F447489

General Info

Members Datasets Scaffolds Average Seq Length
455 271 896 314

Family's Representative Sequence

Representative Sequence 3300001979|JGI24740J21852_10000597|JGI24740J21852_100005979
Length 379
Sequence VSAGAPPAAGLFDCRDAFARAIETLAADDGRIVAVVNDSVGSSKLGKFRDRFPDRLVNVGIAEQNMVGVGAGLANGGKIPFVSGAACFLTARALEQIKADIVYSNANVKLCGISSGVAYGELGATHHSIEDLTWLRTMRELTVIVPSDPSETEAAIRAAAAQEGPVFIRISRMPVPELDHRVPFAIGRAEVLRDGNDVAIIATGTLVHRALDAADRLAARGVAARVVNMATIAPLDEESVLAAARDTGAIVTAEEHVVRGGLGGAVAEIVATRHPVPMRILGFDGXQPTGSAEWLMARAGLTADGXARAAQELLDQRRGXCPPARYWRSIRGRPXXRHCWSMXSAXFSRAPIGRWHLCIRSRAGPNSRPPTSGPAFSKS

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
14 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
84 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
85 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
87 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
88 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
89 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
92 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
93 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
139 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
145 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
152 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
157 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
163 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
164 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
165 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
166 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
167 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
168 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
174 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
175 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
176 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
177 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
178 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
179 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
180 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
181 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
182 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
183 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
184 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
185 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
186 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
190 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
191 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
192 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
195 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
196 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
197 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
198 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
199 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
208 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
211 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
215 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
216 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
217 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
218 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
219 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
231 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
232 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
233 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
234 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
235 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
236 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
237 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
238 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
239 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
240 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
241 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
244 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
245 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
246 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
247 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
248 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
249 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
250 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
251 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
252 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
253 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
254 2643221584 Caulobacter sp. Root656 Isolate Unclassified
255 2643221629 Devosia sp. Root105 Isolate Unclassified
256 2643221662 Devosia sp. Root413D1 Isolate Unclassified
257 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
258 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
259 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
260 2830075706 Sphingomonas jinjuensis DSM 21457 Isolate Rhizosphere
261 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
262 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
263 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
264 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
265 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
266 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
267 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
268 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
269 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
270 8054302542 Novosphingobium kaempferiae Sx8-5 Isolate Rhizosphere
271 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.16
Metatranscriptomes 0
Isolates 4.84

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.58
Nodule 0.22
Rhizoplane 3.74
Rhizosphere 71.87
Stem 0
Stem Tuber 0
Unclassified 0.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000597 3300001979 Bacteria 15636
2 JGI24741J21665_1000041 3300001915 Bacteria 30736
3 JGI24741J21665_1000598 3300001915 Bacteria 10949
4 JGI24740J21852_10000151 3300001979 Bacteria 27084
5 JGI24737J22298_10000135 3300001990 Bacteria 22638
6 JGI25150J39212_1000224 3300002774 Bacteria 30911
7 JGI25150J39212_1000521 3300002774 Bacteria 15743
8 JGI25165J46597_1009903 3300003214 Bacteria 1410
9 JGI25153J46596_10000005 3300003215 Bacteria 492839
10 JGI25153J46596_10000198 3300003215 Bacteria 56709
11 JGI25153J46596_10019281 3300003215 Bacteria 2619
12 Ga0055539_1002781 3300003752 Bacteria 2570
13 Ga0055525_1000012 3300003759 Bacteria 486564
14 Ga0055542_1000025 3300003762 Bacteria 263538
15 Ga0055529_1000014 3300003763 Bacteria 367283
16 Ga0055536_1002251 3300003781 Bacteria 10985
17 Ga0055536_1013981 3300003781 Bacteria 2851
18 Ga0055536_1037488 3300003781 Bacteria 1186
19 Ga0055530_10002720 3300003791 Bacteria 10977
20 Ga0055540_1002035 3300003792 Bacteria 11192
21 Ga0055540_1002397 3300003792 Bacteria 9967
22 Ga0055531_10000231 3300003794 Bacteria 61615
23 Ga0065165_1001941 3300005262 Bacteria 19688
24 Ga0065165_1006532 3300005262 Bacteria 6080
25 Ga0070658_10000246 3300005327 Bacteria 48141
26 Ga0070658_10018297 3300005327 Bacteria 5608
27 Ga0070676_10006352 3300005328 Bacteria 6315
28 Ga0068869_100239903 3300005334 Bacteria 1444
29 Ga0068869_100245802 3300005334 Bacteria 1427
30 Ga0070682_100024574 3300005337 Bacteria 3587
31 Ga0068868_100004725 3300005338 Bacteria 9566
32 Ga0070660_100003009 3300005339 Bacteria 11612
33 Ga0070660_100214568 3300005339 Bacteria 1563
34 Ga0070691_10030392 3300005341 Bacteria 2530
35 Ga0070661_100000533 3300005344 Bacteria 29189
36 Ga0070661_100003181 3300005344 Bacteria 11311
37 Ga0070668_100020136 3300005347 Bacteria 5031
38 Ga0070668_100158583 3300005347 Bacteria 1835
39 Ga0070671_100217023 3300005355 Bacteria 1623
40 Ga0070674_100000081 3300005356 Bacteria 44511
41 Ga0070674_100034171 3300005356 Bacteria 3393
42 Ga0070673_100046758 3300005364 Bacteria 3363
43 Ga0070659_100001823 3300005366 Bacteria 15331
44 Ga0070659_100010630 3300005366 Bacteria 6778
45 Ga0070659_100052687 3300005366 Bacteria 3201
46 Ga0070667_100028343 3300005367 Bacteria 4662
47 Ga0070709_10092683 3300005434 Bacteria 1996
48 Ga0070714_100246564 3300005435 Bacteria 1650
49 Ga0070713_100263649 3300005436 Bacteria 1575
50 Ga0070710_10206245 3300005437 Bacteria 1244
51 Ga0070708_100044612 3300005445 Bacteria 3900
52 Ga0070663_100000435 3300005455 Bacteria 22028
53 Ga0070678_100000195 3300005456 Bacteria 26717
54 Ga0070678_100288292 3300005456 Bacteria 1391
55 Ga0070662_100169929 3300005457 Bacteria 1711
56 Ga0068867_100007497 3300005459 Bacteria 7716
57 Ga0070707_100126358 3300005468 Bacteria 2485
58 Ga0070698_100309662 3300005471 Bacteria 1510
59 Ga0070699_100100070 3300005518 Bacteria 2541
60 Ga0070679_100012626 3300005530 Bacteria 8079
61 Ga0070679_100051183 3300005530 Bacteria 4114
62 Ga0068853_100001270 3300005539 Bacteria 18080
63 Ga0068853_100041067 3300005539 Bacteria 3950
64 Ga0070696_100158178 3300005546 Bacteria 1668
65 Ga0070665_100000226 3300005548 Bacteria 94176
66 Ga0070665_100118154 3300005548 Bacteria 2654
67 Ga0070665_100155531 3300005548 Bacteria 2288
68 Ga0070665_100178776 3300005548 Bacteria 2123
69 Ga0068855_100218557 3300005563 Bacteria 2138
70 Ga0070664_100011429 3300005564 Bacteria 7204
71 Ga0070664_100074682 3300005564 Bacteria 2910
72 Ga0068857_100001176 3300005577 Bacteria 20437
73 Ga0068854_100091212 3300005578 Bacteria 2267
74 Ga0068856_100013177 3300005614 Bacteria 8009
75 Ga0068856_100109388 3300005614 Bacteria 2760
76 Ga0068856_100445075 3300005614 Bacteria 1316
77 Ga0070702_100117950 3300005615 Bacteria 1657
78 Ga0068852_100000806 3300005616 Bacteria 20633
79 Ga0068852_100007942 3300005616 Bacteria 7776
80 Ga0068852_100591525 3300005616 Bacteria 1113
81 Ga0068861_100036176 3300005719 Bacteria 3663
82 Ga0068858_100370735 3300005842 Bacteria 1373
83 Ga0081455_10223546 3300005937 Bacteria 1393
84 Ga0081538_10003305 3300005981 Bacteria 15282
85 Ga0081540_1005728 3300005983 Bacteria 9214
86 Ga0081539_10011945 3300005985 Bacteria 6775
87 Ga0070717_10039995 3300006028 Bacteria 3817
88 Ga0070716_100025612 3300006173 Bacteria 3149
89 Ga0075367_10074672 3300006178 Bacteria 2044
90 Ga0097621_100003531 3300006237 Bacteria 10794
91 Ga0097621_100074978 3300006237 Bacteria 2803
92 Ga0075370_10043265 3300006353 Bacteria 2545
93 Ga0068871_100032140 3300006358 Bacteria 4142
94 Ga0105240_10004551 3300009093 Bacteria 21046
95 Ga0105245_10001280 3300009098 Bacteria 22677
96 Ga0105245_10078219 3300009098 Bacteria 3018
97 Ga0105243_10000863 3300009148 Bacteria 28651
98 Ga0105243_10109295 3300009148 Bacteria 2310
99 Ga0105241_10002276 3300009174 Bacteria 14440
100 Ga0105241_10119953 3300009174 Bacteria 2116
101 Ga0105248_10449918 3300009177 Bacteria 1451
102 Ga0105237_10001033 3300009545 Bacteria 37474
103 Ga0105237_10002521 3300009545 Bacteria 22685
104 Ga0105237_10003437 3300009545 Bacteria 18796
105 Ga0105237_10007942 3300009545 Bacteria 11561
106 Ga0105237_10046517 3300009545 Bacteria 4364
107 Ga0105237_10136550 3300009545 Bacteria 2446
108 Ga0105237_10492414 3300009545 Bacteria 1232
109 Ga0105238_10001576 3300009551 Bacteria 22849
110 Ga0105238_10002028 3300009551 Bacteria 20445
111 Ga0105238_10047374 3300009551 Bacteria 4335
112 Ga0105238_10096714 3300009551 Bacteria 2938
113 Ga0105238_10272336 3300009551 Bacteria 1674
114 Ga0105239_10002583 3300010375 Bacteria 22930
115 Ga0105239_10008592 3300010375 Bacteria 11582
116 Ga0105239_10009696 3300010375 Bacteria 10827
117 Ga0105246_10081813 3300011119 Bacteria 2303
118 Ga0157373_10001113 3300013100 Bacteria 20630
119 Ga0157373_10001141 3300013100 Bacteria 20445
120 Ga0157373_10299631 3300013100 Bacteria 1141
121 Ga0157371_10000114 3300013102 Bacteria 122406
122 Ga0157370_10001936 3300013104 Bacteria 25490
123 Ga0157370_10010898 3300013104 Bacteria 9547
124 Ga0157370_10031003 3300013104 Bacteria 5235
125 Ga0157370_10083569 3300013104 Bacteria 3002
126 Ga0157369_10001750 3300013105 Bacteria 26329
127 Ga0157369_10006343 3300013105 Bacteria 13725
128 Ga0157369_10007068 3300013105 Bacteria 12944
129 Ga0157369_10009171 3300013105 Bacteria 11319
130 Ga0157369_10045664 3300013105 Bacteria 4763
131 Ga0157374_10010230 3300013296 Bacteria 8068
132 Ga0157378_10121021 3300013297 Bacteria 2413
133 Ga0157378_10127181 3300013297 Bacteria 2355
134 Ga0157372_10001504 3300013307 Bacteria 25339
135 Ga0157372_10001828 3300013307 Bacteria 23062
136 Ga0157372_10034086 3300013307 Bacteria 5595
137 Ga0157372_10061035 3300013307 Bacteria 4220
138 Ga0157376_10027001 3300014969 Bacteria 4546
139 Ga0163161_10090722 3300017792 Bacteria 2261
140 Ga0213873_10006391 3300021358 Bacteria 2316
141 Ga0213871_10003155 3300021441 Bacteria 3139
142 Ga0209563_100030 3300025230 Bacteria 489259
143 Ga0207427_101287 3300025231 Bacteria 9520
144 Ga0207425_1000016 3300025245 Bacteria 428169
145 Ga0209026_1012640 3300025250 Bacteria 1464
146 Ga0209677_101186 3300025253 Bacteria 11953
147 Ga0209148_1000011 3300025254 Bacteria 1196503
148 Ga0209129_1000596 3300025258 Bacteria 24634
149 Ga0209233_1000320 3300025261 Bacteria 52300
150 Ga0209455_1000006 3300025272 Bacteria 1196503
151 Ga0209676_1000087 3300025292 Bacteria 263734
152 Ga0209676_1000136 3300025292 Bacteria 181860
153 Ga0209676_1010262 3300025292 Bacteria 3930
154 Ga0209676_1012678 3300025292 Bacteria 3289
155 Ga0209025_1000396 3300025294 Bacteria 89775
156 Ga0209758_1000001 3300025297 Bacteria 1981790
157 Ga0209758_1000009 3300025297 Bacteria 1123483
158 Ga0209758_1000246 3300025297 Bacteria 111041
159 Ga0209050_1000005 3300025298 Bacteria 1557793
160 Ga0209050_1000083 3300025298 Bacteria 263734
161 Ga0209050_1000238 3300025298 Bacteria 119729
162 Ga0209256_1026748 3300025299 Bacteria 1656
163 Ga0209051_1000100 3300025303 Bacteria 165053
164 Ga0209051_1008068 3300025303 Bacteria 5635
165 Ga0209257_1000142 3300025304 Bacteria 200756
166 Ga0209257_1000896 3300025304 Bacteria 41831
167 Ga0209257_1001045 3300025304 Bacteria 36833
168 Ga0209257_1003367 3300025304 Bacteria 13806
169 Ga0209257_1003370 3300025304 Bacteria 13803
170 Ga0207656_10000141 3300025321 Bacteria 26826
171 Ga0207692_10025603 3300025898 Bacteria 2758
172 Ga0207692_10095332 3300025898 Bacteria 1622
173 Ga0207688_10106146 3300025901 Bacteria 1626
174 Ga0207647_10002328 3300025904 Bacteria 14426
175 Ga0207645_10019260 3300025907 Bacteria 4476
176 Ga0207705_10000551 3300025909 Bacteria 31496
177 Ga0207705_10000705 3300025909 Bacteria 27607
178 Ga0207705_10044680 3300025909 Bacteria 3183
179 Ga0207654_10000349 3300025911 Bacteria 27494
180 Ga0207695_10001536 3300025913 Bacteria 38107
181 Ga0207695_10002719 3300025913 Bacteria 25820
182 Ga0207695_10003407 3300025913 Bacteria 22456
183 Ga0207695_10061135 3300025913 Bacteria 3895
184 Ga0207671_10000440 3300025914 Bacteria 57127
185 Ga0207671_10001253 3300025914 Bacteria 29926
186 Ga0207671_10003159 3300025914 Bacteria 16672
187 Ga0207671_10006042 3300025914 Bacteria 10925
188 Ga0207693_10102480 3300025915 Bacteria 2245
189 Ga0207657_10000819 3300025919 Bacteria 32829
190 Ga0207657_10134597 3300025919 Bacteria 2023
191 Ga0207649_10000104 3300025920 Bacteria 69778
192 Ga0207649_10011467 3300025920 Bacteria 4888
193 Ga0207694_10001782 3300025924 Bacteria 17996
194 Ga0207694_10003290 3300025924 Bacteria 12864
195 Ga0207694_10166534 3300025924 Bacteria 1783
196 Ga0207687_10003433 3300025927 Bacteria 10680
197 Ga0207687_10065776 3300025927 Bacteria 2575
198 Ga0207700_10039299 3300025928 Bacteria 3443
199 Ga0207664_10055813 3300025929 Bacteria 3135
200 Ga0207644_10144396 3300025931 Bacteria 1836
201 Ga0207644_10258393 3300025931 Bacteria 1392
202 Ga0207690_10000335 3300025932 Bacteria 31382
203 Ga0207706_10010705 3300025933 Bacteria 8377
204 Ga0207709_10000039 3300025935 Bacteria 260127
205 Ga0207669_10000088 3300025937 Bacteria 46536
206 Ga0207669_10003163 3300025937 Bacteria 7100
207 Ga0207679_10041587 3300025945 Bacteria 3297
208 Ga0207679_10091544 3300025945 Bacteria 2354
209 Ga0207667_10000001 3300025949 Bacteria 1178522
210 Ga0207667_10001349 3300025949 Bacteria 30809
211 Ga0207667_10008420 3300025949 Bacteria 12258
212 Ga0207667_10013095 3300025949 Bacteria 9519
213 Ga0207667_10194694 3300025949 Bacteria 2080
214 Ga0207651_10016880 3300025960 Bacteria 4294
215 Ga0207668_10076859 3300025972 Bacteria 2405
216 Ga0207640_10000431 3300025981 Bacteria 25680
217 Ga0207640_10076262 3300025981 Bacteria 2275
218 Ga0207677_10026927 3300026023 Bacteria 3613
219 Ga0207639_10000351 3300026041 Bacteria 31842
220 Ga0207639_10000893 3300026041 Bacteria 20232
221 Ga0207639_10012921 3300026041 Bacteria 5825
222 Ga0207639_10149910 3300026041 Bacteria 1952
223 Ga0207678_10001047 3300026067 Bacteria 25287
224 Ga0207678_10001617 3300026067 Bacteria 20730
225 Ga0207678_10099970 3300026067 Bacteria 2478
226 Ga0207702_10000971 3300026078 Bacteria 29379
227 Ga0207702_10015824 3300026078 Bacteria 6245
228 Ga0207702_10026281 3300026078 Bacteria 4832
229 Ga0207702_10170805 3300026078 Bacteria 1994
230 Ga0207676_10007283 3300026095 Bacteria 7842
231 Ga0207674_10002228 3300026116 Bacteria 24551
232 Ga0207674_10002615 3300026116 Bacteria 22570
233 Ga0207674_10108561 3300026116 Bacteria 2751
234 Ga0207683_10000638 3300026121 Bacteria 32038
235 Ga0207683_10063381 3300026121 Bacteria 3256
236 Ga0207698_10000492 3300026142 Bacteria 23058
237 Ga0207698_10008937 3300026142 Bacteria 6356
238 Ga0207698_10042271 3300026142 Bacteria 3403
239 Ga0268266_10000002 3300028379 Bacteria 3059047
240 Ga0268266_10067973 3300028379 Bacteria 3085
241 Ga0268266_10285131 3300028379 Bacteria 1537
242 Ga0307517_10018539 3300028786 Bacteria 8995
243 Ga0307515_10234249 3300028794 Bacteria 1621
244 Ga0307515_10324813 3300028794 Bacteria 1202
245 Ga0265338_10035865 3300028800 Bacteria 4756
246 Ga0265330_10018089 3300031235 Bacteria 3239
247 Ga0265325_10002923 3300031241 Bacteria 11381
248 Ga0265325_10009788 3300031241 Bacteria 5583
249 Ga0265325_10009980 3300031241 Bacteria 5521
250 Ga0265325_10010566 3300031241 Bacteria 5341
251 Ga0265340_10022097 3300031247 Bacteria 3255
252 Ga0265340_10067478 3300031247 Bacteria 1700
253 Ga0265339_10015608 3300031249 Bacteria 4548
254 Ga0307513_10021749 3300031456 Bacteria 7566
255 Ga0265313_10003242 3300031595 Bacteria 13370
256 Ga0265313_10003564 3300031595 Bacteria 12517
257 Ga0307508_10013093 3300031616 Bacteria 7585
258 Ga0265314_10085804 3300031711 Bacteria 2063
259 Ga0265342_10002560 3300031712 Bacteria 15603
260 Ga0265342_10143184 3300031712 Bacteria 1332
261 Ga0307516_10055106 3300031730 Bacteria 3883
262 Ga0307412_10004861 3300031911 Bacteria 7501
263 Ga0307416_100382068 3300032002 Bacteria 1439
264 Ga0307415_100319871 3300032126 Bacteria 1293
265 Ga0307507_10062541 3300033179 Bacteria 3456
266 Ga0307510_10000694 3300033180 Bacteria 34508
267 Ga0307510_10183083 3300033180 Bacteria 1655
268 Ga0373931_0059758 3300035691 Bacteria 2051
269 Ga0395900_0004655 3300037418 Bacteria 14474
270 Ga0395898_0078819 3300037466 Unclassified 3178
271 Ga0436364_1172241 3300037853 Bacteria 1560
272 Ga0395901_0011476 3300038443 Bacteria 8979
273 Ga0395901_0196906 3300038443 Bacteria 2113
274 Ga0395901_0453832 3300038443 Bacteria 1311
275 Ga0436365_1730081 3300039437 Bacteria 3141
276 Ga0436360_0189047 3300039438 Bacteria 1377
277 Ga0436360_0262678 3300039438 Bacteria 5055
278 Ga0436360_0506615 3300039438 Bacteria 3227
279 Ga0436360_1047685 3300039438 Bacteria 1917
280 Ga0436361_0849820 3300039447 Bacteria 1398
281 Ga0436361_0981288 3300039447 Bacteria 8722
282 Ga0436363_1692828 3300039450 Bacteria 2676
283 Ga0436362_0630374 3300039453 Bacteria 2743
284 Ga0436362_1248143 3300039453 Bacteria 3222
285 Ga0439436_0014182 3300041404 Bacteria 2407
286 Ga0451795_0766160 3300041456 Bacteria 1049
287 Ga0439445_0004835 3300042004 Bacteria 3058
288 Ga0439445_0014711 3300042004 Bacteria 1908
289 Ga0466969_0130049 3300044656 Bacteria 1168
290 Ga0466964_0109631 3300044706 Bacteria 1229
291 Ga0466959_0034775 3300045049 Bacteria 3727
292 Ga0466958_0023272 3300045836 Bacteria 3634
293 Ga0466967_0008093 3300045976 Bacteria 7667
294 Ga0466967_0214571 3300045976 Bacteria 1826
295 Ga0495638_0000733 3300046460 Bacteria 35276
296 Ga0495638_0014671 3300046460 Bacteria 5286
297 Ga0495650_0000192 3300046471 Bacteria 131943
298 Ga0495584_0071613 3300046491 Bacteria 1742
299 Ga0495585_0000339 3300046492 Bacteria 45404
300 Ga0495585_0059005 3300046492 Bacteria 2116
301 Ga0495596_0006608 3300046500 Bacteria 5321
302 Ga0495583_0000248 3300046506 Bacteria 89173
303 Ga0495583_0000785 3300046506 Bacteria 39590
304 Ga0495606_0006388 3300046507 Bacteria 10888
305 Ga0495606_0035498 3300046507 Bacteria 3407
306 Ga0495610_0000445 3300046512 Bacteria 42633
307 Ga0495616_0000025 3300046513 Bacteria 142511
308 Ga0495616_0089964 3300046513 Bacteria 1455
309 Ga0495631_0015192 3300046518 Bacteria 3697
310 Ga0495631_0044484 3300046518 Bacteria 1956
311 Ga0495637_0004287 3300046520 Bacteria 7405
312 Ga0495637_0016319 3300046520 Bacteria 3473
313 Ga0495643_0000434 3300046522 Bacteria 54356
314 Ga0495643_0003038 3300046522 Bacteria 12616
315 Ga0495643_0003990 3300046522 Bacteria 10549
316 Ga0495648_0000266 3300046524 Bacteria 58974
317 Ga0495648_0003212 3300046524 Bacteria 14502
318 Ga0495648_0022419 3300046524 Bacteria 4347
319 Ga0495648_0060966 3300046524 Bacteria 2242
320 Ga0495663_0001349 3300046525 Bacteria 7747
321 Ga0495622_0202663 3300046557 Bacteria 884
322 Ga0495633_0000148 3300046558 Bacteria 93134
323 Ga0495633_0000427 3300046558 Bacteria 43836
324 Ga0495668_0000016 3300046616 Bacteria 438197
325 Ga0495668_0000037 3300046616 Bacteria 233981
326 Ga0495668_0013540 3300046616 Bacteria 4807
327 Ga0495668_0027165 3300046616 Bacteria 3243
328 Ga0495611_0006249 3300046648 Bacteria 5083
329 Ga0495625_0000106 3300046660 Bacteria 125985
330 Ga0495625_0017832 3300046660 Bacteria 5549
331 Ga0495625_0020743 3300046660 Bacteria 5066
332 Ga0495625_0025836 3300046660 Unclassified 4446
333 Ga0495625_0047232 3300046660 Bacteria 3105
334 Ga0495625_0072192 3300046660 Bacteria 2421
335 Ga0495625_0191517 3300046660 Bacteria 1354
336 Ga0495661_0006197 3300046665 Bacteria 8420
337 Ga0495669_0000052 3300046684 Bacteria 79328
338 Ga0495670_0005860 3300046691 Bacteria 6024
339 Ga0495670_0034953 3300046691 Bacteria 2504
340 Ga0495670_0049147 3300046691 Bacteria 2110
341 Ga0495670_0075995 3300046691 Bacteria 1706
342 Ga0495660_0023015 3300046810 Bacteria 3555
343 Ga0495660_0068808 3300046810 Bacteria 1883
344 Ga0495660_0116606 3300046810 Bacteria 1356
345 Ga0495683_0014391 3300047323 Bacteria 4121
346 Ga0495687_000068 3300047443 Bacteria 161081
347 Ga0495687_000335 3300047443 Bacteria 60311
348 Ga0495677_0003552 3300047445 Bacteria 6049
349 Ga0495673_0000567 3300047469 Bacteria 37594
350 Ga0495673_0019553 3300047469 Bacteria 3391
351 Ga0495681_0000047 3300047470 Bacteria 110934
352 Ga0495681_0006966 3300047470 Bacteria 7322
353 Ga0495681_0053314 3300047470 Bacteria 1894
354 Ga0495686_0004994 3300047472 Bacteria 10666
355 Ga0495593_0053266 3300047673 Bacteria 2136
356 Ga0496102_0389989 3300048905 Bacteria 1310
357 Ga0496103_0199502 3300048906 Bacteria 1287
358 Ga0496104_0024634 3300048907 Bacteria 5536
359 Ga0496108_0024789 3300048911 Bacteria 4939
360 Ga0496109_0006922 3300048912 Bacteria 9567
361 Ga0496109_0023520 3300048912 Bacteria 5471
362 Ga0496109_0122317 3300048912 Bacteria 2425
363 Ga0496110_0017134 3300048913 Bacteria 6057
364 Ga0496110_0020377 3300048913 Bacteria 5600
365 Ga0496111_0024241 3300048914 Bacteria 4270
366 Ga0496111_0130642 3300048914 Bacteria 1858
367 Ga0496112_0040664 3300048915 Bacteria 4546
368 Ga0496113_0024998 3300048916 Bacteria 4252
369 Ga0496114_0297296 3300048917 Bacteria 1425
370 Ga0496115_0292434 3300048918 Bacteria 1336
371 Ga0496118_0012300 3300048921 Bacteria 8236
372 Ga0496118_0169171 3300048921 Bacteria 1338
373 Ga0496121_0000112 3300048924 Bacteria 183480
374 Ga0496121_0033409 3300048924 Bacteria 4654
375 Ga0496124_0009927 3300048927 Bacteria 9731
376 Ga0496124_0020817 3300048927 Bacteria 6053
377 Ga0496125_0007104 3300048928 Bacteria 11953
378 Ga0496126_0003182 3300048929 Bacteria 21115
379 Ga0496126_0021048 3300048929 Bacteria 6381
380 Ga0495678_061781 3300049459 Bacteria 1404
381 Ga0501034_0068345 3300049571 Bacteria 3563
382 Ga0501034_0068929 3300049571 Bacteria 3548
383 Ga0501034_0071231 3300049571 Bacteria 3486
384 Ga0501034_0368211 3300049571 Bacteria 1363
385 Ga0501037_0154254 3300049573 Bacteria 1640
386 Ga0501039_0186818 3300049575 Bacteria 1630
387 Ga0501043_0201459 3300049579 Bacteria 1545
388 Ga0501047_0118161 3300049581 Bacteria 2533
389 Ga0501047_0124983 3300049581 Bacteria 2453
390 Ga0501047_0282600 3300049581 Bacteria 1504
391 Ga0501070_0119266 3300049586 Bacteria 2180
392 Ga0501070_0143493 3300049586 Bacteria 1971
393 Ga0501080_0085738 3300049742 Bacteria 2926
394 Ga0501035_0007519 3300049822 Bacteria 10180
395 Ga0501035_0151137 3300049822 Bacteria 2015
396 Ga0501035_0197413 3300049822 Bacteria 1727
397 Ga0501035_0303697 3300049822 Bacteria 1344
398 Ga0501044_0076480 3300049823 Bacteria 3397
399 Ga0501044_0225976 3300049823 Bacteria 1821
400 Ga0501044_0264590 3300049823 Bacteria 1657
401 nmdc:mga07m45_35964_c1 3300050496 Bacteria 2756
402 nmdc:mga05p37_165799_c1 3300050507 Bacteria 2696
403 Ga0500610_0000131 3300053079 Bacteria 22564
404 Ga0500643_000377 3300053087 Bacteria 34750
405 Ga0500644_0000012 3300053088 Bacteria 117525
406 Ga0500555_000127 3300053103 Bacteria 36304
407 Ga0500572_000039 3300053111 Bacteria 40615
408 Ga0500594_0035919 3300053118 Bacteria 1331
409 Ga0500595_000214 3300053119 Bacteria 39457
410 Ga0500595_003553 3300053119 Bacteria 7241
411 Ga0500595_035931 3300053119 Bacteria 1628
412 Ga0500608_000060 3300053122 Bacteria 48113
413 Ga0500658_0000119 3300053134 Bacteria 37530
414 Ga0500559_0000120 3300053136 Bacteria 61423
415 Ga0500559_0005693 3300053136 Bacteria 5702
416 Ga0500564_000036 3300053138 Bacteria 38057
417 Ga0500604_0000100 3300053151 Bacteria 27107
418 Ga0500604_0018349 3300053151 Bacteria 1949
419 Ga0500616_0014659 3300053153 Bacteria 4498
420 Ga0500622_0030406 3300053156 Bacteria 2835
421 Ga0500634_0000001 3300053161 Bacteria 258285
422 Ga0500639_011215 3300053163 Bacteria 4701
423 Ga0500636_0002352 3300053177 Bacteria 10495
424 Ga0500645_000002 3300053730 Bacteria 388892
425 Ga0500596_006695 3300053735 Bacteria 1932
426 Ga0500661_011621 3300055283 Bacteria 1591
427 2585152709 2582581280 Bacteria 5994497
428 2585196422 2582581293 Bacteria 5907401
429 2600200976 2599185354 Bacteria 4398675
430 2643779666 2643221552 Bacteria 5708754
431 2643931737 2643221584 Bacteria 5511711
432 2644168322 2643221629 Bacteria 5850260
433 2644351155 2643221662 Bacteria 5851492
434 2739793835 2739367756 Bacteria 4553612
435 2753765610 2751185897 Bacteria 5322941
436 2819645253 2818991454 Bacteria 5563326
437 2830075787 2830075706 Bacteria 3855215
438 2848299272 2848297114 Bacteria 3608511
439 2857506920 2857504554 Bacteria 5369913
440 2876763304 2876761206 Bacteria 10111113
441 2884964125 2884960567 Bacteria 5437054
442 2887444871 2887443736 Bacteria 4426037
443 2919142999 2919138771 Bacteria 5281312
444 2928104489 2928100450 Bacteria 4837635
445 2928531562 2928531327 Bacteria 5101314
446 2946791325 2946787523 Bacteria 4366789
447 8054304538 8054302542 Bacteria 5698134
448 8057104333 8057101203 Bacteria 5034064
449 JGI24740J21852_10000597
450 JGI24741J21665_1000041
451 JGI24741J21665_1000598
452 JGI24740J21852_10000151
453 JGI24737J22298_10000135
454 JGI25150J39212_1000224
455 JGI25150J39212_1000521
456 JGI25165J46597_1009903
457 JGI25153J46596_10000005
458 JGI25153J46596_10000198
459 JGI25153J46596_10019281
460 Ga0055539_1002781
461 Ga0055525_1000012
462 Ga0055542_1000025
463 Ga0055529_1000014
464 Ga0055536_1002251
465 Ga0055536_1013981
466 Ga0055536_1037488
467 Ga0055530_10002720
468 Ga0055540_1002035
469 Ga0055540_1002397
470 Ga0055531_10000231
471 Ga0065165_1001941
472 Ga0065165_1006532
473 Ga0070658_10000246
474 Ga0070658_10018297
475 Ga0070676_10006352
476 Ga0068869_100239903
477 Ga0068869_100245802
478 Ga0070682_100024574
479 Ga0068868_100004725
480 Ga0070660_100003009
481 Ga0070660_100214568
482 Ga0070691_10030392
483 Ga0070661_100000533
484 Ga0070661_100003181
485 Ga0070668_100020136
486 Ga0070668_100158583
487 Ga0070671_100217023
488 Ga0070674_100000081
489 Ga0070674_100034171
490 Ga0070673_100046758
491 Ga0070659_100001823
492 Ga0070659_100010630
493 Ga0070659_100052687
494 Ga0070667_100028343
495 Ga0070709_10092683
496 Ga0070714_100246564
497 Ga0070713_100263649
498 Ga0070710_10206245
499 Ga0070708_100044612
500 Ga0070663_100000435
501 Ga0070678_100000195
502 Ga0070678_100288292
503 Ga0070662_100169929
504 Ga0068867_100007497
505 Ga0070707_100126358
506 Ga0070698_100309662
507 Ga0070699_100100070
508 Ga0070679_100012626
509 Ga0070679_100051183
510 Ga0068853_100001270
511 Ga0068853_100041067
512 Ga0070696_100158178
513 Ga0070665_100000226
514 Ga0070665_100118154
515 Ga0070665_100155531
516 Ga0070665_100178776
517 Ga0068855_100218557
518 Ga0070664_100011429
519 Ga0070664_100074682
520 Ga0068857_100001176
521 Ga0068854_100091212
522 Ga0068856_100013177
523 Ga0068856_100109388
524 Ga0068856_100445075
525 Ga0070702_100117950
526 Ga0068852_100000806
527 Ga0068852_100007942
528 Ga0068852_100591525
529 Ga0068861_100036176
530 Ga0068858_100370735
531 Ga0081455_10223546
532 Ga0081538_10003305
533 Ga0081540_1005728
534 Ga0081539_10011945
535 Ga0070717_10039995
536 Ga0070716_100025612
537 Ga0075367_10074672
538 Ga0097621_100003531
539 Ga0097621_100074978
540 Ga0075370_10043265
541 Ga0068871_100032140
542 Ga0105240_10004551
543 Ga0105245_10001280
544 Ga0105245_10078219
545 Ga0105243_10000863
546 Ga0105243_10109295
547 Ga0105241_10002276
548 Ga0105241_10119953
549 Ga0105248_10449918
550 Ga0105237_10001033
551 Ga0105237_10002521
552 Ga0105237_10003437
553 Ga0105237_10007942
554 Ga0105237_10046517
555 Ga0105237_10136550
556 Ga0105237_10492414
557 Ga0105238_10001576
558 Ga0105238_10002028
559 Ga0105238_10047374
560 Ga0105238_10096714
561 Ga0105238_10272336
562 Ga0105239_10002583
563 Ga0105239_10008592
564 Ga0105239_10009696
565 Ga0105246_10081813
566 Ga0157373_10001113
567 Ga0157373_10001141
568 Ga0157373_10299631
569 Ga0157371_10000114
570 Ga0157370_10001936
571 Ga0157370_10010898
572 Ga0157370_10031003
573 Ga0157370_10083569
574 Ga0157369_10001750
575 Ga0157369_10006343
576 Ga0157369_10007068
577 Ga0157369_10009171
578 Ga0157369_10045664
579 Ga0157374_10010230
580 Ga0157378_10121021
581 Ga0157378_10127181
582 Ga0157372_10001504
583 Ga0157372_10001828
584 Ga0157372_10034086
585 Ga0157372_10061035
586 Ga0157376_10027001
587 Ga0163161_10090722
588 Ga0213873_10006391
589 Ga0213871_10003155
590 Ga0209563_100030
591 Ga0207427_101287
592 Ga0207425_1000016
593 Ga0209026_1012640
594 Ga0209677_101186
595 Ga0209148_1000011
596 Ga0209129_1000596
597 Ga0209233_1000320
598 Ga0209455_1000006
599 Ga0209676_1000087
600 Ga0209676_1000136
601 Ga0209676_1010262
602 Ga0209676_1012678
603 Ga0209025_1000396
604 Ga0209758_1000001
605 Ga0209758_1000009
606 Ga0209758_1000246
607 Ga0209050_1000005
608 Ga0209050_1000083
609 Ga0209050_1000238
610 Ga0209256_1026748
611 Ga0209051_1000100
612 Ga0209051_1008068
613 Ga0209257_1000142
614 Ga0209257_1000896
615 Ga0209257_1001045
616 Ga0209257_1003367
617 Ga0209257_1003370
618 Ga0207656_10000141
619 Ga0207692_10025603
620 Ga0207692_10095332
621 Ga0207688_10106146
622 Ga0207647_10002328
623 Ga0207645_10019260
624 Ga0207705_10000551
625 Ga0207705_10000705
626 Ga0207705_10044680
627 Ga0207654_10000349
628 Ga0207695_10001536
629 Ga0207695_10002719
630 Ga0207695_10003407
631 Ga0207695_10061135
632 Ga0207671_10000440
633 Ga0207671_10001253
634 Ga0207671_10003159
635 Ga0207671_10006042
636 Ga0207693_10102480
637 Ga0207657_10000819
638 Ga0207657_10134597
639 Ga0207649_10000104
640 Ga0207649_10011467
641 Ga0207694_10001782
642 Ga0207694_10003290
643 Ga0207694_10166534
644 Ga0207687_10003433
645 Ga0207687_10065776
646 Ga0207700_10039299
647 Ga0207664_10055813
648 Ga0207644_10144396
649 Ga0207644_10258393
650 Ga0207690_10000335
651 Ga0207706_10010705
652 Ga0207709_10000039
653 Ga0207669_10000088
654 Ga0207669_10003163
655 Ga0207679_10041587
656 Ga0207679_10091544
657 Ga0207667_10000001
658 Ga0207667_10001349
659 Ga0207667_10008420
660 Ga0207667_10013095
661 Ga0207667_10194694
662 Ga0207651_10016880
663 Ga0207668_10076859
664 Ga0207640_10000431
665 Ga0207640_10076262
666 Ga0207677_10026927
667 Ga0207639_10000351
668 Ga0207639_10000893
669 Ga0207639_10012921
670 Ga0207639_10149910
671 Ga0207678_10001047
672 Ga0207678_10001617
673 Ga0207678_10099970
674 Ga0207702_10000971
675 Ga0207702_10015824
676 Ga0207702_10026281
677 Ga0207702_10170805
678 Ga0207676_10007283
679 Ga0207674_10002228
680 Ga0207674_10002615
681 Ga0207674_10108561
682 Ga0207683_10000638
683 Ga0207683_10063381
684 Ga0207698_10000492
685 Ga0207698_10008937
686 Ga0207698_10042271
687 Ga0268266_10000002
688 Ga0268266_10067973
689 Ga0268266_10285131
690 Ga0307517_10018539
691 Ga0307515_10234249
692 Ga0307515_10324813
693 Ga0265338_10035865
694 Ga0265330_10018089
695 Ga0265325_10002923
696 Ga0265325_10009788
697 Ga0265325_10009980
698 Ga0265325_10010566
699 Ga0265340_10022097
700 Ga0265340_10067478
701 Ga0265339_10015608
702 Ga0307513_10021749
703 Ga0265313_10003242
704 Ga0265313_10003564
705 Ga0307508_10013093
706 Ga0265314_10085804
707 Ga0265342_10002560
708 Ga0265342_10143184
709 Ga0307516_10055106
710 Ga0307412_10004861
711 Ga0307416_100382068
712 Ga0307415_100319871
713 Ga0307507_10062541
714 Ga0307510_10000694
715 Ga0307510_10183083
716 Ga0373931_0059758
717 Ga0395900_0004655
718 Ga0395898_0078819
719 Ga0436364_1172241
720 Ga0395901_0011476
721 Ga0395901_0196906
722 Ga0395901_0453832
723 Ga0436365_1730081
724 Ga0436360_0189047
725 Ga0436360_0262678
726 Ga0436360_0506615
727 Ga0436360_1047685
728 Ga0436361_0849820
729 Ga0436361_0981288
730 Ga0436363_1692828
731 Ga0436362_0630374
732 Ga0436362_1248143
733 Ga0439436_0014182
734 Ga0451795_0766160
735 Ga0439445_0004835
736 Ga0439445_0014711
737 Ga0466969_0130049
738 Ga0466964_0109631
739 Ga0466959_0034775
740 Ga0466958_0023272
741 Ga0466967_0008093
742 Ga0466967_0214571
743 Ga0495638_0000733
744 Ga0495638_0014671
745 Ga0495650_0000192
746 Ga0495584_0071613
747 Ga0495585_0000339
748 Ga0495585_0059005
749 Ga0495596_0006608
750 Ga0495583_0000248
751 Ga0495583_0000785
752 Ga0495606_0006388
753 Ga0495606_0035498
754 Ga0495610_0000445
755 Ga0495616_0000025
756 Ga0495616_0089964
757 Ga0495631_0015192
758 Ga0495631_0044484
759 Ga0495637_0004287
760 Ga0495637_0016319
761 Ga0495643_0000434
762 Ga0495643_0003038
763 Ga0495643_0003990
764 Ga0495648_0000266
765 Ga0495648_0003212
766 Ga0495648_0022419
767 Ga0495648_0060966
768 Ga0495663_0001349
769 Ga0495622_0202663
770 Ga0495633_0000148
771 Ga0495633_0000427
772 Ga0495668_0000016
773 Ga0495668_0000037
774 Ga0495668_0013540
775 Ga0495668_0027165
776 Ga0495611_0006249
777 Ga0495625_0000106
778 Ga0495625_0017832
779 Ga0495625_0020743
780 Ga0495625_0025836
781 Ga0495625_0047232
782 Ga0495625_0072192
783 Ga0495625_0191517
784 Ga0495661_0006197
785 Ga0495669_0000052
786 Ga0495670_0005860
787 Ga0495670_0034953
788 Ga0495670_0049147
789 Ga0495670_0075995
790 Ga0495660_0023015
791 Ga0495660_0068808
792 Ga0495660_0116606
793 Ga0495683_0014391
794 Ga0495687_000068
795 Ga0495687_000335
796 Ga0495677_0003552
797 Ga0495673_0000567
798 Ga0495673_0019553
799 Ga0495681_0000047
800 Ga0495681_0006966
801 Ga0495681_0053314
802 Ga0495686_0004994
803 Ga0495593_0053266
804 Ga0496102_0389989
805 Ga0496103_0199502
806 Ga0496104_0024634
807 Ga0496108_0024789
808 Ga0496109_0006922
809 Ga0496109_0023520
810 Ga0496109_0122317
811 Ga0496110_0017134
812 Ga0496110_0020377
813 Ga0496111_0024241
814 Ga0496111_0130642
815 Ga0496112_0040664
816 Ga0496113_0024998
817 Ga0496114_0297296
818 Ga0496115_0292434
819 Ga0496118_0012300
820 Ga0496118_0169171
821 Ga0496121_0000112
822 Ga0496121_0033409
823 Ga0496124_0009927
824 Ga0496124_0020817
825 Ga0496125_0007104
826 Ga0496126_0003182
827 Ga0496126_0021048
828 Ga0495678_061781
829 Ga0501034_0068345
830 Ga0501034_0068929
831 Ga0501034_0071231
832 Ga0501034_0368211
833 Ga0501037_0154254
834 Ga0501039_0186818
835 Ga0501043_0201459
836 Ga0501047_0118161
837 Ga0501047_0124983
838 Ga0501047_0282600
839 Ga0501070_0119266
840 Ga0501070_0143493
841 Ga0501080_0085738
842 Ga0501035_0007519
843 Ga0501035_0151137
844 Ga0501035_0197413
845 Ga0501035_0303697
846 Ga0501044_0076480
847 Ga0501044_0225976
848 Ga0501044_0264590
849 nmdc:mga07m45_35964_c1
850 nmdc:mga05p37_165799_c1
851 Ga0500610_0000131
852 Ga0500643_000377
853 Ga0500644_0000012
854 Ga0500555_000127
855 Ga0500572_000039
856 Ga0500594_0035919
857 Ga0500595_000214
858 Ga0500595_003553
859 Ga0500595_035931
860 Ga0500608_000060
861 Ga0500658_0000119
862 Ga0500559_0000120
863 Ga0500559_0005693
864 Ga0500564_000036
865 Ga0500604_0000100
866 Ga0500604_0018349
867 Ga0500616_0014659
868 Ga0500622_0030406
869 Ga0500634_0000001
870 Ga0500639_011215
871 Ga0500636_0002352
872 Ga0500645_000002
873 Ga0500596_006695
874 Ga0500661_011621
875 2585152709
876 2585196422
877 2600200976
878 2643779666
879 2643931737
880 2644168322
881 2644351155
882 2739793835
883 2753765610
884 2819645253
885 2830075787
886 2848299272
887 2857506920
888 2876763304
889 2884964125
890 2887444871
891 2919142999
892 2928104489
893 2928531562
894 2946791325
895 8054304538
896 8057104333

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02779

Transket_pyr

Transketolase, pyrimidine binding domain

11

177

0.97

PF02780

Transketolase_C

Transketolase, C-terminal domain

187

305

0.94

PF22613

Transketolase_C_1

Transketolase-like TK C-terminal domain

186

278

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6yak-assembly1.cif.gz_DDD split gene transketolase, active alpha2beta2 heterotetramer 0.9446 13 315
6yaj-assembly1.cif.gz_AAA split gene transketolase, inactive beta4 tetramer 0.9276 14 315
6yaj-assembly1.cif.gz_BBB split gene transketolase, inactive beta4 tetramer 0.9273 14 315
6rjb-assembly1.cif.gz_A human transketolase variant t382e 0.9198 11 314
3ooy-assembly1.cif.gz_A crystal structure of human transketolase (tkt) 0.9182 11 313
ID Description Score Start End Superfamily
af_P29401_490_623_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9314 187 316 3.40.50.920
af_Q58092_3_181_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9202 11 179 3.40.50.970
af_P9WNS3_497_621_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9184 195 314 3.40.50.920
1ik6A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9116 184 283 3.40.50.920
2o1xD03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9099 187 313 3.40.50.920
ID Description Score Start End GO Terms
AF-A0A7C5FYV8-F1-model_v4 Transketolase family protein 0.9741 15 84
AF-A0A7X7W510-F1-model_v4 deleted 0.9739 184 315
AF-A0A7J4GRZ8-F1-model_v4 Transketolase family protein 0.9677 142 316 GO:0003824
AF-A0A3C0J3H1-F1-model_v4 Transketolase 0.9651 184 319 GO:0003824
AF-A0A3A9YUX4-F1-model_v4 Transketolase family protein 0.9643 11 316 GO:0000287
GO:0003824

Map