157376_119486452 73
146 3300014969 Ga0157376_12599710 Ga0157376_125997101 73
147 3300014969 Ga0157376_12868463 Ga0157376_128684632 73
148 3300025254 Ga0209148_1015146 Ga0209148_10151462 73
149 3300025299 Ga0209256_1002765 Ga0209256_100276514 73
150 3300025299 Ga0209256_1003631 Ga0209256_10036315 73
151 3300025909 Ga0207705_10083086 Ga0207705_100830863 73
152 3300025909 Ga0207705_10381030 Ga0207705_103810302 73
153 3300025909 Ga0207705_10510635 Ga0207705_105106352 73
154 3300025909 Ga0207705_10589035 Ga0207705_105890352 73
155 3300025909 Ga0207705_11435754 Ga0207705_114357541 73
156 3300025912 Ga0207707_10518463 Ga0207707_105184632 73
157 3300025912 Ga0207707_10741383 Ga0207707_107413831 73
158 3300025913 Ga0207695_10001195 Ga0207695_100011957 73
159 3300025913 Ga0207695_10929634 Ga0207695_109296341 73
160 3300025914 Ga0207671_10782846 Ga0207671_107828462 73
161 3300025914 Ga0207671_11117285 Ga0207671_111172852 73
162 3300025917 Ga0207660_10042635 Ga0207660_100426354 73
163 3300025919 Ga0207657_10001137 Ga0207657_100011379 73
164 3300025919 Ga0207657_10063018 Ga0207657_100630182 73
165 3300025919 Ga0207657_10668840 Ga0207657_106688402 73
166 3300025921 Ga0207652_10427049 Ga0207652_104270492 73
167 3300025924 Ga0207694_10014979 Ga0207694_100149793 73
168 3300025924 Ga0207694_10015440 Ga0207694_100154403 73
169 3300025924 Ga0207694_10549220 Ga0207694_105492202 73
170 3300025925 Ga0207650_10154457 Ga0207650_101544572 73
171 3300025932 Ga0207690_10212337 Ga0207690_102123372 73
172 3300025933 Ga0207706_10079305 Ga0207706_100793052 73
173 3300025941 Ga0207711_10001604 Ga0207711_100016046 73
174 3300025941 Ga0207711_10395649 Ga0207711_103956492 73
175 3300025944 Ga0207661_12183919 Ga0207661_121839192 73
176 3300025949 Ga0207667_10591250 Ga0207667_105912502 73
177 3300025949 Ga0207667_11115717 Ga0207667_111157171 73
178 3300025960 Ga0207651_11614679 Ga0207651_116146791 73
179 3300025986 Ga0207658_10111154 Ga0207658_101111542 73
180 3300025986 Ga0207658_12114904 Ga0207658_121149042 73
181 3300026023 Ga0207677_10247358 Ga0207677_102473582 73
182 3300026041 Ga0207639_10260736 Ga0207639_102607361 73
183 3300026041 Ga0207639_10581345 Ga0207639_105813452 73
184 3300026078 Ga0207702_12306385 Ga0207702_123063852 73
185 3300026088 Ga0207641_10896596 Ga0207641_108965962 73
186 3300026088 Ga0207641_11881228 Ga0207641_118812281 73
187 3300026095 Ga0207676_10139042 Ga0207676_101390424 73
188 3300026116 Ga0207674_10174819 Ga0207674_101748192 73
189 3300026142 Ga0207698_10659819 Ga0207698_106598192 73
190 3300028379 Ga0268266_10000064 Ga0268266_10000064224 73
191 3300028379 Ga0268266_10002526 Ga0268266_1000252610 73
192 3300028379 Ga0268266_10244212 Ga0268266_102442122 73
193 3300028379 Ga0268266_10566250 Ga0268266_105662502 73
194 3300028800 Ga0265338_10103592 Ga0265338_101035922 73
195 3300029957 Ga0265324_10028146 Ga0265324_100281462 73
196 3300031238 Ga0265332_10048354 Ga0265332_100483542 73
197 3300031240 Ga0265320_10048024 Ga0265320_100480244 73
198 3300031247 Ga0265340_10200870 Ga0265340_102008702 73
199 3300031247 Ga0265340_10248686 Ga0265340_102486862 73
200 3300031249 Ga0265339_10366191 Ga0265339_103661911 73
201 3300031251 Ga0265327_10003803 Ga0265327_1000380314 73
202 3300031456 Ga0307513_10005748 Ga0307513_1000574810 73
203 3300031616 Ga0307508_10092085 Ga0307508_100920853 73
204 3300031616 Ga0307508_10549185 Ga0307508_105491851 73
205 3300031712 Ga0265342_10118683 Ga0265342_101186832 73
206 3300031903 Ga0307407_11479232 Ga0307407_114792322 73
207 3300031995 Ga0307409_102050047 Ga0307409_1020500472 73
208 3300035172 Ga0373955_0838514 Ga0373955_0838514_275_511 73
209 3300036401 Ga0373937_2082645 Ga0373937_2082645_258_494 73
210 3300037312 Ga0395899_0000167 Ga0395899_0000167_60945_61181 73
211 3300037418 Ga0395900_0000009 Ga0395900_0000009_345197_345433 73
212 3300037418 Ga0395900_0402161 Ga0395900_0402161_672_908 73
213 3300037418 Ga0395900_0757794 Ga0395900_0757794_301_537 73
214 3300037466 Ga0395898_0006464 Ga0395898_0006464_4448_4684 73
215 3300037471 Ga0395905_0007153 Ga0395905_0007153_5676_5912 73
216 3300038443 Ga0395901_0000014 Ga0395901_0000014_296402_296638 73
217 3300041413 Ga0439465_0213534 Ga0439465_0213534_13_264 73
218 3300041451 Ga0451791_1688163 Ga0451791_1688163_126_362 73
219 3300041496 Ga0451839_0269995 Ga0451839_0269995_250_486 73
220 3300044684 Ga0466966_0802494 Ga0466966_0802494_56_292 73
221 3300044684 Ga0466966_0841285 Ga0466966_0841285_223_459 73
222 3300046454 Ga0495592_0879986 Ga0495592_0879986_193_429 73
223 3300046474 Ga0495605_0160068 Ga0495605_0160068_413_649 73
224 3300046491 Ga0495584_0388785 Ga0495584_0388785_291_527 73
225 3300046506 Ga0495583_0076089 Ga0495583_0076089_492_728 73
226 3300046516 Ga0495628_0099701 Ga0495628_0099701_1378_1614 73
227 3300046517 Ga0495630_1497900 Ga0495630_1497900_151_387 73
228 3300046528 Ga0495642_0094948 Ga0495642_0094948_946_1182 73
229 3300046529 Ga0495652_0374197 Ga0495652_0374197_85_321 73
230 3300046529 Ga0495652_0900251 Ga0495652_0900251_177_413 73
231 3300046543 Ga0495645_0385637 Ga0495645_0385637_648_884 73
232 3300046616 Ga0495668_0189915 Ga0495668_0189915_724_960 73
233 3300046616 Ga0495668_0341159 Ga0495668_0341159_433_669 73
234 3300046648 Ga0495611_0230044 Ga0495611_0230044_333_569 73
235 3300046660 Ga0495625_0077650 Ga0495625_0077650_1400_1636 73
236 3300046678 Ga0495599_0640446 Ga0495599_0640446_351_587 73
237 3300046684 Ga0495669_0222250 Ga0495669_0222250_462_698 73
238 3300046684 Ga0495669_0555627 Ga0495669_0555627_166_402 73
239 3300046689 Ga0495613_0003033 Ga0495613_0003033_1285_1521 73
240 3300047318 Ga0495636_0112479 Ga0495636_0112479_295_531 73
241 3300047319 Ga0495674_0299377 Ga0495674_0299377_710_946 73
242 3300047323 Ga0495683_0407715 Ga0495683_0407715_72_308 73
243 3300047470 Ga0495681_0255642 Ga0495681_0255642_332_568 73
244 3300047472 Ga0495686_0501062 Ga0495686_0501062_319_555 73
245 3300048904 Ga0496101_0395228 Ga0496101_0395228_137_373 73
246 3300048904 Ga0496101_0816857 Ga0496101_0816857_16_252 73
247 3300048906 Ga0496103_0167794 Ga0496103_0167794_844_1080 73
248 3300048907 Ga0496104_0745515 Ga0496104_0745515_490_726 73
249 3300048909 Ga0496106_0186647 Ga0496106_0186647_364_600 73
250 3300048910 Ga0496107_0417635 Ga0496107_0417635_257_493 73
251 3300048911 Ga0496108_0156166 Ga0496108_0156166_656_892 73
252 3300048912 Ga0496109_0011317 Ga0496109_0011317_6727_6963 73
253 3300048913 Ga0496110_0487028 Ga0496110_0487028_819_1055 73
254 3300048914 Ga0496111_0517220 Ga0496111_0517220_394_630 73
255 3300048915 Ga0496112_0122269 Ga0496112_0122269_412_648 73
256 3300048915 Ga0496112_1348719 Ga0496112_1348719_227_463 73
257 3300048916 Ga0496113_0361990 Ga0496113_0361990_890_1126 73
258 3300048916 Ga0496113_0742204 Ga0496113_0742204_233_469 73
259 3300048918 Ga0496115_0000794 Ga0496115_0000794_9953_10189 73
260 3300048918 Ga0496115_0012991 Ga0496115_0012991_5541_5777 73
261 3300048918 Ga0496115_0361334 Ga0496115_0361334_473_709 73
262 3300048918 Ga0496115_1142170 Ga0496115_1142170_158_394 73
263 3300048927 Ga0496124_0021850 Ga0496124_0021850_2564_2809 73
264 3300049579 Ga0501043_0308978 Ga0501043_0308978_487_723 73
265 3300049581 Ga0501047_0666865 Ga0501047_0666865_472_717 73
266 3300049589 Ga0501073_0169563 Ga0501073_0169563_1201_1437 73
267 3300049671 Ga0501238_001022 Ga0501238_001022_2128_2385 73
268 3300050491 nmdc:mga00v17_8291_c1 nmdc:mga00v17_8291_c1_3661_3906 73
269 3300050508 nmdc:mga09592_1052007_c1 nmdc:mga09592_1052007_c1_329_568 73
270 3300050509 nmdc:mga0qj67_88865_c1 nmdc:mga0qj67_88865_c1_1416_1655 73
271 3300050510 nmdc:mga06r32_532637_c1 nmdc:mga06r32_532637_c1_892_1131 73
272 3300050510 nmdc:mga06r32_629041_c1 nmdc:mga06r32_629041_c1_690_929 73
273 3300050516 nmdc:mga0sz30_5859_c1 nmdc:mga0sz30_5859_c1_3852_4097 73
274 3300053077 Ga0495601_0424914 Ga0495601_0424914_63_299 73
275 3300053077 Ga0495601_0979863 Ga0495601_0979863_274_510 73
276 3300053087 Ga0500643_007931 Ga0500643_007931_2456_2692 73
277 3300053087 Ga0500643_102309 Ga0500643_102309_92_328 73
278 3300053088 Ga0500644_0002145 Ga0500644_0002145_3570_3818 73
279 3300053091 Ga0500647_0025102 Ga0500647_0025102_661_897 73
280 3300053093 Ga0500651_0005516 Ga0500651_0005516_5475_5723 73
281 3300053094 Ga0500566_0323003 Ga0500566_0323003_142_378 73
282 3300053096 Ga0500641_0000523 Ga0500641_0000523_9336_9572 73
283 3300053096 Ga0500641_0049319 Ga0500641_0049319_1294_1530 73
284 3300053119 Ga0500595_013443 Ga0500595_013443_422_658 73
285 3300053119 Ga0500595_089094 Ga0500595_089094_47_295 73
286 3300053131 Ga0500652_153608 Ga0500652_153608_527_763 73
287 3300053150 Ga0500603_159291 Ga0500603_159291_12_248 73
288 3300003215 JGI25153J46596_10054462 JGI25153J46596_100544622 74
289 3300003316 rootH1_10086563 rootH1_100865632 74
290 3300003322 rootL2_10164339 rootL2_101643391 74
291 3300003771 Ga0055526_1030707 Ga0055526_10307073 74
292 3300003773 Ga0055537_1003999 Ga0055537_10039993 74
293 3300003773 Ga0055537_1004006 Ga0055537_10040065 74
294 3300003773 Ga0055537_1004009 Ga0055537_10040093 74
295 3300003775 Ga0055524_1012548 Ga0055524_10125482 74
296 3300003790 Ga0055528_1006543 Ga0055528_10065434 74
297 3300003791 Ga0055530_10006758 Ga0055530_100067584 74
298 3300003791 Ga0055530_10016431 Ga0055530_100164313 74
299 3300003792 Ga0055540_1054815 Ga0055540_10548152 74
300 3300003794 Ga0055531_10006115 Ga0055531_100061157 74
301 3300003794 Ga0055531_10006160 Ga0055531_100061603 74
302 3300005262 Ga0065165_1001046 Ga0065165_100104613 74
303 3300005336 Ga0070680_100078532 Ga0070680_1000785323 74
304 3300005341 Ga0070691_10049052 Ga0070691_100490522 74
305 3300005344 Ga0070661_100409132 Ga0070661_1004091322 74
306 3300005530 Ga0070679_100481216 Ga0070679_1004812161 74
307 3300005530 Ga0070679_101198229 Ga0070679_1011982292 74
308 3300005843 Ga0068860_102785548 Ga0068860_1027855481 74
309 3300006195 Ga0075366_10169211 Ga0075366_101692112 74
310 3300006195 Ga0075366_10784260 Ga0075366_107842602 74
311 3300006353 Ga0075370_10076916 Ga0075370_100769161 74
312 3300006353 Ga0075370_10913510 Ga0075370_109135102 74
313 3300009093 Ga0105240_10054523 Ga0105240_100545233 74
314 3300009176 Ga0105242_10292381 Ga0105242_102923813 74
315 3300009177 Ga0105248_12973948 Ga0105248_129739482 74
316 3300012512 Ga0157327_1063108 Ga0157327_10631082 74
317 3300013296 Ga0157374_10540383 Ga0157374_105403832 74
318 3300014325 Ga0163163_12742650 Ga0163163_127426502 74
319 3300014969 Ga0157376_11113460 Ga0157376_111134602 74
320 3300025263 Ga0209565_1000118 Ga0209565_100011860 74
321 3300025273 Ga0209673_1002937 Ga0209673_10029375 74
322 3300025273 Ga0209673_1020148 Ga0209673_10201482 74
323 3300025291 Ga0209675_1006728 Ga0209675_10067286 74
324 3300025292 Ga0209676_1000319 Ga0209676_10003197 74
325 3300025292 Ga0209676_1000401 Ga0209676_100040177 74
326 3300025295 Ga0209564_1002161 Ga0209564_100216110 74
327 3300025295 Ga0209564_1014148 Ga0209564_10141484 74
328 3300025295 Ga0209564_1025404 Ga0209564_10254042 74
329 3300025297 Ga0209758_1002847 Ga0209758_100284713 74
330 3300025297 Ga0209758_1003231 Ga0209758_100323116 74
331 3300025298 Ga0209050_1005474 Ga0209050_10054746 74
332 3300025298 Ga0209050_1006330 Ga0209050_10063306 74
333 3300025298 Ga0209050_1032468 Ga0209050_10324682 74
334 3300025299 Ga0209256_1003647 Ga0209256_10036476 74
335 3300025303 Ga0209051_1004563 Ga0209051_10045634 74
336 3300025304 Ga0209257_1000506 Ga0209257_100050652 74
337 3300025304 Ga0209257_1006567 Ga0209257_10065674 74
338 3300025304 Ga0209257_1008873 Ga0209257_10088734 74
339 3300025304 Ga0209257_1111502 Ga0209257_11115022 74
340 3300025913 Ga0207695_10000718 Ga0207695_1000071866 74
341 3300025917 Ga0207660_10073840 Ga0207660_100738403 74
342 3300025934 Ga0207686_10352576 Ga0207686_103525762 74
343 3300025949 Ga0207667_11163628 Ga0207667_111636282 74
344 3300026088 Ga0207641_12267054 Ga0207641_122670542 74
345 3300028381 Ga0268264_12318728 Ga0268264_123187282 74
346 3300028577 Ga0265318_10000037 Ga0265318_10000037113 74
347 3300030522 Ga0307512_10131020 Ga0307512_101310202 74
348 3300031456 Ga0307513_10614919 Ga0307513_106149192 74
349 3300035172 Ga0373955_0627253 Ga0373955_0627253_206_457 74
350 3300035691 Ga0373931_0762789 Ga0373931_0762789_25_267 74
351 3300039447 Ga0436361_0176858 Ga0436361_0176858_626_877 74
352 3300039447 Ga0436361_0229943 Ga0436361_0229943_342_593 74
353 3300041456 Ga0451795_0519203 Ga0451795_0519203_59_307 74
354 3300041496 Ga0451839_0826984 Ga0451839_0826984_56_304 74
355 3300041498 Ga0451841_0419063 Ga0451841_0419063_131_379 74
356 3300041512 Ga0451853_3532279 Ga0451853_3532279_444_692 74
357 3300042001 Ga0439441_081511 Ga0439441_081511_420_668 74
358 3300042436 Ga0439435_0004991 Ga0439435_0004991_1051_1299 74
359 3300042438 Ga0439459_0138117 Ga0439459_0138117_112_360 74
360 3300042530 Ga0450916_073317 Ga0450916_073317_126_374 74
361 3300046452 Ga0495617_121751 Ga0495617_121751_231_491 74
362 3300046453 Ga0495627_000813 Ga0495627_000813_3602_3859 74
363 3300046457 Ga0495590_0238785 Ga0495590_0238785_223_471 74
364 3300046460 Ga0495638_0000805 Ga0495638_0000805_8503_8751 74
365 3300046460 Ga0495638_0003370 Ga0495638_0003370_3380_3640 74
366 3300046460 Ga0495638_0004076 Ga0495638_0004076_4028_4276 74
367 3300046460 Ga0495638_0005600 Ga0495638_0005600_4257_4514 74
368 3300046460 Ga0495638_0092421 Ga0495638_0092421_89_346 74
369 3300046471 Ga0495650_0000237 Ga0495650_0000237_10637_10885 74
370 3300046471 Ga0495650_0047607 Ga0495650_0047607_471_731 74
371 3300046492 Ga0495585_0070780 Ga0495585_0070780_405_662 74
372 3300046506 Ga0495583_0125919 Ga0495583_0125919_634_882 74
373 3300046507 Ga0495606_0074423 Ga0495606_0074423_1709_1969 74
374 3300046512 Ga0495610_0000407 Ga0495610_0000407_31667_31927 74
375 3300046512 Ga0495610_0002000 Ga0495610_0002000_12896_13168 74
376 3300046512 Ga0495610_0244691 Ga0495610_0244691_369_626 74
377 3300046513 Ga0495616_0000321 Ga0495616_0000321_5117_5374 74
378 3300046513 Ga0495616_0198815 Ga0495616_0198815_428_688 74
379 3300046515 Ga0495620_0078210 Ga0495620_0078210_592_840 74
380 3300046518 Ga0495631_0198801 Ga0495631_0198801_169_432 74
381 3300046519 Ga0495632_0004281 Ga0495632_0004281_4591_4848 74
382 3300046519 Ga0495632_0015114 Ga0495632_0015114_1062_1319 74
383 3300046519 Ga0495632_0146589 Ga0495632_0146589_122_370 74
384 3300046520 Ga0495637_0009234 Ga0495637_0009234_4175_4435 74
385 3300046520 Ga0495637_0010645 Ga0495637_0010645_2852_3109 74
386 3300046522 Ga0495643_0047209 Ga0495643_0047209_907_1164 74
387 3300046524 Ga0495648_0049624 Ga0495648_0049624_176_433 74
388 3300046524 Ga0495648_0072855 Ga0495648_0072855_366_614 74
389 3300046525 Ga0495663_0112314 Ga0495663_0112314_567_827 74
390 3300046530 Ga0495654_0000249 Ga0495654_0000249_40055_40303 74
391 3300046542 Ga0495597_0013122 Ga0495597_0013122_1170_1418 74
392 3300046616 Ga0495668_0000100 Ga0495668_0000100_134380_134628 74
393 3300046616 Ga0495668_0009327 Ga0495668_0009327_1835_2092 74
394 3300046616 Ga0495668_0106552 Ga0495668_0106552_933_1181 74
395 3300046660 Ga0495625_0000143 Ga0495625_0000143_90756_91019 74
396 3300046660 Ga0495625_0005451 Ga0495625_0005451_6912_7172 74
397 3300046660 Ga0495625_0007058 Ga0495625_0007058_1677_1937 74
398 3300046660 Ga0495625_0029340 Ga0495625_0029340_91_339 74
399 3300046660 Ga0495625_0127233 Ga0495625_0127233_365_613 74
400 3300046660 Ga0495625_0321411 Ga0495625_0321411_308_556 74
401 3300046691 Ga0495670_0132066 Ga0495670_0132066_788_1036 74
402 3300046691 Ga0495670_0810373 Ga0495670_0810373_90_350 74
403 3300046692 Ga0495671_0061917 Ga0495671_0061917_1191_1439 74
404 3300046692 Ga0495671_0254069 Ga0495671_0254069_438_698 74
405 3300046810 Ga0495660_0007387 Ga0495660_0007387_1601_1849 74
406 3300046810 Ga0495660_0286728 Ga0495660_0286728_50_298 74
407 3300047320 Ga0495672_0002693 Ga0495672_0002693_3228_3488 74
408 3300047323 Ga0495683_0049865 Ga0495683_0049865_1692_1949 74
409 3300047323 Ga0495683_0434331 Ga0495683_0434331_201_461 74
410 3300047446 Ga0495679_003908 Ga0495679_003908_2244_2507 74
411 3300047469 Ga0495673_0001740 Ga0495673_0001740_12658_12906 74
412 3300047470 Ga0495681_0071339 Ga0495681_0071339_878_1138 74
413 3300047472 Ga0495686_0011016 Ga0495686_0011016_1751_2023 74
414 3300047472 Ga0495686_0011749 Ga0495686_0011749_4863_5123 74
415 3300047472 Ga0495686_0034429 Ga0495686_0034429_828_1100 74
416 3300047472 Ga0495686_0045061 Ga0495686_0045061_1204_1452 74
417 3300047472 Ga0495686_0406978 Ga0495686_0406978_263_523 74
418 3300048914 Ga0496111_1050603 Ga0496111_1050603_163_411 74
419 3300048915 Ga0496112_1675092 Ga0496112_1675092_133_393 74
420 3300048917 Ga0496114_1290645 Ga0496114_1290645_109_357 74
421 3300048919 Ga0496116_0018160 Ga0496116_0018160_4383_4631 74
422 3300048924 Ga0496121_0165726 Ga0496121_0165726_309_557 74
423 3300048926 Ga0496123_0441908 Ga0496123_0441908_47_295 74
424 3300048927 Ga0496124_0257900 Ga0496124_0257900_858_1106 74
425 3300048928 Ga0496125_0075161 Ga0496125_0075161_1227_1475 74
426 3300048929 Ga0496126_0001304 Ga0496126_0001304_6575_6823 74
427 3300048929 Ga0496126_1047468 Ga0496126_1047468_134_382 74
428 3300048929 Ga0496126_1063289 Ga0496126_1063289_174_434 74
429 3300050493 nmdc:mga0k408_19793_c1 nmdc:mga0k408_19793_c1_2330_2590 74
430 3300050493 nmdc:mga0k408_583609_c1 nmdc:mga0k408_583609_c1_232_480 74
431 3300053086 Ga0500578_0424026 Ga0500578_0424026_20_280 74
432 3300053087 Ga0500643_067765 Ga0500643_067765_32_292 74
433 3300053092 Ga0500583_0166529 Ga0500583_0166529_118_366 74
434 3300053094 Ga0500566_0247844 Ga0500566_0247844_570_818 74
435 3300053098 Ga0500650_0153763 Ga0500650_0153763_203_451 74
436 3300053100 Ga0500660_255233 Ga0500660_255233_183_440 74
437 3300053102 Ga0500554_006648 Ga0500554_006648_2186_2434 74
438 3300053104 Ga0500556_0001327 Ga0500556_0001327_7862_8122 74
439 3300053104 Ga0500556_0134747 Ga0500556_0134747_417_665 74
440 3300053122 Ga0500608_032397 Ga0500608_032397_1673_1921 74
441 3300053123 Ga0500614_006224 Ga0500614_006224_1352_1600 74
442 3300053125 Ga0500618_000240 Ga0500618_000240_5633_5896 74
443 3300053134 Ga0500658_0001685 Ga0500658_0001685_7676_7936 74
444 3300053134 Ga0500658_0414853 Ga0500658_0414853_342_590 74
445 3300053136 Ga0500559_0000031 Ga0500559_0000031_40547_40810 74
446 3300053142 Ga0500577_0000365 Ga0500577_0000365_9307_9579 74
447 3300053153 Ga0500616_0010493 Ga0500616_0010493_1659_1907 74
448 3300053156 Ga0500622_0003880 Ga0500622_0003880_7394_7642 74
449 3300053156 Ga0500622_0030979 Ga0500622_0030979_175_438 74
450 3300053158 Ga0500627_0123465 Ga0500627_0123465_25_273 74
451 3300053727 Ga0500611_047085 Ga0500611_047085_564_812 74
452 3300053730 Ga0500645_009516 Ga0500645_009516_2893_3153 74
453 3300053731 Ga0500609_011115 Ga0500609_011115_215_472 74
454 3300053736 Ga0500599_096087 Ga0500599_096087_37_285 74

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13443

HTH_26

Cro/C1-type HTH DNA-binding domain

6

68

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xj3-assembly1.cif.gz_B high resolution structure of the t55c mutant of cylr2. 0.9441 4 65
3bs3-assembly1.cif.gz_A-2 crystal structure of a putative dna-binding protein from bacteroides fragilis 0.9427 3 64
3f51-assembly1.cif.gz_A crystal structure of the clp gene regulator clgr from corynebacterium glutamicum 0.9372 7 61
3f52-assembly1.cif.gz_E crystal structure of the clp gene regulator clgr from c. glutamicum 0.9268 7 61
3bs3-assembly1.cif.gz_A-2 crystal structure of a putative dna-binding protein from bacteroides fragilis 0.9144 3 64
ID Description Score Start End Superfamily
3f51A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9372 7 61 1.10.260.40
3f51C00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9317 7 61 1.10.260.40
3f52E00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.9268 7 61 1.10.260.40
3f52A00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8996 7 61 1.10.260.40
2lykB00 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.8976 3 68 1.10.260.40
ID Description Score Start End GO Terms
AF-A0A2M8WQ62-F1-model_v4 Xre family transcriptional regulator 0.9882 3 64 GO:0003677
AF-A4EFA9-F1-model_v4 Transcriptional regulator, XRE family protein 0.9854 3 64 GO:0003677
AF-A0A1H9FDC5-F1-model_v4 Putative transcriptional regulator 0.9852 3 65 GO:0003677
AF-A0A2D0LDB8-F1-model_v4 HTH cro/C1-type domain-containing protein 0.9813 3 64 GO:0003677
AF-A0A7Y0EYJ2-F1-model_v4 XRE family transcriptional regulator 0.9809 3 65 GO:0003677

Feature Viewer

pLDDT pTM Quality
81.6 0.65 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map