F447501

General Info

Members Datasets Scaffolds Average Seq Length
455 289 449 212

Family's Representative Sequence

Representative Sequence 3300003659|JGI25404J52841_10033200|JGI25404J52841_100332001
Length 247
Sequence VTFRGWPAEALEFYEGLEADNSKTYWTAHKTVYDDTVRRPMDELLAELEPEFGAGKVFRPYRDVRFSADKTPYKTHLGAWLERGGYIQLSATGLAAGRGMWMMSPEQLDRYRRAVAEERSGXELETVVAAVRKRGIDVMGHGVLRTAPRGYPRDHPRAELLRYKGLTAWRQWPVASWLGTATAKRRIVEFLHDARPLAEWLPPPPDRGVPARRAAAGRMARLPGSRGLTVRCGLSQDSVGRSPSQGS

Samples

Sample ID Description Type Environment
1 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
2 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
3 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
4 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
5 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
6 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
74 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
76 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
117 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
120 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
121 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
131 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
134 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
140 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
141 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
142 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
155 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
156 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
157 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
158 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
159 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
160 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
161 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
162 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
163 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
164 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
165 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
169 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
170 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
171 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
172 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
175 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
178 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
184 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
185 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
188 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
189 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
190 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
191 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
192 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
203 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
212 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
213 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
214 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
215 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
216 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
219 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
224 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
225 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
226 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
254 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
255 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
261 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
264 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
265 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
268 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
269 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
270 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
271 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
272 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
273 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
274 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
275 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
276 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
277 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
278 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
279 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
280 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
281 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
282 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
283 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
284 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
285 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
286 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
287 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
288 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
289 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.58
Metatranscriptomes 1.1
Isolates 1.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.03
Nodule 0
Rhizoplane 3.08
Rhizosphere 84.62
Stem 0
Stem Tuber 0
Unclassified 5.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10033200 3300003659 Bacteria 1100
2 Ga0070658_10019508 3300005327 Bacteria 5429
3 Ga0070683_100010464 3300005329 Bacteria 7976
4 Ga0070683_100109077 3300005329 Bacteria 2611
5 Ga0068869_100034859 3300005334 Bacteria 3564
6 Ga0070680_100328002 3300005336 Bacteria 1300
7 Ga0070680_100413938 3300005336 Bacteria 1150
8 Ga0068868_100002027 3300005338 Bacteria 13925
9 Ga0070660_100014123 3300005339 Bacteria 5750
10 Ga0070660_100027844 3300005339 Bacteria 4222
11 Ga0070689_100342980 3300005340 Bacteria 1251
12 Ga0070691_10033442 3300005341 Bacteria 2419
13 Ga0070661_100030114 3300005344 Bacteria 3920
14 Ga0070692_10138425 3300005345 Bacteria 1375
15 Ga0070668_100326618 3300005347 Bacteria 1293
16 Ga0070675_100000500 3300005354 Bacteria 26911
17 Ga0070674_100091864 3300005356 Bacteria 2193
18 Ga0070659_100003337 3300005366 Bacteria 11424
19 Ga0070659_100182654 3300005366 Bacteria 1722
20 Ga0070667_100033506 3300005367 Bacteria 4294
21 Ga0070714_100043437 3300005435 Bacteria 3801
22 Ga0070714_100408889 3300005435 Bacteria 1284
23 Ga0070713_100131660 3300005436 Bacteria 2206
24 Ga0070710_10091449 3300005437 Unclassified 1795
25 Ga0070701_10091645 3300005438 Bacteria 1666
26 Ga0070711_100021639 3300005439 Bacteria 4160
27 Ga0070711_100317886 3300005439 Bacteria 1243
28 Ga0070700_100009423 3300005441 Bacteria 5359
29 Ga0070700_100260295 3300005441 Unclassified 1249
30 Ga0070708_100005761 3300005445 Bacteria 9832
31 Ga0070708_100298374 3300005445 Unclassified 1517
32 Ga0070708_101119615 3300005445 Bacteria 737
33 Ga0070678_100737347 3300005456 Bacteria 890
34 Ga0070662_100056011 3300005457 Bacteria 2862
35 Ga0070662_100366621 3300005457 Bacteria 1183
36 Ga0070681_10294239 3300005458 Bacteria 1533
37 Ga0070706_100094458 3300005467 Bacteria 2775
38 Ga0070707_100085123 3300005468 Bacteria 3055
39 Ga0070698_100007998 3300005471 Bacteria 11433
40 Ga0070698_100071036 3300005471 Bacteria 3492
41 Ga0070698_100226180 3300005471 Bacteria 1804
42 Ga0070698_100237740 3300005471 Bacteria 1755
43 Ga0070699_100051236 3300005518 Bacteria 3574
44 Ga0070699_100786110 3300005518 Bacteria 871
45 Ga0070679_100006502 3300005530 Bacteria 10897
46 Ga0070679_101010296 3300005530 Bacteria 776
47 Ga0070684_100003092 3300005535 Bacteria 12419
48 Ga0070684_100073237 3300005535 Bacteria 3018
49 Ga0070684_100138351 3300005535 Bacteria 2201
50 Ga0070684_100215594 3300005535 Bacteria 1750
51 Ga0070672_100143544 3300005543 Bacteria 1971
52 Ga0070693_100333496 3300005547 Bacteria 1033
53 Ga0070664_100000986 3300005564 Bacteria 22287
54 Ga0068857_100001211 3300005577 Bacteria 20120
55 Ga0068857_100128827 3300005577 Bacteria 2281
56 Ga0068857_100914090 3300005577 Bacteria 842
57 Ga0070702_100021964 3300005615 Bacteria 3367
58 Ga0068852_100534966 3300005616 Bacteria 1170
59 Ga0068861_100072695 3300005719 Bacteria 2669
60 Ga0068870_10076526 3300005840 Bacteria 1838
61 Ga0068858_100015872 3300005842 Bacteria 7080
62 Ga0068858_100193277 3300005842 Bacteria 1923
63 Ga0068860_100027924 3300005843 Bacteria 5434
64 Ga0068860_100168323 3300005843 Bacteria 2116
65 Ga0068862_100177915 3300005844 Bacteria 1908
66 Ga0081455_10003875 3300005937 Bacteria 17041
67 Ga0081455_10099640 3300005937 Bacteria 2336
68 Ga0081540_1001693 3300005983 Bacteria 18703
69 Ga0075365_10083346 3300006038 Bacteria 2169
70 Ga0070716_100231925 3300006173 Unclassified 1247
71 Ga0070712_100059549 3300006175 Bacteria 2690
72 Ga0075369_10010928 3300006186 Bacteria 3558
73 Ga0075428_100195774 3300006844 Bacteria 2186
74 Ga0075431_100122852 3300006847 Bacteria 2679
75 Ga0105247_10253668 3300009101 Bacteria 1203
76 Ga0114129_10179868 3300009147 Bacteria 2878
77 Ga0114129_10385260 3300009147 Bacteria 1851
78 Ga0114129_10966714 3300009147 Bacteria 1075
79 Ga0105243_10031924 3300009148 Bacteria 4064
80 Ga0105248_10705870 3300009177 Bacteria 1138
81 Ga0105238_10204508 3300009551 Bacteria 1950
82 Ga0105239_10533776 3300010375 Bacteria 1335
83 Ga0105246_10372565 3300011119 Bacteria 1177
84 Ga0157370_10574005 3300013104 Bacteria 1033
85 Ga0157369_10022123 3300013105 Bacteria 7103
86 Ga0157369_10068838 3300013105 Bacteria 3803
87 Ga0157372_10146352 3300013307 Bacteria 2724
88 Ga0157375_10123325 3300013308 Bacteria 2703
89 Ga0163163_10711347 3300014325 Bacteria 1068
90 Ga0157380_10128298 3300014326 Bacteria 2160
91 Ga0206354_11326585 3300020081 Bacteria 1142
92 Ga0206353_11061338 3300020082 Bacteria 6422
93 Ga0213875_10022138 3300021388 Bacteria 3041
94 Ga0224712_10005748 3300022467 Bacteria 3486
95 Ga0224712_10006177 3300022467 Bacteria 3392
96 Ga0228598_1041020 3300024227 Bacteria 914
97 Ga0209051_1056713 3300025303 Bacteria 1260
98 Ga0207699_10006824 3300025906 Bacteria 5552
99 Ga0207705_10014673 3300025909 Bacteria 5635
100 Ga0207654_10110069 3300025911 Bacteria 1712
101 Ga0207707_10147590 3300025912 Bacteria 2056
102 Ga0207693_10037180 3300025915 Bacteria 3837
103 Ga0207693_10073550 3300025915 Bacteria 2676
104 Ga0207663_10074139 3300025916 Bacteria 2205
105 Ga0207660_10346958 3300025917 Bacteria 1189
106 Ga0207657_10035945 3300025919 Bacteria 4437
107 Ga0207657_10036640 3300025919 Bacteria 4389
108 Ga0207652_10869451 3300025921 Bacteria 798
109 Ga0207646_10040278 3300025922 Bacteria 4202
110 Ga0207694_10765190 3300025924 Bacteria 815
111 Ga0207650_10161077 3300025925 Bacteria 1778
112 Ga0207650_10432879 3300025925 Bacteria 1093
113 Ga0207700_10015863 3300025928 Bacteria 4985
114 Ga0207700_10047105 3300025928 Bacteria 3193
115 Ga0207700_10475428 3300025928 Bacteria 1104
116 Ga0207664_10019735 3300025929 Bacteria 4988
117 Ga0207664_10351357 3300025929 Bacteria 1305
118 Ga0207690_10010688 3300025932 Bacteria 5469
119 Ga0207690_10033030 3300025932 Bacteria 3324
120 Ga0207706_10219530 3300025933 Bacteria 1665
121 Ga0207709_10316457 3300025935 Bacteria 1166
122 Ga0207704_10026741 3300025938 Bacteria 3170
123 Ga0207704_10524473 3300025938 Bacteria 959
124 Ga0207665_10733723 3300025939 Bacteria 778
125 Ga0207691_10220169 3300025940 Bacteria 1646
126 Ga0207691_10643467 3300025940 Bacteria 896
127 Ga0207711_10079584 3300025941 Bacteria 2861
128 Ga0207689_10004013 3300025942 Bacteria 13390
129 Ga0207661_10004263 3300025944 Bacteria 10012
130 Ga0207661_10343126 3300025944 Bacteria 1346
131 Ga0207679_10006572 3300025945 Bacteria 7350
132 Ga0207679_10938181 3300025945 Bacteria 792
133 Ga0207667_10986228 3300025949 Bacteria 830
134 Ga0207668_10270290 3300025972 Bacteria 1389
135 Ga0207658_10032940 3300025986 Unclassified 3693
136 Ga0207658_10103659 3300025986 Bacteria 2234
137 Ga0207677_10004469 3300026023 Bacteria 7511
138 Ga0207703_10273348 3300026035 Bacteria 1532
139 Ga0207678_10404940 3300026067 Unclassified 1181
140 Ga0207708_10052587 3300026075 Bacteria 3102
141 Ga0207708_10931316 3300026075 Bacteria 753
142 Ga0207702_10195505 3300026078 Bacteria 1872
143 Ga0207674_10003876 3300026116 Bacteria 18233
144 Ga0207674_10043192 3300026116 Bacteria 4649
145 Ga0207675_100109349 3300026118 Bacteria 2608
146 Ga0207428_10017846 3300027907 Bacteria 6083
147 Ga0268266_10322303 3300028379 Bacteria 1447
148 Ga0268265_10026498 3300028380 Bacteria 4126
149 Ga0268265_10170652 3300028380 Bacteria 1859
150 Ga0268264_10036234 3300028381 Bacteria 4063
151 Ga0268264_10324020 3300028381 Bacteria 1458
152 Ga0307515_10011698 3300028794 Bacteria 16610
153 Ga0307515_10044959 3300028794 Bacteria 6802
154 Ga0307512_10011587 3300030522 Bacteria 8348
155 Ga0265763_1001652 3300030763 Bacteria 1619
156 Ga0307513_10008091 3300031456 Bacteria 13496
157 Ga0307513_10037676 3300031456 Bacteria 5379
158 Ga0307509_10005125 3300031507 Bacteria 18416
159 Ga0307508_10002757 3300031616 Bacteria 18304
160 Ga0307508_10021928 3300031616 Bacteria 5811
161 Ga0307508_10025556 3300031616 Bacteria 5353
162 Ga0307508_10220611 3300031616 Bacteria 1496
163 Ga0307516_10058944 3300031730 Bacteria 3735
164 Ga0307516_10376747 3300031730 Bacteria 1081
165 Ga0307405_10358539 3300031731 Bacteria 1127
166 Ga0307413_10144750 3300031824 Bacteria 1648
167 Ga0307410_10201890 3300031852 Bacteria 1518
168 Ga0307406_10024385 3300031901 Bacteria 3613
169 Ga0307406_10332497 3300031901 Bacteria 1180
170 Ga0307412_10411508 3300031911 Bacteria 1104
171 Ga0307409_100006402 3300031995 Bacteria 6916
172 Ga0307409_100070394 3300031995 Bacteria 2776
173 Ga0307416_100910672 3300032002 Bacteria 980
174 Ga0307411_10100664 3300032005 Bacteria 2043
175 Ga0307415_100070435 3300032126 Bacteria 2455
176 Ga0307415_100430122 3300032126 Bacteria 1135
177 Ga0307507_10036770 3300033179 Bacteria 4998
178 Ga0307510_10189027 3300033180 Bacteria 1610
179 Ga0373934_0021322 3300035086 Bacteria 2495
180 Ga0373923_0020328 3300035111 Bacteria 2578
181 Ga0373932_0055106 3300035112 Bacteria 1192
182 Ga0373953_0010932 3300035117 Bacteria 3172
183 Ga0373954_0029886 3300035118 Bacteria 2512
184 Ga0373954_0170861 3300035118 Bacteria 1065
185 Ga0373956_0015527 3300035119 Bacteria 3190
186 Ga0373957_0001523 3300035120 Bacteria 6308
187 Ga0373955_0090916 3300035172 Unclassified 1739
188 Ga0373962_0003019 3300035242 Bacteria 4029
189 Ga0373924_0050388 3300035410 Unclassified 1724
190 Ga0373935_0011081 3300035692 Bacteria 5416
191 Ga0373935_0025861 3300035692 Bacteria 3618
192 Ga0373935_0258731 3300035692 Bacteria 1220
193 Ga0373933_0079807 3300035724 Bacteria 2004
194 Ga0373947_0006055 3300035725 Bacteria 7049
195 Ga0373937_0076535 3300036401 Bacteria 3090
196 Ga0373925_0009209 3300037068 Bacteria 7187
197 Ga0373925_0010724 3300037068 Bacteria 6646
198 Ga0395899_0074869 3300037312 Bacteria 2473
199 Ga0395899_0085263 3300037312 Bacteria 2295
200 Ga0395900_0008596 3300037418 Bacteria 10491
201 Ga0395900_0012337 3300037418 Bacteria 8743
202 Ga0395900_0068819 3300037418 Bacteria 3638
203 Ga0395900_0069621 3300037418 Bacteria 3616
204 Ga0395900_0144012 3300037418 Bacteria 2438
205 Ga0395898_0002827 3300037466 Bacteria 19891
206 Ga0395898_0003667 3300037466 Bacteria 17067
207 Ga0395898_0027202 3300037466 Bacteria 5745
208 Ga0395898_0140182 3300037466 Bacteria 2315
209 Ga0395898_0400674 3300037466 Bacteria 1308
210 Ga0395905_0009412 3300037471 Bacteria 9552
211 Ga0395905_0043706 3300037471 Bacteria 4203
212 Ga0395905_0053428 3300037471 Bacteria 3781
213 Ga0395905_0287422 3300037471 Bacteria 1531
214 Ga0436364_0095977 3300037853 Bacteria 1282
215 Ga0436364_1245595 3300037853 Bacteria 3237
216 Ga0395901_0018621 3300038443 Bacteria 7092
217 Ga0395901_0026395 3300038443 Bacteria 5963
218 Ga0395901_0027670 3300038443 Bacteria 5828
219 Ga0395901_0105380 3300038443 Bacteria 2959
220 Ga0451837_1125836 3300041494 Bacteria 1723
221 Ga0466969_0350725 3300044656 Bacteria 668
222 Ga0466972_0013410 3300044658 Bacteria 4115
223 Ga0466965_0219396 3300044683 Bacteria 1013
224 Ga0466966_0019366 3300044684 Bacteria 4478
225 Ga0466966_0095742 3300044684 Bacteria 1839
226 Ga0466966_0159868 3300044684 Unclassified 1372
227 Ga0466961_0004577 3300044693 Bacteria 8683
228 Ga0466961_0063475 3300044693 Bacteria 2347
229 Ga0466961_0129429 3300044693 Bacteria 1582
230 Ga0466961_0158439 3300044693 Bacteria 1411
231 Ga0466961_0270398 3300044693 Bacteria 1041
232 Ga0466963_0044438 3300044694 Bacteria 2924
233 Ga0466963_0193641 3300044694 Bacteria 1420
234 Ga0466963_0303342 3300044694 Bacteria 1123
235 Ga0466971_0008099 3300044719 Bacteria 4583
236 Ga0466971_0073348 3300044719 Bacteria 1555
237 Ga0466968_0139231 3300044735 Bacteria 1109
238 Ga0466968_0349817 3300044735 Bacteria 718
239 Ga0466970_0007018 3300044765 Bacteria 5638
240 Ga0466970_0390640 3300044765 Bacteria 793
241 Ga0466957_0186560 3300044842 Bacteria 1356
242 Ga0466959_0018760 3300045049 Bacteria 5081
243 Ga0466959_0056595 3300045049 Unclassified 2861
244 Ga0466958_0013834 3300045836 Bacteria 4601
245 Ga0466958_0048562 3300045836 Bacteria 2565
246 Ga0466958_0064597 3300045836 Bacteria 2233
247 Ga0466958_0292296 3300045836 Bacteria 1045
248 Ga0466958_0319948 3300045836 Bacteria 997
249 Ga0466967_0006470 3300045976 Bacteria 8295
250 Ga0466967_0034191 3300045976 Bacteria 4312
251 Ga0466967_0087353 3300045976 Bacteria 2827
252 Ga0466967_1124831 3300045976 Bacteria 782
253 Ga0495627_035308 3300046453 Bacteria 1559
254 Ga0495592_0110276 3300046454 Bacteria 1948
255 Ga0495592_0226933 3300046454 Unclassified 1245
256 Ga0495603_0058289 3300046455 Bacteria 2284
257 Ga0495629_0000972 3300046459 Bacteria 23076
258 Ga0495629_0116181 3300046459 Bacteria 1865
259 Ga0495638_0068745 3300046460 Bacteria 2171
260 Ga0495651_0036575 3300046462 Bacteria 3822
261 Ga0495651_0170037 3300046462 Bacteria 1553
262 Ga0495653_0010111 3300046463 Bacteria 7720
263 Ga0495653_0084366 3300046463 Bacteria 2340
264 Ga0495580_0644674 3300046472 Bacteria 697
265 Ga0495582_0000274 3300046473 Bacteria 28739
266 Ga0495664_0134229 3300046477 Bacteria 1499
267 Ga0495607_0102262 3300046501 Bacteria 1533
268 Ga0495608_0015948 3300046511 Bacteria 5201
269 Ga0495618_0031346 3300046514 Bacteria 3325
270 Ga0495628_0142535 3300046516 Bacteria 1828
271 Ga0495630_0364898 3300046517 Bacteria 1106
272 Ga0495632_0067740 3300046519 Bacteria 1721
273 Ga0495643_0006729 3300046522 Bacteria 7523
274 Ga0495666_0163193 3300046526 Bacteria 1032
275 Ga0495652_0182748 3300046529 Unclassified 1607
276 Ga0495665_0002852 3300046531 Bacteria 9338
277 Ga0495665_0038699 3300046531 Bacteria 2542
278 Ga0495640_0046137 3300046533 Bacteria 3021
279 Ga0495586_0115659 3300046535 Bacteria 1495
280 Ga0495645_0046545 3300046543 Bacteria 3161
281 Ga0495622_0052916 3300046557 Bacteria 1884
282 Ga0495633_0141874 3300046558 Bacteria 1111
283 Ga0495667_0027332 3300046559 Bacteria 3845
284 Ga0495667_0161552 3300046559 Bacteria 1441
285 Ga0495656_0027150 3300046615 Bacteria 2285
286 Ga0495656_0113195 3300046615 Bacteria 1272
287 Ga0495634_0036787 3300046642 Bacteria 3346
288 Ga0495634_0234071 3300046642 Bacteria 1129
289 Ga0495635_0033999 3300046663 Bacteria 3536
290 Ga0495588_0310863 3300046674 Bacteria 829
291 Ga0495657_0038208 3300046675 Bacteria 3305
292 Ga0495599_0060104 3300046678 Bacteria 2376
293 Ga0495623_0056376 3300046679 Bacteria 2474
294 Ga0495646_0008390 3300046680 Bacteria 6567
295 Ga0495647_0135618 3300046681 Bacteria 1046
296 Ga0495658_0012122 3300046683 Bacteria 4355
297 Ga0495613_0007160 3300046689 Bacteria 8307
298 Ga0495613_0206472 3300046689 Bacteria 1383
299 Ga0495624_0168175 3300046690 Unclassified 1338
300 Ga0495600_0071699 3300046809 Unclassified 2263
301 Ga0495660_0039137 3300046810 Bacteria 2634
302 Ga0495581_0000177 3300047315 Bacteria 29096
303 Ga0495581_0002988 3300047315 Bacteria 9689
304 Ga0495604_0046101 3300047317 Bacteria 3399
305 Ga0495674_0232112 3300047319 Bacteria 1522
306 Ga0495676_0212655 3300047321 Bacteria 1337
307 Ga0495676_0255804 3300047321 Bacteria 1193
308 Ga0495680_0343615 3300047322 Bacteria 1040
309 Ga0495675_0019682 3300047444 Bacteria 4289
310 Ga0495679_020873 3300047446 Bacteria 2274
311 Ga0495685_000097 3300047447 Bacteria 31828
312 Ga0495681_0004590 3300047470 Bacteria 9403
313 Ga0495684_0017444 3300047471 Bacteria 5527
314 Ga0495593_0277422 3300047673 Bacteria 838
315 Ga0495602_0113965 3300048088 Bacteria 2190
316 Ga0496105_0190924 3300048908 Bacteria 1675
317 Ga0496108_0069174 3300048911 Bacteria 2979
318 Ga0496108_1138866 3300048911 Bacteria 662
319 Ga0496109_0044824 3300048912 Bacteria 4013
320 Ga0496109_0084924 3300048912 Bacteria 2921
321 Ga0496109_0107827 3300048912 Bacteria 2588
322 Ga0496109_0180167 3300048912 Bacteria 1984
323 Ga0496110_0045590 3300048913 Bacteria 3833
324 Ga0496110_0187523 3300048913 Bacteria 1878
325 Ga0496111_0039304 3300048914 Bacteria 3392
326 Ga0496112_0122150 3300048915 Bacteria 2575
327 Ga0496112_0232279 3300048915 Bacteria 1799
328 Ga0496113_0514538 3300048916 Bacteria 961
329 Ga0496114_0054628 3300048917 Bacteria 3331
330 Ga0496126_0170641 3300048929 Bacteria 1853
331 Ga0501031_0015490 3300049568 Bacteria 4950
332 Ga0501031_0032949 3300049568 Bacteria 3378
333 Ga0501032_0326812 3300049569 Bacteria 989
334 Ga0501032_0650697 3300049569 Bacteria 669
335 Ga0501033_0156961 3300049570 Unclassified 1639
336 Ga0501033_0331415 3300049570 Bacteria 1068
337 Ga0501033_0337183 3300049570 Bacteria 1057
338 Ga0501034_0176978 3300049571 Bacteria 2099
339 Ga0501036_0322968 3300049572 Unclassified 1289
340 Ga0501037_0019889 3300049573 Bacteria 4955
341 Ga0501037_0055119 3300049573 Bacteria 2907
342 Ga0501037_0461421 3300049573 Unclassified 865
343 Ga0501038_0000215 3300049574 Bacteria 49658
344 Ga0501038_0103441 3300049574 Unclassified 2368
345 Ga0501038_0163744 3300049574 Bacteria 1805
346 Ga0501039_0055115 3300049575 Bacteria 3078
347 Ga0501039_0199462 3300049575 Bacteria 1573
348 Ga0501040_0070838 3300049576 Unclassified 2406
349 Ga0501040_0105835 3300049576 Bacteria 1965
350 Ga0501041_0221005 3300049577 Bacteria 1188
351 Ga0501041_0356589 3300049577 Bacteria 924
352 Ga0501042_0038896 3300049578 Bacteria 3378
353 Ga0501042_0238595 3300049578 Bacteria 1312
354 Ga0501042_0345938 3300049578 Bacteria 1075
355 Ga0501042_0636731 3300049578 Unclassified 775
356 Ga0501043_0009121 3300049579 Bacteria 7804
357 Ga0501043_0280778 3300049579 Unclassified 1276
358 Ga0501043_0395633 3300049579 Bacteria 1044
359 Ga0501046_0186178 3300049580 Bacteria 1550
360 Ga0501046_0314596 3300049580 Bacteria 1141
361 Ga0501047_0003729 3300049581 Bacteria 14348
362 Ga0501047_0324191 3300049581 Bacteria 1380
363 Ga0501048_0000571 3300049582 Bacteria 26167
364 Ga0501048_0050073 3300049582 Bacteria 2975
365 Ga0501048_0285964 3300049582 Bacteria 1172
366 Ga0501048_0361781 3300049582 Bacteria 1035
367 Ga0501068_0019597 3300049584 Bacteria 3931
368 Ga0501068_0129378 3300049584 Bacteria 1578
369 Ga0501069_0268852 3300049585 Unclassified 996
370 Ga0501070_0119674 3300049586 Bacteria 2176
371 Ga0501070_0305486 3300049586 Unclassified 1295
372 Ga0501071_0033170 3300049587 Unclassified 3669
373 Ga0501071_0052250 3300049587 Bacteria 2946
374 Ga0501071_0085259 3300049587 Bacteria 2316
375 Ga0501071_0406580 3300049587 Bacteria 1039
376 Ga0501072_0080598 3300049588 Unclassified 2579
377 Ga0501072_0128163 3300049588 Bacteria 2022
378 Ga0501072_0435667 3300049588 Bacteria 1038
379 Ga0501072_0569677 3300049588 Bacteria 894
380 Ga0501073_0278308 3300049589 Unclassified 1154
381 Ga0501073_0301098 3300049589 Bacteria 1106
382 Ga0501074_0036034 3300049590 Bacteria 3584
383 Ga0501074_0074936 3300049590 Bacteria 2430
384 Ga0501074_0162770 3300049590 Unclassified 1593
385 Ga0501074_0433329 3300049590 Bacteria 932
386 Ga0501075_0001462 3300049591 Bacteria 15371
387 Ga0501075_0015472 3300049591 Bacteria 5476
388 Ga0501075_0342393 3300049591 Bacteria 1139
389 Ga0501075_0542482 3300049591 Unclassified 887
390 Ga0501076_0007775 3300049592 Bacteria 7814
391 Ga0501076_0020006 3300049592 Bacteria 5120
392 Ga0501077_0074529 3300049593 Unclassified 2149
393 Ga0501077_0149026 3300049593 Unclassified 1484
394 Ga0501077_0337894 3300049593 Bacteria 960
395 Ga0501079_0031742 3300049741 Bacteria 4058
396 Ga0501079_0061665 3300049741 Bacteria 2893
397 Ga0501079_0276641 3300049741 Unclassified 1312
398 Ga0501080_0054550 3300049742 Bacteria 3721
399 Ga0501083_0051532 3300049744 Bacteria 2767
400 Ga0501035_0049778 3300049822 Bacteria 3755
401 Ga0501035_0103579 3300049822 Bacteria 2496
402 Ga0501035_0378410 3300049822 Bacteria 1181
403 Ga0501044_0025594 3300049823 Bacteria 6256
404 Ga0501045_0058822 3300049824 Bacteria 2815
405 Ga0501045_0161179 3300049824 Bacteria 1669
406 Ga0501045_0770926 3300049824 Unclassified 708
407 nmdc:mga03n38_65318_c1 3300050490 Bacteria 1668
408 nmdc:mga0yw44_44358_c1 3300050492 Bacteria 2659
409 nmdc:mga05p37_1291160_c1 3300050507 Bacteria 745
410 nmdc:mga05p37_219657_c1 3300050507 Bacteria 2294
411 nmdc:mga09592_156956_c1 3300050508 Bacteria 1964
412 nmdc:mga09592_83336_c1 3300050508 Bacteria 2725
413 nmdc:mga06r32_228178_c1 3300050510 Bacteria 1850
414 nmdc:mga06r32_2846_c3 3300050510 Bacteria 3220
415 nmdc:mga06r32_580323_c1 3300050510 Bacteria 1093
416 nmdc:mga0sz30_17883_c2 3300050516 Bacteria 1373
417 Ga0495601_0094031 3300053077 Unclassified 1931
418 Ga0495619_0185980 3300053085 Bacteria 1437
419 Ga0495619_0204202 3300053085 Bacteria 1368
420 Ga0500578_0037476 3300053086 Bacteria 3114
421 Ga0500578_0153688 3300053086 Bacteria 1432
422 Ga0500651_0119835 3300053093 Bacteria 1598
423 Ga0500566_0140770 3300053094 Bacteria 1280
424 Ga0500641_0053048 3300053096 Bacteria 1673
425 Ga0500641_0055812 3300053096 Bacteria 1636
426 Ga0500650_0265198 3300053098 Bacteria 767
427 Ga0500560_009741 3300053107 Bacteria 2375
428 Ga0500569_056387 3300053109 Bacteria 1201
429 Ga0500569_083989 3300053109 Bacteria 1022
430 Ga0500652_002711 3300053131 Bacteria 5348
431 Ga0500652_003572 3300053131 Bacteria 4718
432 Ga0500658_0056997 3300053134 Bacteria 1614
433 Ga0500658_0111502 3300053134 Bacteria 1204
434 Ga0500559_0011524 3300053136 Bacteria 3776
435 Ga0500561_0000545 3300053137 Bacteria 6059
436 Ga0500573_0010952 3300053140 Bacteria 5069
437 Ga0500579_114272 3300053143 Bacteria 1342
438 Ga0500579_153556 3300053143 Bacteria 995
439 Ga0500600_0015514 3300053149 Bacteria 4623
440 Ga0500616_0129406 3300053153 Bacteria 1194
441 Ga0500633_0091351 3300053160 Bacteria 1112
442 Ga0500633_0130804 3300053160 Bacteria 936
443 Ga0500634_0190892 3300053161 Bacteria 910
444 Ga0500645_000056 3300053730 Bacteria 92126
445 Ga0500587_016269 3300053739 Bacteria 949
446 Ga0501084_0141945 3300054114 Bacteria 2022
447 Ga0501082_0046347 3300060353 Bacteria 3747
448 Ga0530510_0110021 3300061734 Bacteria 2017
449 Ga0530510_0199551 3300061734 Bacteria 1485

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046674 Ga0495588_0310863 Ga0495588_0310863_284_802 168
2 3300049578 Ga0501042_0038896 Ga0501042_0038896_20_541 172
3 3300049585 Ga0501069_0268852 Ga0501069_0268852_465_986 172
4 3300049591 Ga0501075_0542482 Ga0501075_0542482_346_867 172
5 3300049824 Ga0501045_0770926 Ga0501045_0770926_152_673 172
6 3300045976 Ga0466967_0087353 Ga0466967_0087353_2074_2679 200
7 3300041494 Ga0451837_1125836 Ga0451837_1125836_308_913 201
8 iso_pu_bacteria 2902799365 2902804112 201
9 iso_pu_bacteria 2868088558 2868094405 202
10 iso_pu_bacteria 2738543005 2739204115 203
11 3300005577 Ga0068857_100914090 Ga0068857_1009140901 204
12 3300014325 Ga0163163_10711347 Ga0163163_107113472 204
13 3300005340 Ga0070689_100342980 Ga0070689_1003429802 205
14 3300005356 Ga0070674_100091864 Ga0070674_1000918643 205
15 3300005438 Ga0070701_10091645 Ga0070701_100916452 205
16 3300005441 Ga0070700_100260295 Ga0070700_1002602952 205
17 3300005456 Ga0070678_100737347 Ga0070678_1007373471 205
18 3300005457 Ga0070662_100366621 Ga0070662_1003666211 205
19 3300005840 Ga0068870_10076526 Ga0068870_100765261 205
20 3300005843 Ga0068860_100168323 Ga0068860_1001683233 205
21 3300006038 Ga0075365_10083346 Ga0075365_100833461 205
22 3300006186 Ga0075369_10010928 Ga0075369_100109283 205
23 3300009101 Ga0105247_10253668 Ga0105247_102536681 205
24 3300009148 Ga0105243_10031924 Ga0105243_100319243 205
25 3300011119 Ga0105246_10372565 Ga0105246_103725652 205
26 3300013308 Ga0157375_10123325 Ga0157375_101233253 205
27 3300014326 Ga0157380_10128298 Ga0157380_101282982 205
28 3300025303 Ga0209051_1056713 Ga0209051_10567132 205
29 3300025938 Ga0207704_10026741 Ga0207704_100267412 205
30 3300026067 Ga0207678_10404940 Ga0207678_104049402 205
31 3300026075 Ga0207708_10931316 Ga0207708_109313161 205
32 3300028381 Ga0268264_10324020 Ga0268264_103240202 205
33 3300044684 Ga0466966_0159868 Ga0466966_0159868_55_672 205
34 3300044693 Ga0466961_0004577 Ga0466961_0004577_240_857 205
35 3300045049 Ga0466959_0056595 Ga0466959_0056595_1566_2183 205
36 3300045836 Ga0466958_0292296 Ga0466958_0292296_12_629 205
37 3300046460 Ga0495638_0068745 Ga0495638_0068745_1309_1926 205
38 3300046615 Ga0495656_0027150 Ga0495656_0027150_1082_1699 205
39 3300048912 Ga0496109_0107827 Ga0496109_0107827_1414_2040 205
40 3300048929 Ga0496126_0170641 Ga0496126_0170641_846_1463 205
41 3300050492 nmdc:mga0yw44_44358_c1 nmdc:mga0yw44_44358_c1_450_1067 205
42 3300050516 nmdc:mga0sz30_17883_c2 nmdc:mga0sz30_17883_c2_446_1063 205
43 3300053086 Ga0500578_0153688 Ga0500578_0153688_522_1139 205
44 3300053096 Ga0500641_0053048 Ga0500641_0053048_1030_1647 205
45 3300053098 Ga0500650_0265198 Ga0500650_0265198_124_741 205
46 3300053131 Ga0500652_003572 Ga0500652_003572_4049_4666 205
47 3300053134 Ga0500658_0056997 Ga0500658_0056997_748_1365 205
48 3300053136 Ga0500559_0011524 Ga0500559_0011524_2044_2661 205
49 3300053730 Ga0500645_000056 Ga0500645_000056_62564_63181 205
50 iso_pu_bacteria 2738541274 2738706332 205
51 iso_pu_bacteria 2738543028 2739328822 205
52 3300044683 Ga0466965_0219396 Ga0466965_0219396_291_911 206
53 3300044694 Ga0466963_0303342 Ga0466963_0303342_451_1071 206
54 3300044719 Ga0466971_0008099 Ga0466971_0008099_3861_4481 206
55 3300044735 Ga0466968_0139231 Ga0466968_0139231_112_732 206
56 3300045836 Ga0466958_0048562 Ga0466958_0048562_1136_1756 206
57 3300045976 Ga0466967_0034191 Ga0466967_0034191_2359_2979 206
58 3300005437 Ga0070710_10091449 Ga0070710_100914492 207
59 3300005439 Ga0070711_100021639 Ga0070711_1000216394 207
60 3300005467 Ga0070706_100094458 Ga0070706_1000944582 207
61 3300005468 Ga0070707_100085123 Ga0070707_1000851233 207
62 3300005471 Ga0070698_100007998 Ga0070698_1000079988 207
63 3300005471 Ga0070698_100226180 Ga0070698_1002261802 207
64 3300005518 Ga0070699_100786110 Ga0070699_1007861101 207
65 3300006173 Ga0070716_100231925 Ga0070716_1002319251 207
66 3300006175 Ga0070712_100059549 Ga0070712_1000595492 207
67 3300006847 Ga0075431_100122852 Ga0075431_1001228522 207
68 3300009147 Ga0114129_10966714 Ga0114129_109667141 207
69 3300013105 Ga0157369_10068838 Ga0157369_100688382 207
70 3300020082 Ga0206353_11061338 Ga0206353_110613385 207
71 3300021388 Ga0213875_10022138 Ga0213875_100221382 207
72 3300024227 Ga0228598_1041020 Ga0228598_10410202 207
73 3300025906 Ga0207699_10006824 Ga0207699_100068247 207
74 3300025915 Ga0207693_10037180 Ga0207693_100371804 207
75 3300025915 Ga0207693_10073550 Ga0207693_100735503 207
76 3300025922 Ga0207646_10040278 Ga0207646_100402782 207
77 3300025928 Ga0207700_10047105 Ga0207700_100471052 207
78 3300025929 Ga0207664_10019735 Ga0207664_100197355 207
79 3300025939 Ga0207665_10733723 Ga0207665_107337231 207
80 3300026078 Ga0207702_10195505 Ga0207702_101955051 207
81 3300030763 Ga0265763_1001652 Ga0265763_10016522 207
82 3300031901 Ga0307406_10332497 Ga0307406_103324972 207
83 3300032002 Ga0307416_100910672 Ga0307416_1009106721 207
84 3300032126 Ga0307415_100070435 Ga0307415_1000704351 207
85 3300032126 Ga0307415_100430122 Ga0307415_1004301222 207
86 3300035086 Ga0373934_0021322 Ga0373934_0021322_1717_2340 207
87 3300035111 Ga0373923_0020328 Ga0373923_0020328_1880_2503 207
88 3300035117 Ga0373953_0010932 Ga0373953_0010932_1854_2477 207
89 3300035118 Ga0373954_0029886 Ga0373954_0029886_1569_2192 207
90 3300035119 Ga0373956_0015527 Ga0373956_0015527_714_1337 207
91 3300035120 Ga0373957_0001523 Ga0373957_0001523_3459_4082 207
92 3300035172 Ga0373955_0090916 Ga0373955_0090916_189_812 207
93 3300035410 Ga0373924_0050388 Ga0373924_0050388_1069_1692 207
94 3300035692 Ga0373935_0025861 Ga0373935_0025861_523_1146 207
95 3300035724 Ga0373933_0079807 Ga0373933_0079807_333_956 207
96 3300036401 Ga0373937_0076535 Ga0373937_0076535_1849_2472 207
97 3300037853 Ga0436364_0095977 Ga0436364_0095977_178_801 207
98 3300037853 Ga0436364_1245595 Ga0436364_1245595_790_1413 207
99 3300044656 Ga0466969_0350725 Ga0466969_0350725_10_636 207
100 3300044658 Ga0466972_0013410 Ga0466972_0013410_156_782 207
101 3300044684 Ga0466966_0019366 Ga0466966_0019366_1197_1823 207
102 3300044684 Ga0466966_0095742 Ga0466966_0095742_407_1033 207
103 3300044693 Ga0466961_0063475 Ga0466961_0063475_340_972 207
104 3300044693 Ga0466961_0129429 Ga0466961_0129429_878_1504 207
105 3300044693 Ga0466961_0158439 Ga0466961_0158439_200_826 207
106 3300044693 Ga0466961_0270398 Ga0466961_0270398_280_906 207
107 3300044694 Ga0466963_0044438 Ga0466963_0044438_356_982 207
108 3300044694 Ga0466963_0193641 Ga0466963_0193641_466_1092 207
109 3300044719 Ga0466971_0073348 Ga0466971_0073348_17_643 207
110 3300044735 Ga0466968_0349817 Ga0466968_0349817_75_698 207
111 3300044765 Ga0466970_0007018 Ga0466970_0007018_2430_3056 207
112 3300044765 Ga0466970_0390640 Ga0466970_0390640_39_665 207
113 3300044842 Ga0466957_0186560 Ga0466957_0186560_709_1335 207
114 3300045049 Ga0466959_0018760 Ga0466959_0018760_4087_4713 207
115 3300045836 Ga0466958_0013834 Ga0466958_0013834_3694_4320 207
116 3300045836 Ga0466958_0064597 Ga0466958_0064597_1464_2090 207
117 3300045976 Ga0466967_0006470 Ga0466967_0006470_6658_7284 207
118 3300045976 Ga0466967_1124831 Ga0466967_1124831_133_759 207
119 3300046454 Ga0495592_0226933 Ga0495592_0226933_162_785 207
120 3300046459 Ga0495629_0116181 Ga0495629_0116181_55_678 207
121 3300046462 Ga0495651_0036575 Ga0495651_0036575_2440_3063 207
122 3300046463 Ga0495653_0010111 Ga0495653_0010111_1237_1860 207
123 3300046472 Ga0495580_0644674 Ga0495580_0644674_42_677 207
124 3300046477 Ga0495664_0134229 Ga0495664_0134229_476_1099 207
125 3300046511 Ga0495608_0015948 Ga0495608_0015948_470_1093 207
126 3300046514 Ga0495618_0031346 Ga0495618_0031346_1500_2123 207
127 3300046516 Ga0495628_0142535 Ga0495628_0142535_464_1087 207
128 3300046529 Ga0495652_0182748 Ga0495652_0182748_956_1579 207
129 3300046531 Ga0495665_0002852 Ga0495665_0002852_6340_6975 207
130 3300046533 Ga0495640_0046137 Ga0495640_0046137_1978_2601 207
131 3300046535 Ga0495586_0115659 Ga0495586_0115659_389_1012 207
132 3300046543 Ga0495645_0046545 Ga0495645_0046545_673_1296 207
133 3300046559 Ga0495667_0027332 Ga0495667_0027332_235_858 207
134 3300046642 Ga0495634_0036787 Ga0495634_0036787_1306_1929 207
135 3300046663 Ga0495635_0033999 Ga0495635_0033999_1335_1958 207
136 3300046675 Ga0495657_0038208 Ga0495657_0038208_395_1018 207
137 3300046678 Ga0495599_0060104 Ga0495599_0060104_1605_2228 207
138 3300046679 Ga0495623_0056376 Ga0495623_0056376_1041_1664 207
139 3300046680 Ga0495646_0008390 Ga0495646_0008390_831_1454 207
140 3300046690 Ga0495624_0168175 Ga0495624_0168175_257_880 207
141 3300046809 Ga0495600_0071699 Ga0495600_0071699_264_887 207
142 3300047315 Ga0495581_0002988 Ga0495581_0002988_5585_6220 207
143 3300047317 Ga0495604_0046101 Ga0495604_0046101_156_779 207
144 3300047319 Ga0495674_0232112 Ga0495674_0232112_598_1221 207
145 3300047321 Ga0495676_0212655 Ga0495676_0212655_151_774 207
146 3300047444 Ga0495675_0019682 Ga0495675_0019682_466_1089 207
147 3300047471 Ga0495684_0017444 Ga0495684_0017444_4072_4695 207
148 3300048088 Ga0495602_0113965 Ga0495602_0113965_422_1045 207
149 3300048908 Ga0496105_0190924 Ga0496105_0190924_1006_1632 207
150 3300048912 Ga0496109_0044824 Ga0496109_0044824_1423_2049 207
151 3300048913 Ga0496110_0187523 Ga0496110_0187523_188_814 207
152 3300049568 Ga0501031_0015490 Ga0501031_0015490_2320_2946 207
153 3300049569 Ga0501032_0326812 Ga0501032_0326812_87_713 207
154 3300049569 Ga0501032_0650697 Ga0501032_0650697_13_639 207
155 3300049570 Ga0501033_0156961 Ga0501033_0156961_309_932 207
156 3300049570 Ga0501033_0331415 Ga0501033_0331415_128_754 207
157 3300049571 Ga0501034_0176978 Ga0501034_0176978_730_1356 207
158 3300049573 Ga0501037_0055119 Ga0501037_0055119_1391_2017 207
159 3300049574 Ga0501038_0000215 Ga0501038_0000215_48885_49511 207
160 3300049574 Ga0501038_0103441 Ga0501038_0103441_1474_2097 207
161 3300049575 Ga0501039_0055115 Ga0501039_0055115_965_1588 207
162 3300049576 Ga0501040_0070838 Ga0501040_0070838_293_916 207
163 3300049579 Ga0501043_0009121 Ga0501043_0009121_32_658 207
164 3300049579 Ga0501043_0280778 Ga0501043_0280778_33_656 207
165 3300049580 Ga0501046_0186178 Ga0501046_0186178_559_1185 207
166 3300049581 Ga0501047_0003729 Ga0501047_0003729_1965_2591 207
167 3300049582 Ga0501048_0000571 Ga0501048_0000571_20880_21506 207
168 3300049586 Ga0501070_0119674 Ga0501070_0119674_835_1461 207
169 3300049587 Ga0501071_0033170 Ga0501071_0033170_2685_3308 207
170 3300049588 Ga0501072_0080598 Ga0501072_0080598_1665_2288 207
171 3300049588 Ga0501072_0569677 Ga0501072_0569677_135_758 207
172 3300049589 Ga0501073_0301098 Ga0501073_0301098_73_699 207
173 3300049591 Ga0501075_0001462 Ga0501075_0001462_1467_2090 207
174 3300049592 Ga0501076_0020006 Ga0501076_0020006_1292_1915 207
175 3300049593 Ga0501077_0149026 Ga0501077_0149026_563_1186 207
176 3300049744 Ga0501083_0051532 Ga0501083_0051532_1688_2311 207
177 3300049822 Ga0501035_0049778 Ga0501035_0049778_500_1126 207
178 3300049823 Ga0501044_0025594 Ga0501044_0025594_4200_4826 207
179 3300050510 nmdc:mga06r32_228178_c1 nmdc:mga06r32_228178_c1_722_1345 207
180 3300053077 Ga0495601_0094031 Ga0495601_0094031_552_1175 207
181 3300053085 Ga0495619_0204202 Ga0495619_0204202_144_767 207
182 3300061734 Ga0530510_0110021 Ga0530510_0110021_458_1081 207
183 3300045836 Ga0466958_0319948 Ga0466958_0319948_232_861 208
184 3300048911 Ga0496108_1138866 Ga0496108_1138866_11_637 208
185 3300048912 Ga0496109_0180167 Ga0496109_0180167_38_664 208
186 3300048915 Ga0496112_0122150 Ga0496112_0122150_278_904 208
187 3300031731 Ga0307405_10358539 Ga0307405_103585391 209
188 3300031824 Ga0307413_10144750 Ga0307413_101447503 209
189 3300031901 Ga0307406_10024385 Ga0307406_100243855 209
190 3300031911 Ga0307412_10411508 Ga0307412_104115081 209
191 3300031995 Ga0307409_100006402 Ga0307409_1000064029 209
192 3300035112 Ga0373932_0055106 Ga0373932_0055106_193_822 209
193 iso_pu_bacteria 2622736626 2623588863 209
194 3300005334 Ga0068869_100034859 Ga0068869_1000348593 210
195 3300005338 Ga0068868_100002027 Ga0068868_10000202712 210
196 3300005339 Ga0070660_100027844 Ga0070660_1000278442 210
197 3300005341 Ga0070691_10033442 Ga0070691_100334422 210
198 3300005345 Ga0070692_10138425 Ga0070692_101384252 210
199 3300005347 Ga0070668_100326618 Ga0070668_1003266182 210
200 3300005354 Ga0070675_100000500 Ga0070675_10000050016 210
201 3300005366 Ga0070659_100003337 Ga0070659_10000333712 210
202 3300005441 Ga0070700_100009423 Ga0070700_1000094236 210
203 3300005457 Ga0070662_100056011 Ga0070662_1000560112 210
204 3300005535 Ga0070684_100003092 Ga0070684_1000030924 210
205 3300005543 Ga0070672_100143544 Ga0070672_1001435442 210
206 3300005547 Ga0070693_100333496 Ga0070693_1003334962 210
207 3300005564 Ga0070664_100000986 Ga0070664_1000009867 210
208 3300005577 Ga0068857_100001211 Ga0068857_10000121119 210
209 3300005615 Ga0070702_100021964 Ga0070702_1000219643 210
210 3300005719 Ga0068861_100072695 Ga0068861_1000726952 210
211 3300005842 Ga0068858_100015872 Ga0068858_1000158722 210
212 3300005842 Ga0068858_100193277 Ga0068858_1001932772 210
213 3300005843 Ga0068860_100027924 Ga0068860_1000279244 210
214 3300005844 Ga0068862_100177915 Ga0068862_1001779153 210
215 3300005937 Ga0081455_10003875 Ga0081455_1000387514 210
216 3300025911 Ga0207654_10110069 Ga0207654_101100692 210
217 3300025919 Ga0207657_10036640 Ga0207657_100366402 210
218 3300025925 Ga0207650_10161077 Ga0207650_101610771 210
219 3300025925 Ga0207650_10432879 Ga0207650_104328791 210
220 3300025932 Ga0207690_10010688 Ga0207690_100106881 210
221 3300025933 Ga0207706_10219530 Ga0207706_102195302 210
222 3300025935 Ga0207709_10316457 Ga0207709_103164572 210
223 3300025938 Ga0207704_10524473 Ga0207704_105244731 210
224 3300025940 Ga0207691_10220169 Ga0207691_102201692 210
225 3300025942 Ga0207689_10004013 Ga0207689_1000401310 210
226 3300025945 Ga0207679_10006572 Ga0207679_100065722 210
227 3300025972 Ga0207668_10270290 Ga0207668_102702902 210
228 3300025986 Ga0207658_10103659 Ga0207658_101036593 210
229 3300026023 Ga0207677_10004469 Ga0207677_100044693 210
230 3300026035 Ga0207703_10273348 Ga0207703_102733482 210
231 3300026075 Ga0207708_10052587 Ga0207708_100525873 210
232 3300026116 Ga0207674_10003876 Ga0207674_100038762 210
233 3300026118 Ga0207675_100109349 Ga0207675_1001093492 210
234 3300028380 Ga0268265_10026498 Ga0268265_100264982 210
235 3300028380 Ga0268265_10170652 Ga0268265_101706523 210
236 3300028381 Ga0268264_10036234 Ga0268264_100362343 210
237 3300031507 Ga0307509_10005125 Ga0307509_1000512511 210
238 3300031730 Ga0307516_10376747 Ga0307516_103767472 210
239 3300033179 Ga0307507_10036770 Ga0307507_100367703 210
240 3300035242 Ga0373962_0003019 Ga0373962_0003019_1928_2602 210
241 3300035692 Ga0373935_0011081 Ga0373935_0011081_4197_4829 210
242 3300049573 Ga0501037_0019889 Ga0501037_0019889_1705_2337 210
243 3300049576 Ga0501040_0105835 Ga0501040_0105835_195_827 210
244 3300049581 Ga0501047_0324191 Ga0501047_0324191_152_784 210
245 3300049587 Ga0501071_0052250 Ga0501071_0052250_2206_2838 210
246 3300061734 Ga0530510_0199551 Ga0530510_0199551_110_742 210
247 3300005329 Ga0070683_100109077 Ga0070683_1001090773 212
248 3300005336 Ga0070680_100328002 Ga0070680_1003280022 212
249 3300005367 Ga0070667_100033506 Ga0070667_1000335063 212
250 3300005445 Ga0070708_100298374 Ga0070708_1002983742 212
251 3300005445 Ga0070708_101119615 Ga0070708_1011196151 212
252 3300005471 Ga0070698_100071036 Ga0070698_1000710362 212
253 3300005471 Ga0070698_100237740 Ga0070698_1002377403 212
254 3300005518 Ga0070699_100051236 Ga0070699_1000512363 212
255 3300005535 Ga0070684_100138351 Ga0070684_1001383513 212
256 3300006844 Ga0075428_100195774 Ga0075428_1001957742 212
257 3300009147 Ga0114129_10179868 Ga0114129_101798683 212
258 3300009147 Ga0114129_10385260 Ga0114129_103852603 212
259 3300022467 Ga0224712_10006177 Ga0224712_100061772 212
260 3300025940 Ga0207691_10643467 Ga0207691_106434672 212
261 3300025944 Ga0207661_10343126 Ga0207661_103431262 212
262 3300025986 Ga0207658_10032940 Ga0207658_100329402 212
263 3300027907 Ga0207428_10017846 Ga0207428_100178468 212
264 3300031456 Ga0307513_10037676 Ga0307513_100376762 212
265 3300031616 Ga0307508_10025556 Ga0307508_100255565 212
266 3300031852 Ga0307410_10201890 Ga0307410_102018903 212
267 3300031995 Ga0307409_100070394 Ga0307409_1000703942 212
268 3300032005 Ga0307411_10100664 Ga0307411_101006642 212
269 3300035692 Ga0373935_0258731 Ga0373935_0258731_350_997 212
270 3300035725 Ga0373947_0006055 Ga0373947_0006055_5140_5787 212
271 3300037068 Ga0373925_0009209 Ga0373925_0009209_1019_1666 212
272 3300037068 Ga0373925_0010724 Ga0373925_0010724_4594_5238 212
273 3300037312 Ga0395899_0074869 Ga0395899_0074869_895_1539 212
274 3300037312 Ga0395899_0085263 Ga0395899_0085263_1099_1737 212
275 3300037418 Ga0395900_0008596 Ga0395900_0008596_4833_5471 212
276 3300037418 Ga0395900_0012337 Ga0395900_0012337_8064_8720 212
277 3300037418 Ga0395900_0068819 Ga0395900_0068819_1898_2542 212
278 3300037418 Ga0395900_0069621 Ga0395900_0069621_1203_1862 212
279 3300037418 Ga0395900_0144012 Ga0395900_0144012_835_1479 212
280 3300037466 Ga0395898_0002827 Ga0395898_0002827_12785_13441 212
281 3300037466 Ga0395898_0003667 Ga0395898_0003667_2216_2854 212
282 3300037466 Ga0395898_0027202 Ga0395898_0027202_3286_3945 212
283 3300037466 Ga0395898_0140182 Ga0395898_0140182_458_1102 212
284 3300037466 Ga0395898_0400674 Ga0395898_0400674_213_857 212
285 3300037471 Ga0395905_0009412 Ga0395905_0009412_8385_9023 212
286 3300037471 Ga0395905_0043706 Ga0395905_0043706_2205_2849 212
287 3300037471 Ga0395905_0053428 Ga0395905_0053428_2317_2976 212
288 3300037471 Ga0395905_0287422 Ga0395905_0287422_166_810 212
289 3300038443 Ga0395901_0018621 Ga0395901_0018621_5956_6600 212
290 3300038443 Ga0395901_0026395 Ga0395901_0026395_3991_4647 212
291 3300038443 Ga0395901_0027670 Ga0395901_0027670_2875_3513 212
292 3300038443 Ga0395901_0105380 Ga0395901_0105380_197_856 212
293 3300046454 Ga0495592_0110276 Ga0495592_0110276_299_943 212
294 3300046455 Ga0495603_0058289 Ga0495603_0058289_106_753 212
295 3300046459 Ga0495629_0000972 Ga0495629_0000972_8529_9176 212
296 3300046462 Ga0495651_0170037 Ga0495651_0170037_888_1532 212
297 3300046463 Ga0495653_0084366 Ga0495653_0084366_621_1265 212
298 3300046473 Ga0495582_0000274 Ga0495582_0000274_12179_12826 212
299 3300046517 Ga0495630_0364898 Ga0495630_0364898_327_971 212
300 3300046526 Ga0495666_0163193 Ga0495666_0163193_233_880 212
301 3300046531 Ga0495665_0038699 Ga0495665_0038699_915_1562 212
302 3300046559 Ga0495667_0161552 Ga0495667_0161552_230_874 212
303 3300046615 Ga0495656_0113195 Ga0495656_0113195_325_972 212
304 3300046642 Ga0495634_0234071 Ga0495634_0234071_380_1024 212
305 3300046681 Ga0495647_0135618 Ga0495647_0135618_28_675 212
306 3300046683 Ga0495658_0012122 Ga0495658_0012122_48_695 212
307 3300046689 Ga0495613_0007160 Ga0495613_0007160_6527_7174 212
308 3300047315 Ga0495581_0000177 Ga0495581_0000177_13313_13960 212
309 3300047322 Ga0495680_0343615 Ga0495680_0343615_175_819 212
310 3300047673 Ga0495593_0277422 Ga0495593_0277422_131_778 212
311 3300048911 Ga0496108_0069174 Ga0496108_0069174_1952_2596 212
312 3300048912 Ga0496109_0084924 Ga0496109_0084924_984_1628 212
313 3300048913 Ga0496110_0045590 Ga0496110_0045590_80_724 212
314 3300048914 Ga0496111_0039304 Ga0496111_0039304_1648_2292 212
315 3300048916 Ga0496113_0514538 Ga0496113_0514538_243_887 212
316 3300049568 Ga0501031_0032949 Ga0501031_0032949_616_1257 212
317 3300049570 Ga0501033_0337183 Ga0501033_0337183_66_707 212
318 3300049572 Ga0501036_0322968 Ga0501036_0322968_131_775 212
319 3300049573 Ga0501037_0461421 Ga0501037_0461421_28_672 212
320 3300049574 Ga0501038_0163744 Ga0501038_0163744_929_1573 212
321 3300049575 Ga0501039_0199462 Ga0501039_0199462_616_1257 212
322 3300049577 Ga0501041_0221005 Ga0501041_0221005_496_1140 212
323 3300049577 Ga0501041_0356589 Ga0501041_0356589_262_906 212
324 3300049578 Ga0501042_0238595 Ga0501042_0238595_278_922 212
325 3300049578 Ga0501042_0345938 Ga0501042_0345938_264_908 212
326 3300049578 Ga0501042_0636731 Ga0501042_0636731_91_756 212
327 3300049579 Ga0501043_0395633 Ga0501043_0395633_208_849 212
328 3300049580 Ga0501046_0314596 Ga0501046_0314596_38_679 212
329 3300049582 Ga0501048_0050073 Ga0501048_0050073_867_1511 212
330 3300049582 Ga0501048_0285964 Ga0501048_0285964_197_838 212
331 3300049582 Ga0501048_0361781 Ga0501048_0361781_365_1009 212
332 3300049584 Ga0501068_0019597 Ga0501068_0019597_209_850 212
333 3300049584 Ga0501068_0129378 Ga0501068_0129378_235_876 212
334 3300049586 Ga0501070_0305486 Ga0501070_0305486_118_762 212
335 3300049587 Ga0501071_0085259 Ga0501071_0085259_392_1036 212
336 3300049587 Ga0501071_0406580 Ga0501071_0406580_233_877 212
337 3300049588 Ga0501072_0128163 Ga0501072_0128163_618_1262 212
338 3300049588 Ga0501072_0435667 Ga0501072_0435667_148_792 212
339 3300049589 Ga0501073_0278308 Ga0501073_0278308_114_758 212
340 3300049590 Ga0501074_0036034 Ga0501074_0036034_2747_3388 212
341 3300049590 Ga0501074_0074936 Ga0501074_0074936_391_1035 212
342 3300049590 Ga0501074_0162770 Ga0501074_0162770_131_775 212
343 3300049590 Ga0501074_0433329 Ga0501074_0433329_149_793 212
344 3300049591 Ga0501075_0015472 Ga0501075_0015472_4422_5066 212
345 3300049591 Ga0501075_0342393 Ga0501075_0342393_235_879 212
346 3300049592 Ga0501076_0007775 Ga0501076_0007775_2064_2708 212
347 3300049593 Ga0501077_0074529 Ga0501077_0074529_1303_1947 212
348 3300049593 Ga0501077_0337894 Ga0501077_0337894_173_814 212
349 3300049741 Ga0501079_0031742 Ga0501079_0031742_640_1281 212
350 3300049741 Ga0501079_0061665 Ga0501079_0061665_736_1380 212
351 3300049741 Ga0501079_0276641 Ga0501079_0276641_134_778 212
352 3300049742 Ga0501080_0054550 Ga0501080_0054550_1789_2430 212
353 3300049822 Ga0501035_0103579 Ga0501035_0103579_1240_1881 212
354 3300049822 Ga0501035_0378410 Ga0501035_0378410_38_679 212
355 3300049824 Ga0501045_0058822 Ga0501045_0058822_1012_1656 212
356 3300049824 Ga0501045_0161179 Ga0501045_0161179_744_1388 212
357 3300050507 nmdc:mga05p37_219657_c1 nmdc:mga05p37_219657_c1_936_1580 212
358 3300050508 nmdc:mga09592_156956_c1 nmdc:mga09592_156956_c1_788_1435 212
359 3300050508 nmdc:mga09592_83336_c1 nmdc:mga09592_83336_c1_187_831 212
360 3300050510 nmdc:mga06r32_2846_c3 nmdc:mga06r32_2846_c3_1558_2214 212
361 3300053085 Ga0495619_0185980 Ga0495619_0185980_382_1026 212
362 3300053143 Ga0500579_153556 Ga0500579_153556_287_943 212
363 3300054114 Ga0501084_0141945 Ga0501084_0141945_744_1388 212
364 3300060353 Ga0501082_0046347 Ga0501082_0046347_723_1367 212
365 3300005327 Ga0070658_10019508 Ga0070658_100195081 213
366 3300005329 Ga0070683_100010464 Ga0070683_1000104642 213
367 3300005336 Ga0070680_100413938 Ga0070680_1004139381 213
368 3300005339 Ga0070660_100014123 Ga0070660_1000141234 213
369 3300005344 Ga0070661_100030114 Ga0070661_1000301144 213
370 3300005366 Ga0070659_100182654 Ga0070659_1001826542 213
371 3300005435 Ga0070714_100043437 Ga0070714_1000434372 213
372 3300005435 Ga0070714_100408889 Ga0070714_1004088892 213
373 3300005436 Ga0070713_100131660 Ga0070713_1001316602 213
374 3300005439 Ga0070711_100317886 Ga0070711_1003178862 213
375 3300005445 Ga0070708_100005761 Ga0070708_1000057616 213
376 3300005458 Ga0070681_10294239 Ga0070681_102942392 213
377 3300005530 Ga0070679_100006502 Ga0070679_10000650210 213
378 3300005530 Ga0070679_101010296 Ga0070679_1010102961 213
379 3300005535 Ga0070684_100073237 Ga0070684_1000732373 213
380 3300005535 Ga0070684_100215594 Ga0070684_1002155943 213
381 3300005577 Ga0068857_100128827 Ga0068857_1001288274 213
382 3300005616 Ga0068852_100534966 Ga0068852_1005349661 213
383 3300005937 Ga0081455_10099640 Ga0081455_100996402 213
384 3300005983 Ga0081540_1001693 Ga0081540_100169311 213
385 3300009177 Ga0105248_10705870 Ga0105248_107058701 213
386 3300009551 Ga0105238_10204508 Ga0105238_102045082 213
387 3300010375 Ga0105239_10533776 Ga0105239_105337761 213
388 3300013104 Ga0157370_10574005 Ga0157370_105740051 213
389 3300013105 Ga0157369_10022123 Ga0157369_100221232 213
390 3300013307 Ga0157372_10146352 Ga0157372_101463524 213
391 3300020081 Ga0206354_11326585 Ga0206354_113265852 213
392 3300022467 Ga0224712_10005748 Ga0224712_100057484 213
393 3300025909 Ga0207705_10014673 Ga0207705_100146735 213
394 3300025912 Ga0207707_10147590 Ga0207707_101475902 213
395 3300025916 Ga0207663_10074139 Ga0207663_100741393 213
396 3300025917 Ga0207660_10346958 Ga0207660_103469582 213
397 3300025919 Ga0207657_10035945 Ga0207657_100359454 213
398 3300025921 Ga0207652_10869451 Ga0207652_108694512 213
399 3300025924 Ga0207694_10765190 Ga0207694_107651901 213
400 3300025928 Ga0207700_10015863 Ga0207700_100158634 213
401 3300025928 Ga0207700_10475428 Ga0207700_104754281 213
402 3300025929 Ga0207664_10351357 Ga0207664_103513572 213
403 3300025932 Ga0207690_10033030 Ga0207690_100330301 213
404 3300025941 Ga0207711_10079584 Ga0207711_100795843 213
405 3300025944 Ga0207661_10004263 Ga0207661_1000426310 213
406 3300025945 Ga0207679_10938181 Ga0207679_109381811 213
407 3300025949 Ga0207667_10986228 Ga0207667_109862281 213
408 3300026116 Ga0207674_10043192 Ga0207674_100431925 213
409 3300028379 Ga0268266_10322303 Ga0268266_103223032 213
410 3300028794 Ga0307515_10011698 Ga0307515_1001169810 213
411 3300028794 Ga0307515_10044959 Ga0307515_100449592 213
412 3300030522 Ga0307512_10011587 Ga0307512_100115875 213
413 3300031456 Ga0307513_10008091 Ga0307513_100080918 213
414 3300031616 Ga0307508_10002757 Ga0307508_1000275713 213
415 3300031616 Ga0307508_10021928 Ga0307508_100219281 213
416 3300031616 Ga0307508_10220611 Ga0307508_102206111 213
417 3300031730 Ga0307516_10058944 Ga0307516_100589442 213
418 3300033180 Ga0307510_10189027 Ga0307510_101890272 213
419 3300035118 Ga0373954_0170861 Ga0373954_0170861_347_991 213
420 3300046453 Ga0495627_035308 Ga0495627_035308_258_905 213
421 3300046501 Ga0495607_0102262 Ga0495607_0102262_130_777 213
422 3300046519 Ga0495632_0067740 Ga0495632_0067740_246_893 213
423 3300046522 Ga0495643_0006729 Ga0495643_0006729_2627_3274 213
424 3300046557 Ga0495622_0052916 Ga0495622_0052916_279_926 213
425 3300046558 Ga0495633_0141874 Ga0495633_0141874_39_686 213
426 3300046689 Ga0495613_0206472 Ga0495613_0206472_632_1279 213
427 3300046810 Ga0495660_0039137 Ga0495660_0039137_1017_1664 213
428 3300047321 Ga0495676_0255804 Ga0495676_0255804_282_929 213
429 3300047446 Ga0495679_020873 Ga0495679_020873_473_1120 213
430 3300047447 Ga0495685_000097 Ga0495685_000097_31128_31775 213
431 3300047470 Ga0495681_0004590 Ga0495681_0004590_7332_7979 213
432 3300048915 Ga0496112_0232279 Ga0496112_0232279_227_868 213
433 3300048917 Ga0496114_0054628 Ga0496114_0054628_1623_2282 213
434 3300050490 nmdc:mga03n38_65318_c1 nmdc:mga03n38_65318_c1_157_807 213
435 3300050507 nmdc:mga05p37_1291160_c1 nmdc:mga05p37_1291160_c1_21_668 213
436 3300050510 nmdc:mga06r32_580323_c1 nmdc:mga06r32_580323_c1_187_834 213
437 3300053086 Ga0500578_0037476 Ga0500578_0037476_781_1428 213
438 3300053093 Ga0500651_0119835 Ga0500651_0119835_811_1539 213
439 3300053094 Ga0500566_0140770 Ga0500566_0140770_361_1008 213
440 3300053096 Ga0500641_0055812 Ga0500641_0055812_638_1366 213
441 3300053107 Ga0500560_009741 Ga0500560_009741_1418_2062 213
442 3300053109 Ga0500569_056387 Ga0500569_056387_58_735 213
443 3300053109 Ga0500569_083989 Ga0500569_083989_193_840 213
444 3300053131 Ga0500652_002711 Ga0500652_002711_3879_4526 213
445 3300053134 Ga0500658_0111502 Ga0500658_0111502_456_1103 213
446 3300053137 Ga0500561_0000545 Ga0500561_0000545_874_1521 213
447 3300053140 Ga0500573_0010952 Ga0500573_0010952_3207_3851 213
448 3300053143 Ga0500579_114272 Ga0500579_114272_621_1268 213
449 3300053149 Ga0500600_0015514 Ga0500600_0015514_1704_2351 213
450 3300053153 Ga0500616_0129406 Ga0500616_0129406_54_701 213
451 3300053160 Ga0500633_0091351 Ga0500633_0091351_103_780 213
452 3300053160 Ga0500633_0130804 Ga0500633_0130804_102_749 213
453 3300053161 Ga0500634_0190892 Ga0500634_0190892_163_810 213
454 3300053739 Ga0500587_016269 Ga0500587_016269_225_872 213
455 3300003659 JGI25404J52841_10033200 JGI25404J52841_100332001 247

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09365

DUF2461

Conserved hypothetical protein (DUF2461)

9

200

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2a8e-assembly1.cif.gz_A three-dimensional structure of bacillus subtilis q45498 putative protein at resolution 2.5a. northeast structural genomics consortium target sr204. 0.5744 1 199
3cxj-assembly1.cif.gz_A crystal structure of an uncharacterized protein from methanothermobacter thermautotrophicus 0.5644 42 199
3mqz-assembly1.cif.gz_A crystal structure of conserved protein duf1054 from pink subaerial biofilm microbial leptospirillum sp. group ii uba. 0.5602 33 197
1ua7-assembly1.cif.gz_A crystal structure analysis of alpha-amylase from bacillus subtilis complexed with acarbose 0.5505 54 99
2a8e-assembly1.cif.gz_A three-dimensional structure of bacillus subtilis q45498 putative protein at resolution 2.5a. northeast structural genomics consortium target sr204. 0.5462 1 199
ID Description Score Start End Superfamily
2a8eA00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.5895 4 199 3.30.930.20
af_Q2G2G7_1_204_3.30.930.20 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.5747 1 196 3.30.930.20
af_A0A2R8QR39_23_279_3.30.70.270 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Reverse transcriptase/Diguanylate cyclase domain 0.5677 123 199 3.30.70.270
3cxjC00 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.5665 37 196 3.30.1460.10
2a8eA00 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Protein of unknown function DUF1054 0.5653 4 199 3.30.930.20
ID Description Score Start End GO Terms
AF-A0A6L9SBB2-F1-model_v4 DUF2461 domain-containing protein 0.995 1 199
AF-A0A3C1DVV9-F1-model_v4 TIGR02453 family protein 0.9922 86 199
AF-A0A285QJB5-F1-model_v4 TIGR02453 family protein 0.9908 1 199
AF-A0A522P447-F1-model_v4 DUF2461 domain-containing protein 0.9817 1 199
AF-A0A522B3W2-F1-model_v4 DUF2461 family protein 0.9809 2 78

Feature Viewer

pLDDT pTM Quality
84.71 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map