F447532

General Info

Members Datasets Scaffolds Average Seq Length
455 187 910 347

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100055415|Ga0070699_1000554154
Length 376
Sequence MTSIRRLRDAIRPPAPEAAVEAQRHLDALTKPPGSLGRLEEIALRLAALRGGAPRVDQPVVFTFAADHGVVAEGVSAYPQVVTAQMVENFARGGAAINVLARQAGARVIVADFGVAGPVPPALAVLSRRVGAGTANMAHGPAMTAGQAARAIEHGIALAEEAIDAGADLLATGEMGIGNTTAAAAITAVITGAPPEAVTGRGTGVDDEGWRRKVEAVRAALAVNRPSAADGLDVLARVGGFEIGGLVGVILAGAARRVPIALDGFIATAAALIAVTLAPDARHALFASHRSAEPGHVRALAHLGLVPYLDLSLRLGEGTGAALFIHLARAACLVYGEMATFKSAGIDQSEGASTAPSEAFPSDRMEPAEPAPDKGQ

Samples

Sample ID Description Type Environment
1 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
14 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
15 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
41 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
118 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
119 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
120 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
121 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
122 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
123 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
125 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
126 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
129 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
132 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
133 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
134 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
135 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
136 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
137 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
145 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
152 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
154 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
156 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
162 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
163 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
164 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
165 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
166 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
167 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
168 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
169 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
170 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
171 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
172 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
173 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
179 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
180 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
181 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
182 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
184 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
185 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
186 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
187 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.22
Rhizosphere 98.46
Stem 0
Stem Tuber 0
Unclassified 0.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070699_100055415 3300005518 Bacteria 3433
2 JGI25406J46586_10016074 3300003203 Bacteria 3132
3 Ga0070690_100038179 3300005330 Bacteria 3029
4 Ga0070690_100081065 3300005330 Bacteria 2123
5 Ga0068869_100004092 3300005334 Bacteria 9030
6 Ga0070680_100013991 3300005336 Bacteria 6263
7 Ga0070682_100000155 3300005337 Bacteria 52961
8 Ga0070660_100000481 3300005339 Bacteria 26714
9 Ga0070691_10017060 3300005341 Bacteria 3341
10 Ga0070687_100008746 3300005343 Bacteria 4301
11 Ga0070692_10000554 3300005345 Bacteria 11643
12 Ga0070669_100000928 3300005353 Bacteria 21349
13 Ga0070669_100012213 3300005353 Bacteria 6096
14 Ga0070659_100000164 3300005366 Bacteria 51171
15 Ga0070705_100001147 3300005440 Bacteria 14609
16 Ga0070705_100022262 3300005440 Bacteria 3385
17 Ga0070694_100000027 3300005444 Bacteria 67286
18 Ga0070694_100025049 3300005444 Bacteria 3856
19 Ga0070708_100016694 3300005445 Bacteria 6099
20 Ga0070708_100017072 3300005445 Bacteria 6044
21 Ga0070708_100031618 3300005445 Bacteria 4583
22 Ga0070708_100032683 3300005445 Bacteria 4515
23 Ga0070708_100190042 3300005445 Bacteria 1920
24 Ga0070663_100000829 3300005455 Bacteria 16738
25 Ga0070662_100014141 3300005457 Bacteria 5326
26 Ga0070662_100115636 3300005457 Bacteria 2049
27 Ga0070681_10004024 3300005458 Bacteria 13868
28 Ga0070681_10069900 3300005458 Bacteria 3477
29 Ga0070681_10081830 3300005458 Bacteria 3185
30 Ga0068867_100000779 3300005459 Bacteria 21522
31 Ga0070706_100005335 3300005467 Bacteria 12247
32 Ga0070706_100006773 3300005467 Bacteria 10818
33 Ga0070706_100012196 3300005467 Bacteria 7966
34 Ga0070706_100018246 3300005467 Bacteria 6475
35 Ga0070706_100037035 3300005467 Bacteria 4507
36 Ga0070707_100058230 3300005468 Bacteria 3706
37 Ga0070707_100089579 3300005468 Bacteria 2977
38 Ga0070707_100117480 3300005468 Bacteria 2581
39 Ga0070707_100308649 3300005468 Bacteria 1537
40 Ga0070698_100003480 3300005471 Bacteria 17332
41 Ga0070698_100022171 3300005471 Bacteria 6649
42 Ga0070698_100040448 3300005471 Bacteria 4791
43 Ga0070698_100272352 3300005471 Bacteria 1624
44 Ga0070699_100010889 3300005518 Bacteria 7867
45 Ga0070699_100017827 3300005518 Bacteria 6097
46 Ga0070699_100029521 3300005518 Bacteria 4727
47 Ga0070699_100134893 3300005518 Bacteria 2177
48 Ga0070699_100241109 3300005518 Bacteria 1614
49 Ga0070679_100021924 3300005530 Bacteria 6239
50 Ga0070684_100030948 3300005535 Bacteria 4552
51 Ga0070697_100001477 3300005536 Bacteria 17862
52 Ga0070697_100002358 3300005536 Bacteria 14524
53 Ga0070697_100008245 3300005536 Bacteria 8131
54 Ga0070697_100008299 3300005536 Bacteria 8105
55 Ga0070697_100079458 3300005536 Bacteria 2700
56 Ga0070697_100372358 3300005536 Bacteria 1236
57 Ga0068853_100000513 3300005539 Bacteria 26286
58 Ga0070672_100231185 3300005543 Bacteria 1553
59 Ga0070695_100006321 3300005545 Bacteria 7001
60 Ga0070696_100000125 3300005546 Bacteria 40741
61 Ga0070696_100029443 3300005546 Bacteria 3754
62 Ga0070693_100004832 3300005547 Bacteria 6426
63 Ga0070693_100046587 3300005547 Bacteria 2463
64 Ga0070704_100028906 3300005549 Bacteria 3695
65 Ga0070704_100157912 3300005549 Bacteria 1790
66 Ga0068855_100001061 3300005563 Bacteria 34091
67 Ga0068856_100002919 3300005614 Bacteria 17510
68 Ga0068856_100310048 3300005614 Bacteria 1596
69 Ga0070702_100008006 3300005615 Bacteria 5097
70 Ga0068859_100002731 3300005617 Bacteria 17899
71 Ga0068859_100012675 3300005617 Bacteria 8477
72 Ga0068864_100019370 3300005618 Bacteria 5690
73 Ga0068861_100015057 3300005719 Bacteria 5443
74 Ga0068861_100039946 3300005719 Bacteria 3506
75 Ga0068861_100125259 3300005719 Bacteria 2078
76 Ga0068861_100229013 3300005719 Bacteria 1575
77 Ga0068870_10000436 3300005840 Bacteria 15820
78 Ga0068863_100068993 3300005841 Bacteria 3344
79 Ga0068860_100012761 3300005843 Bacteria 8261
80 Ga0068860_100426147 3300005843 Unclassified 1316
81 Ga0068862_100000708 3300005844 Bacteria 34089
82 Ga0068862_100011329 3300005844 Bacteria 7363
83 Ga0068862_100041312 3300005844 Bacteria 3923
84 Ga0081455_10002510 3300005937 Bacteria 21783
85 Ga0081539_10000920 3300005985 Bacteria 55416
86 Ga0075428_100000277 3300006844 Bacteria 51053
87 Ga0075428_100004521 3300006844 Bacteria 15363
88 Ga0075428_100007434 3300006844 Bacteria 12137
89 Ga0075428_100014308 3300006844 Bacteria 8820
90 Ga0075428_100246704 3300006844 Bacteria 1925
91 Ga0075428_100400487 3300006844 Bacteria 1471
92 Ga0075430_100001380 3300006846 Bacteria 19711
93 Ga0075430_100006731 3300006846 Bacteria 9694
94 Ga0075430_100011398 3300006846 Bacteria 7547
95 Ga0075430_100016771 3300006846 Bacteria 6238
96 Ga0075430_100097161 3300006846 Bacteria 2461
97 Ga0075431_100000902 3300006847 Bacteria 26158
98 Ga0075431_100001042 3300006847 Bacteria 24720
99 Ga0075431_100001572 3300006847 Bacteria 21215
100 Ga0075431_100009284 3300006847 Bacteria 9866
101 Ga0075431_100026966 3300006847 Bacteria 5894
102 Ga0075431_100034115 3300006847 Bacteria 5244
103 Ga0075431_100053424 3300006847 Bacteria 4166
104 Ga0075431_100062788 3300006847 Bacteria 3833
105 Ga0075431_100362035 3300006847 Bacteria 1457
106 Ga0075433_10010197 3300006852 Bacteria 7535
107 Ga0075433_10012425 3300006852 Bacteria 6881
108 Ga0075433_10031477 3300006852 Bacteria 4535
109 Ga0075433_10178935 3300006852 Bacteria 1887
110 Ga0075434_100000436 3300006871 Bacteria 30954
111 Ga0075434_100031669 3300006871 Bacteria 5214
112 Ga0075434_100036689 3300006871 Bacteria 4850
113 Ga0075434_100082306 3300006871 Bacteria 3216
114 Ga0075434_100138513 3300006871 Bacteria 2453
115 Ga0075434_100150753 3300006871 Bacteria 2345
116 Ga0075434_100162601 3300006871 Bacteria 2252
117 Ga0075429_100000974 3300006880 Bacteria 22720
118 Ga0075429_100010414 3300006880 Bacteria 8046
119 Ga0075429_100013147 3300006880 Bacteria 7182
120 Ga0075429_100013171 3300006880 Bacteria 7174
121 Ga0075429_100014740 3300006880 Bacteria 6775
122 Ga0075429_100027559 3300006880 Bacteria 4931
123 Ga0075436_100038498 3300006914 Bacteria 3301
124 Ga0097620_100002731 3300006931 Bacteria 17899
125 Ga0097620_100012675 3300006931 Bacteria 8477
126 Ga0097620_100068004 3300006931 Bacteria 3597
127 Ga0075435_100010350 3300007076 Bacteria 6819
128 Ga0075435_100061354 3300007076 Bacteria 3050
129 Ga0075435_100115975 3300007076 Bacteria 2231
130 Ga0075435_100190589 3300007076 Bacteria 1735
131 Ga0099794_10006432 3300007265 Bacteria 4759
132 Ga0099794_10078402 3300007265 Bacteria 1626
133 Ga0111539_10000808 3300009094 Bacteria 40653
134 Ga0111539_10041676 3300009094 Bacteria 5518
135 Ga0111539_10116626 3300009094 Bacteria 3131
136 Ga0105245_10154294 3300009098 Bacteria 2174
137 Ga0114129_10000315 3300009147 Bacteria 56522
138 Ga0114129_10001207 3300009147 Bacteria 34315
139 Ga0114129_10001698 3300009147 Bacteria 30035
140 Ga0114129_10002048 3300009147 Bacteria 27665
141 Ga0114129_10002275 3300009147 Bacteria 26570
142 Ga0114129_10002668 3300009147 Bacteria 24836
143 Ga0114129_10013755 3300009147 Bacteria 11534
144 Ga0114129_10016287 3300009147 Bacteria 10582
145 Ga0114129_10019422 3300009147 Bacteria 9676
146 Ga0114129_10023771 3300009147 Bacteria 8686
147 Ga0114129_10040948 3300009147 Bacteria 6529
148 Ga0114129_10096788 3300009147 Bacteria 4086
149 Ga0114129_10107442 3300009147 Bacteria 3854
150 Ga0114129_10191397 3300009147 Bacteria 2777
151 Ga0114129_10216662 3300009147 Bacteria 2585
152 Ga0105243_10017632 3300009148 Bacteria 5400
153 Ga0105241_10000742 3300009174 Bacteria 24808
154 Ga0105249_10025612 3300009553 Bacteria 5313
155 Ga0105249_10134684 3300009553 Bacteria 2363
156 Ga0105249_10321486 3300009553 Bacteria 1559
157 Ga0105246_10077349 3300011119 Bacteria 2360
158 Ga0157373_10001020 3300013100 Bacteria 21661
159 Ga0157369_10019024 3300013105 Bacteria 7691
160 Ga0157378_10081691 3300013297 Bacteria 2921
161 Ga0163162_10028087 3300013306 Bacteria 5565
162 Ga0157372_10000270 3300013307 Bacteria 57505
163 Ga0163163_10256816 3300014325 Bacteria 1798
164 Ga0157376_10009912 3300014969 Bacteria 6949
165 Ga0213876_10045180 3300021384 Bacteria 2330
166 Ga0213875_10000008 3300021388 Bacteria 533344
167 Ga0207653_10002638 3300025885 Bacteria 5694
168 Ga0207642_10105025 3300025899 Bacteria 1426
169 Ga0207688_10018209 3300025901 Bacteria 3823
170 Ga0207645_10000163 3300025907 Bacteria 52572
171 Ga0207645_10034982 3300025907 Bacteria 3226
172 Ga0207643_10000017 3300025908 Bacteria 114659
173 Ga0207684_10000969 3300025910 Bacteria 32131
174 Ga0207684_10006670 3300025910 Bacteria 10491
175 Ga0207684_10077399 3300025910 Bacteria 2828
176 Ga0207684_10080143 3300025910 Bacteria 2777
177 Ga0207684_10096346 3300025910 Bacteria 2525
178 Ga0207684_10109245 3300025910 Bacteria 2367
179 Ga0207684_10146083 3300025910 Bacteria 2034
180 Ga0207707_10000289 3300025912 Bacteria 53542
181 Ga0207707_10098918 3300025912 Bacteria 2550
182 Ga0207663_10238274 3300025916 Bacteria 1333
183 Ga0207660_10000137 3300025917 Bacteria 43795
184 Ga0207662_10202512 3300025918 Bacteria 1285
185 Ga0207657_10000617 3300025919 Bacteria 37736
186 Ga0207649_10004945 3300025920 Bacteria 7205
187 Ga0207652_10000347 3300025921 Bacteria 48029
188 Ga0207646_10001076 3300025922 Bacteria 34787
189 Ga0207646_10017793 3300025922 Bacteria 6640
190 Ga0207646_10396043 3300025922 Bacteria 1247
191 Ga0207681_10013767 3300025923 Bacteria 5010
192 Ga0207681_10019343 3300025923 Bacteria 4302
193 Ga0207681_10054196 3300025923 Bacteria 2726
194 Ga0207650_10115019 3300025925 Bacteria 2087
195 Ga0207659_10159454 3300025926 Bacteria 1769
196 Ga0207687_10055082 3300025927 Bacteria 2785
197 Ga0207706_10005628 3300025933 Bacteria 11673
198 Ga0207706_10015040 3300025933 Bacteria 7005
199 Ga0207706_10149689 3300025933 Bacteria 2053
200 Ga0207709_10127592 3300025935 Bacteria 1728
201 Ga0207670_10082485 3300025936 Bacteria 2253
202 Ga0207665_10011199 3300025939 Bacteria 5887
203 Ga0207691_10190693 3300025940 Bacteria 1788
204 Ga0207689_10000143 3300025942 Bacteria 61419
205 Ga0207689_10029283 3300025942 Bacteria 4600
206 Ga0207679_10000337 3300025945 Bacteria 34917
207 Ga0207667_10001401 3300025949 Bacteria 30228
208 Ga0207712_10060655 3300025961 Bacteria 2682
209 Ga0207712_10079418 3300025961 Bacteria 2383
210 Ga0207668_10044022 3300025972 Bacteria 3034
211 Ga0207640_10002945 3300025981 Bacteria 9157
212 Ga0207658_10289711 3300025986 Bacteria 1407
213 Ga0207703_10008909 3300026035 Bacteria 7904
214 Ga0207639_10005190 3300026041 Bacteria 8789
215 Ga0207678_10000669 3300026067 Bacteria 31460
216 Ga0207702_10000780 3300026078 Bacteria 33702
217 Ga0207641_10026416 3300026088 Bacteria 4791
218 Ga0207641_10108521 3300026088 Bacteria 2457
219 Ga0207648_10002299 3300026089 Bacteria 20648
220 Ga0207648_10193965 3300026089 Bacteria 1801
221 Ga0207648_10266248 3300026089 Bacteria 1530
222 Ga0207676_10012116 3300026095 Bacteria 6173
223 Ga0207674_10000965 3300026116 Bacteria 37621
224 Ga0207674_10019125 3300026116 Bacteria 7424
225 Ga0207675_100007267 3300026118 Bacteria 10470
226 Ga0207675_100033648 3300026118 Bacteria 4775
227 Ga0207675_100045227 3300026118 Bacteria 4113
228 Ga0209983_1000515 3300027665 Bacteria 8345
229 Ga0209971_1000007 3300027682 Bacteria 106624
230 Ga0209966_1000070 3300027695 Bacteria 45819
231 Ga0209998_10000009 3300027717 Bacteria 98699
232 Ga0209974_10002437 3300027876 Bacteria 6725
233 Ga0207428_10000009 3300027907 Bacteria 410565
234 Ga0207428_10019820 3300027907 Bacteria 5729
235 Ga0268265_10006884 3300028380 Bacteria 7689
236 Ga0268265_10012419 3300028380 Bacteria 5772
237 Ga0268265_10198160 3300028380 Unclassified 1739
238 Ga0268264_10162078 3300028381 Bacteria 2015
239 Ga0307409_100035975 3300031995 Bacteria 3634
240 Ga0307416_100440459 3300032002 Bacteria 1353
241 Ga0307411_10221665 3300032005 Bacteria 1468
242 Ga0373951_0015748 3300035091 Bacteria 1705
243 Ga0373946_0045252 3300035171 Bacteria 1820
244 Ga0373961_0011367 3300035241 Bacteria 2208
245 Ga0373937_0199123 3300036401 Bacteria 1883
246 Ga0395899_0139515 3300037312 Bacteria 1726
247 Ga0395900_0023334 3300037418 Bacteria 6332
248 Ga0395898_0066643 3300037466 Bacteria 3487
249 Ga0436364_1415525 3300037853 Bacteria 425173
250 Ga0395901_0006112 3300038443 Bacteria 12201
251 Ga0436365_0905834 3300039437 Bacteria 3102
252 Ga0439448_0001114 3300042005 Bacteria 6771
253 Ga0439463_014014 3300042016 Bacteria 1976
254 Ga0439458_0002725 3300042157 Bacteria 4263
255 Ga0439464_0004629 3300042439 Bacteria 3524
256 Ga0439460_0001762 3300042461 Bacteria 5139
257 Ga0451577_0000484 3300042876 Bacteria 67383
258 Ga0451577_0004978 3300042876 Bacteria 13780
259 Ga0451577_0025701 3300042876 Bacteria 5341
260 Ga0451577_0027589 3300042876 Bacteria 5140
261 Ga0451577_0115582 3300042876 Bacteria 2403
262 Ga0451577_0329210 3300042876 Bacteria 1385
263 Ga0453683_0045235 3300044673 Bacteria 2760
264 Ga0453684_0001451 3300044712 Bacteria 67383
265 Ga0453684_0010059 3300044712 Bacteria 16264
266 Ga0453684_0029994 3300044712 Bacteria 7700
267 Ga0453684_0066967 3300044712 Bacteria 4570
268 Ga0453684_0336578 3300044712 Bacteria 1705
269 Ga0451576_0000256 3300045051 Bacteria 130491
270 Ga0451576_0006362 3300045051 Bacteria 14499
271 Ga0451576_0011944 3300045051 Bacteria 9813
272 Ga0451576_0074146 3300045051 Bacteria 3541
273 Ga0451576_0081214 3300045051 Unclassified 3372
274 Ga0451576_0231139 3300045051 Bacteria 1931
275 Ga0451576_0325982 3300045051 Bacteria 1607
276 Ga0495629_0174078 3300046459 Bacteria 1493
277 Ga0495580_0002552 3300046472 Bacteria 15867
278 Ga0495580_0103844 3300046472 Bacteria 1975
279 Ga0495628_0035448 3300046516 Bacteria 4009
280 Ga0495586_0017326 3300046535 Bacteria 3830
281 Ga0495634_0056344 3300046642 Bacteria 2626
282 Ga0496112_0106861 3300048915 Bacteria 2769
283 Ga0496126_0087106 3300048929 Bacteria 2752
284 Ga0496126_0224610 3300048929 Bacteria 1576
285 Ga0501031_0015812 3300049568 Bacteria 4899
286 Ga0501032_0185206 3300049569 Bacteria 1362
287 Ga0501033_0018670 3300049570 Bacteria 5241
288 Ga0501036_0053377 3300049572 Bacteria 3423
289 Ga0501036_0077766 3300049572 Bacteria 2807
290 Ga0501036_0104130 3300049572 Bacteria 2400
291 Ga0501036_0276263 3300049572 Bacteria 1406
292 Ga0501038_0006607 3300049574 Bacteria 10728
293 Ga0501038_0218218 3300049574 Bacteria 1523
294 Ga0501039_0005057 3300049575 Bacteria 10002
295 Ga0501039_0015353 3300049575 Bacteria 5863
296 Ga0501039_0020148 3300049575 Bacteria 5114
297 Ga0501039_0070872 3300049575 Bacteria 2708
298 Ga0501039_0118275 3300049575 Bacteria 2076
299 Ga0501040_0000096 3300049576 Bacteria 44128
300 Ga0501040_0006784 3300049576 Bacteria 7424
301 Ga0501041_0006334 3300049577 Bacteria 6924
302 Ga0501041_0007044 3300049577 Bacteria 6595
303 Ga0501041_0023730 3300049577 Bacteria 3678
304 Ga0501041_0025955 3300049577 Bacteria 3523
305 Ga0501041_0086676 3300049577 Bacteria 1932
306 Ga0501042_0000123 3300049578 Bacteria 33177
307 Ga0501042_0006043 3300049578 Bacteria 7841
308 Ga0501042_0058898 3300049578 Bacteria 2742
309 Ga0501042_0193894 3300049578 Bacteria 1465
310 Ga0501042_0306378 3300049578 Bacteria 1147
311 Ga0501043_0015598 3300049579 Bacteria 5955
312 Ga0501046_0000002 3300049580 Bacteria 526908
313 Ga0501046_0000558 3300049580 Bacteria 36981
314 Ga0501046_0016049 3300049580 Bacteria 6279
315 Ga0501046_0018793 3300049580 Bacteria 5741
316 Ga0501047_0047515 3300049581 Bacteria 4146
317 Ga0501048_0003981 3300049582 Bacteria 11218
318 Ga0501048_0030257 3300049582 Bacteria 3917
319 Ga0501048_0042133 3300049582 Bacteria 3270
320 Ga0501067_0008809 3300049583 Bacteria 5590
321 Ga0501068_0167697 3300049584 Bacteria 1385
322 Ga0501068_0175104 3300049584 Bacteria 1355
323 Ga0501069_0040907 3300049585 Bacteria 2561
324 Ga0501071_0006212 3300049587 Bacteria 7749
325 Ga0501071_0043881 3300049587 Bacteria 3207
326 Ga0501071_0095054 3300049587 Bacteria 2193
327 Ga0501071_0115163 3300049587 Bacteria 1989
328 Ga0501072_0003595 3300049588 Bacteria 11669
329 Ga0501072_0024603 3300049588 Bacteria 4686
330 Ga0501072_0031033 3300049588 Bacteria 4181
331 Ga0501072_0092000 3300049588 Bacteria 2408
332 Ga0501072_0110982 3300049588 Bacteria 2183
333 Ga0501073_0143987 3300049589 Bacteria 1652
334 Ga0501074_0020870 3300049590 Bacteria 4758
335 Ga0501074_0240130 3300049590 Bacteria 1289
336 Ga0501075_0001409 3300049591 Bacteria 15662
337 Ga0501075_0008954 3300049591 Bacteria 6984
338 Ga0501075_0013179 3300049591 Bacteria 5895
339 Ga0501075_0016004 3300049591 Bacteria 5395
340 Ga0501075_0034244 3300049591 Bacteria 3781
341 Ga0501075_0034764 3300049591 Bacteria 3754
342 Ga0501075_0044343 3300049591 Bacteria 3337
343 Ga0501075_0070891 3300049591 Bacteria 2634
344 Ga0501076_0000293 3300049592 Bacteria 31155
345 Ga0501076_0000738 3300049592 Bacteria 21154
346 Ga0501076_0003820 3300049592 Bacteria 10608
347 Ga0501076_0010571 3300049592 Bacteria 6852
348 Ga0501076_0033463 3300049592 Bacteria 4013
349 Ga0501076_0041524 3300049592 Bacteria 3619
350 Ga0501076_0169228 3300049592 Bacteria 1781
351 Ga0501077_0003260 3300049593 Bacteria 9778
352 Ga0501077_0005369 3300049593 Bacteria 7794
353 Ga0501077_0019523 3300049593 Bacteria 4287
354 Ga0501077_0030776 3300049593 Bacteria 3416
355 Ga0501079_0000518 3300049741 Bacteria 25104
356 Ga0501079_0003682 3300049741 Bacteria 11298
357 Ga0501079_0056733 3300049741 Bacteria 3022
358 Ga0501079_0070853 3300049741 Bacteria 2692
359 Ga0501079_0210764 3300049741 Bacteria 1517
360 Ga0501079_0257397 3300049741 Bacteria 1364
361 Ga0501080_0000491 3300049742 Bacteria 30852
362 Ga0501080_0097934 3300049742 Bacteria 2723
363 Ga0501080_0111707 3300049742 Bacteria 2533
364 Ga0501081_0010946 3300049743 Bacteria 5928
365 Ga0501081_0011311 3300049743 Bacteria 5838
366 Ga0501081_0025784 3300049743 Bacteria 3959
367 Ga0501081_0026917 3300049743 Bacteria 3880
368 Ga0501081_0045434 3300049743 Bacteria 3016
369 Ga0501081_0071175 3300049743 Bacteria 2424
370 Ga0501081_0104136 3300049743 Bacteria 2009
371 Ga0501083_0014235 3300049744 Bacteria 5565
372 Ga0501035_0044767 3300049822 Bacteria 3984
373 Ga0501035_0180221 3300049822 Bacteria 1820
374 Ga0501045_0000068 3300049824 Bacteria 48222
375 Ga0501045_0000104 3300049824 Bacteria 41730
376 Ga0501045_0043032 3300049824 Bacteria 3288
377 Ga0501045_0055594 3300049824 Bacteria 2894
378 Ga0501045_0144736 3300049824 Bacteria 1768
379 Ga0501045_0191113 3300049824 Bacteria 1526
380 Ga0501045_0288196 3300049824 Bacteria 1222
381 Ga0501045_0358375 3300049824 Bacteria 1085
382 nmdc:mga05p37_104535_c1 3300050507 Bacteria 3484
383 nmdc:mga05p37_11152_c1 3300050507 Bacteria 10680
384 nmdc:mga05p37_1261_c1 3300050507 Bacteria 29344
385 nmdc:mga05p37_1615_c2 3300050507 Bacteria 9502
386 nmdc:mga05p37_1641_c1 3300050507 Bacteria 25943
387 nmdc:mga05p37_237955_c1 3300050507 Bacteria 2191
388 nmdc:mga05p37_23981_c1 3300050507 Bacteria 7409
389 nmdc:mga05p37_24513_c1 3300050507 Bacteria 7334
390 nmdc:mga05p37_247085_c1 3300050507 Bacteria 2142
391 nmdc:mga05p37_35191_c1 3300050507 Bacteria 6140
392 nmdc:mga05p37_37310_c1 3300050507 Bacteria 5958
393 nmdc:mga05p37_502_c1 3300050507 Bacteria 43047
394 nmdc:mga09592_142951_c1 3300050508 Bacteria 2063
395 nmdc:mga09592_3974_c1 3300050508 Bacteria 11909
396 nmdc:mga09592_536_c1 3300050508 Bacteria 28695
397 nmdc:mga09592_821_c1 3300050508 Bacteria 24038
398 nmdc:mga0qj67_286967_c1 3300050509 Bacteria 1334
399 nmdc:mga0qj67_301672_c1 3300050509 Bacteria 1298
400 nmdc:mga0qj67_4456_c1 3300050509 Bacteria 10146
401 nmdc:mga0qj67_632_c1 3300050509 Bacteria 24182
402 nmdc:mga06r32_1465_c1 3300050510 Bacteria 21248
403 nmdc:mga06r32_1523_c1 3300050510 Bacteria 20829
404 nmdc:mga06r32_181057_c1 3300050510 Bacteria 2093
405 nmdc:mga06r32_303850_c1 3300050510 Bacteria 1581
406 nmdc:mga06r32_348098_c1 3300050510 Bacteria 1466
407 nmdc:mga06r32_35738_c1 3300050510 Bacteria 4688
408 nmdc:mga06r32_3673_c1 3300050510 Bacteria 13707
409 nmdc:mga06r32_51562_c1 3300050510 Bacteria 3938
410 nmdc:mga08y16_2549_c1 3300050511 Bacteria 18737
411 nmdc:mga08y16_3120_c1 3300050511 Bacteria 17157
412 nmdc:mga08y16_35223_c1 3300050511 Bacteria 5258
413 nmdc:mga0n895_10199_c1 3300050512 Bacteria 8277
414 nmdc:mga0n895_13088_c1 3300050512 Bacteria 7465
415 nmdc:mga0n895_132_c1 3300050512 Bacteria 44663
416 nmdc:mga0n895_328098_c1 3300050512 Bacteria 1551
417 nmdc:mga0n895_361597_c1 3300050512 Bacteria 1470
418 nmdc:mga0n895_389657_c1 3300050512 Bacteria 1409
419 nmdc:mga0n895_84666_c1 3300050512 Bacteria 3164
420 nmdc:mga0rr50_124558_c1 3300050513 Bacteria 2056
421 nmdc:mga0rr50_132423_c1 3300050513 Bacteria 1998
422 nmdc:mga0rr50_149901_c1 3300050513 Bacteria 1884
423 nmdc:mga0rr50_18162_c1 3300050513 Bacteria 4717
424 nmdc:mga0rr50_220836_c1 3300050513 Bacteria 1565
425 nmdc:mga0rr50_23630_c1 3300050513 Bacteria 4243
426 nmdc:mga0rr50_41701_c1 3300050513 Bacteria 3347
427 nmdc:mga0rr50_6513_c1 3300050513 Bacteria 7119
428 nmdc:mga0rr50_75017_c1 3300050513 Bacteria 2591
429 nmdc:mga08x19_51658_c1 3300050514 Bacteria 2641
430 nmdc:mga0a205_154146_c1 3300050515 Bacteria 2196
431 nmdc:mga0a205_163_c1 3300050515 Bacteria 44112
432 nmdc:mga0a205_180308_c1 3300050515 Bacteria 2006
433 nmdc:mga0a205_192981_c1 3300050515 Bacteria 1928
434 nmdc:mga0a205_22020_c1 3300050515 Bacteria 6032
435 nmdc:mga0a205_27744_c1 3300050515 Bacteria 5408
436 nmdc:mga0a205_7019_c1 3300050515 Bacteria 10173
437 Ga0501084_0001122 3300054114 Bacteria 20895
438 Ga0501084_0006761 3300054114 Bacteria 9427
439 Ga0501084_0006878 3300054114 Bacteria 9362
440 Ga0501084_0008426 3300054114 Bacteria 8518
441 Ga0501082_0000297 3300060353 Bacteria 43869
442 Ga0501082_0004582 3300060353 Bacteria 12073
443 Ga0501082_0020097 3300060353 Bacteria 5755
444 Ga0501082_0022427 3300060353 Bacteria 5438
445 Ga0501082_0038062 3300060353 Bacteria 4149
446 Ga0501082_0046828 3300060353 Bacteria 3727
447 Ga0501082_0088045 3300060353 Bacteria 2679
448 Ga0501082_0125986 3300060353 Bacteria 2221
449 Ga0530510_0000009 3300061734 Bacteria 161973
450 Ga0530510_0009969 3300061734 Bacteria 6665
451 Ga0530510_0034326 3300061734 Bacteria 3653
452 Ga0530510_0050323 3300061734 Bacteria 3010
453 Ga0530510_0051607 3300061734 Bacteria 2972
454 Ga0530510_0223291 3300061734 Bacteria 1400
455 2883579827 2883577096 Bacteria 4709178
456 Ga0070699_100055415
457 JGI25406J46586_10016074
458 Ga0070690_100038179
459 Ga0070690_100081065
460 Ga0068869_100004092
461 Ga0070680_100013991
462 Ga0070682_100000155
463 Ga0070660_100000481
464 Ga0070691_10017060
465 Ga0070687_100008746
466 Ga0070692_10000554
467 Ga0070669_100000928
468 Ga0070669_100012213
469 Ga0070659_100000164
470 Ga0070705_100001147
471 Ga0070705_100022262
472 Ga0070694_100000027
473 Ga0070694_100025049
474 Ga0070708_100016694
475 Ga0070708_100017072
476 Ga0070708_100031618
477 Ga0070708_100032683
478 Ga0070708_100190042
479 Ga0070663_100000829
480 Ga0070662_100014141
481 Ga0070662_100115636
482 Ga0070681_10004024
483 Ga0070681_10069900
484 Ga0070681_10081830
485 Ga0068867_100000779
486 Ga0070706_100005335
487 Ga0070706_100006773
488 Ga0070706_100012196
489 Ga0070706_100018246
490 Ga0070706_100037035
491 Ga0070707_100058230
492 Ga0070707_100089579
493 Ga0070707_100117480
494 Ga0070707_100308649
495 Ga0070698_100003480
496 Ga0070698_100022171
497 Ga0070698_100040448
498 Ga0070698_100272352
499 Ga0070699_100010889
500 Ga0070699_100017827
501 Ga0070699_100029521
502 Ga0070699_100134893
503 Ga0070699_100241109
504 Ga0070679_100021924
505 Ga0070684_100030948
506 Ga0070697_100001477
507 Ga0070697_100002358
508 Ga0070697_100008245
509 Ga0070697_100008299
510 Ga0070697_100079458
511 Ga0070697_100372358
512 Ga0068853_100000513
513 Ga0070672_100231185
514 Ga0070695_100006321
515 Ga0070696_100000125
516 Ga0070696_100029443
517 Ga0070693_100004832
518 Ga0070693_100046587
519 Ga0070704_100028906
520 Ga0070704_100157912
521 Ga0068855_100001061
522 Ga0068856_100002919
523 Ga0068856_100310048
524 Ga0070702_100008006
525 Ga0068859_100002731
526 Ga0068859_100012675
527 Ga0068864_100019370
528 Ga0068861_100015057
529 Ga0068861_100039946
530 Ga0068861_100125259
531 Ga0068861_100229013
532 Ga0068870_10000436
533 Ga0068863_100068993
534 Ga0068860_100012761
535 Ga0068860_100426147
536 Ga0068862_100000708
537 Ga0068862_100011329
538 Ga0068862_100041312
539 Ga0081455_10002510
540 Ga0081539_10000920
541 Ga0075428_100000277
542 Ga0075428_100004521
543 Ga0075428_100007434
544 Ga0075428_100014308
545 Ga0075428_100246704
546 Ga0075428_100400487
547 Ga0075430_100001380
548 Ga0075430_100006731
549 Ga0075430_100011398
550 Ga0075430_100016771
551 Ga0075430_100097161
552 Ga0075431_100000902
553 Ga0075431_100001042
554 Ga0075431_100001572
555 Ga0075431_100009284
556 Ga0075431_100026966
557 Ga0075431_100034115
558 Ga0075431_100053424
559 Ga0075431_100062788
560 Ga0075431_100362035
561 Ga0075433_10010197
562 Ga0075433_10012425
563 Ga0075433_10031477
564 Ga0075433_10178935
565 Ga0075434_100000436
566 Ga0075434_100031669
567 Ga0075434_100036689
568 Ga0075434_100082306
569 Ga0075434_100138513
570 Ga0075434_100150753
571 Ga0075434_100162601
572 Ga0075429_100000974
573 Ga0075429_100010414
574 Ga0075429_100013147
575 Ga0075429_100013171
576 Ga0075429_100014740
577 Ga0075429_100027559
578 Ga0075436_100038498
579 Ga0097620_100002731
580 Ga0097620_100012675
581 Ga0097620_100068004
582 Ga0075435_100010350
583 Ga0075435_100061354
584 Ga0075435_100115975
585 Ga0075435_100190589
586 Ga0099794_10006432
587 Ga0099794_10078402
588 Ga0111539_10000808
589 Ga0111539_10041676
590 Ga0111539_10116626
591 Ga0105245_10154294
592 Ga0114129_10000315
593 Ga0114129_10001207
594 Ga0114129_10001698
595 Ga0114129_10002048
596 Ga0114129_10002275
597 Ga0114129_10002668
598 Ga0114129_10013755
599 Ga0114129_10016287
600 Ga0114129_10019422
601 Ga0114129_10023771
602 Ga0114129_10040948
603 Ga0114129_10096788
604 Ga0114129_10107442
605 Ga0114129_10191397
606 Ga0114129_10216662
607 Ga0105243_10017632
608 Ga0105241_10000742
609 Ga0105249_10025612
610 Ga0105249_10134684
611 Ga0105249_10321486
612 Ga0105246_10077349
613 Ga0157373_10001020
614 Ga0157369_10019024
615 Ga0157378_10081691
616 Ga0163162_10028087
617 Ga0157372_10000270
618 Ga0163163_10256816
619 Ga0157376_10009912
620 Ga0213876_10045180
621 Ga0213875_10000008
622 Ga0207653_10002638
623 Ga0207642_10105025
624 Ga0207688_10018209
625 Ga0207645_10000163
626 Ga0207645_10034982
627 Ga0207643_10000017
628 Ga0207684_10000969
629 Ga0207684_10006670
630 Ga0207684_10077399
631 Ga0207684_10080143
632 Ga0207684_10096346
633 Ga0207684_10109245
634 Ga0207684_10146083
635 Ga0207707_10000289
636 Ga0207707_10098918
637 Ga0207663_10238274
638 Ga0207660_10000137
639 Ga0207662_10202512
640 Ga0207657_10000617
641 Ga0207649_10004945
642 Ga0207652_10000347
643 Ga0207646_10001076
644 Ga0207646_10017793
645 Ga0207646_10396043
646 Ga0207681_10013767
647 Ga0207681_10019343
648 Ga0207681_10054196
649 Ga0207650_10115019
650 Ga0207659_10159454
651 Ga0207687_10055082
652 Ga0207706_10005628
653 Ga0207706_10015040
654 Ga0207706_10149689
655 Ga0207709_10127592
656 Ga0207670_10082485
657 Ga0207665_10011199
658 Ga0207691_10190693
659 Ga0207689_10000143
660 Ga0207689_10029283
661 Ga0207679_10000337
662 Ga0207667_10001401
663 Ga0207712_10060655
664 Ga0207712_10079418
665 Ga0207668_10044022
666 Ga0207640_10002945
667 Ga0207658_10289711
668 Ga0207703_10008909
669 Ga0207639_10005190
670 Ga0207678_10000669
671 Ga0207702_10000780
672 Ga0207641_10026416
673 Ga0207641_10108521
674 Ga0207648_10002299
675 Ga0207648_10193965
676 Ga0207648_10266248
677 Ga0207676_10012116
678 Ga0207674_10000965
679 Ga0207674_10019125
680 Ga0207675_100007267
681 Ga0207675_100033648
682 Ga0207675_100045227
683 Ga0209983_1000515
684 Ga0209971_1000007
685 Ga0209966_1000070
686 Ga0209998_10000009
687 Ga0209974_10002437
688 Ga0207428_10000009
689 Ga0207428_10019820
690 Ga0268265_10006884
691 Ga0268265_10012419
692 Ga0268265_10198160
693 Ga0268264_10162078
694 Ga0307409_100035975
695 Ga0307416_100440459
696 Ga0307411_10221665
697 Ga0373951_0015748
698 Ga0373946_0045252
699 Ga0373961_0011367
700 Ga0373937_0199123
701 Ga0395899_0139515
702 Ga0395900_0023334
703 Ga0395898_0066643
704 Ga0436364_1415525
705 Ga0395901_0006112
706 Ga0436365_0905834
707 Ga0439448_0001114
708 Ga0439463_014014
709 Ga0439458_0002725
710 Ga0439464_0004629
711 Ga0439460_0001762
712 Ga0451577_0000484
713 Ga0451577_0004978
714 Ga0451577_0025701
715 Ga0451577_0027589
716 Ga0451577_0115582
717 Ga0451577_0329210
718 Ga0453683_0045235
719 Ga0453684_0001451
720 Ga0453684_0010059
721 Ga0453684_0029994
722 Ga0453684_0066967
723 Ga0453684_0336578
724 Ga0451576_0000256
725 Ga0451576_0006362
726 Ga0451576_0011944
727 Ga0451576_0074146
728 Ga0451576_0081214
729 Ga0451576_0231139
730 Ga0451576_0325982
731 Ga0495629_0174078
732 Ga0495580_0002552
733 Ga0495580_0103844
734 Ga0495628_0035448
735 Ga0495586_0017326
736 Ga0495634_0056344
737 Ga0496112_0106861
738 Ga0496126_0087106
739 Ga0496126_0224610
740 Ga0501031_0015812
741 Ga0501032_0185206
742 Ga0501033_0018670
743 Ga0501036_0053377
744 Ga0501036_0077766
745 Ga0501036_0104130
746 Ga0501036_0276263
747 Ga0501038_0006607
748 Ga0501038_0218218
749 Ga0501039_0005057
750 Ga0501039_0015353
751 Ga0501039_0020148
752 Ga0501039_0070872
753 Ga0501039_0118275
754 Ga0501040_0000096
755 Ga0501040_0006784
756 Ga0501041_0006334
757 Ga0501041_0007044
758 Ga0501041_0023730
759 Ga0501041_0025955
760 Ga0501041_0086676
761 Ga0501042_0000123
762 Ga0501042_0006043
763 Ga0501042_0058898
764 Ga0501042_0193894
765 Ga0501042_0306378
766 Ga0501043_0015598
767 Ga0501046_0000002
768 Ga0501046_0000558
769 Ga0501046_0016049
770 Ga0501046_0018793
771 Ga0501047_0047515
772 Ga0501048_0003981
773 Ga0501048_0030257
774 Ga0501048_0042133
775 Ga0501067_0008809
776 Ga0501068_0167697
777 Ga0501068_0175104
778 Ga0501069_0040907
779 Ga0501071_0006212
780 Ga0501071_0043881
781 Ga0501071_0095054
782 Ga0501071_0115163
783 Ga0501072_0003595
784 Ga0501072_0024603
785 Ga0501072_0031033
786 Ga0501072_0092000
787 Ga0501072_0110982
788 Ga0501073_0143987
789 Ga0501074_0020870
790 Ga0501074_0240130
791 Ga0501075_0001409
792 Ga0501075_0008954
793 Ga0501075_0013179
794 Ga0501075_0016004
795 Ga0501075_0034244
796 Ga0501075_0034764
797 Ga0501075_0044343
798 Ga0501075_0070891
799 Ga0501076_0000293
800 Ga0501076_0000738
801 Ga0501076_0003820
802 Ga0501076_0010571
803 Ga0501076_0033463
804 Ga0501076_0041524
805 Ga0501076_0169228
806 Ga0501077_0003260
807 Ga0501077_0005369
808 Ga0501077_0019523
809 Ga0501077_0030776
810 Ga0501079_0000518
811 Ga0501079_0003682
812 Ga0501079_0056733
813 Ga0501079_0070853
814 Ga0501079_0210764
815 Ga0501079_0257397
816 Ga0501080_0000491
817 Ga0501080_0097934
818 Ga0501080_0111707
819 Ga0501081_0010946
820 Ga0501081_0011311
821 Ga0501081_0025784
822 Ga0501081_0026917
823 Ga0501081_0045434
824 Ga0501081_0071175
825 Ga0501081_0104136
826 Ga0501083_0014235
827 Ga0501035_0044767
828 Ga0501035_0180221
829 Ga0501045_0000068
830 Ga0501045_0000104
831 Ga0501045_0043032
832 Ga0501045_0055594
833 Ga0501045_0144736
834 Ga0501045_0191113
835 Ga0501045_0288196
836 Ga0501045_0358375
837 nmdc:mga05p37_104535_c1
838 nmdc:mga05p37_11152_c1
839 nmdc:mga05p37_1261_c1
840 nmdc:mga05p37_1615_c2
841 nmdc:mga05p37_1641_c1
842 nmdc:mga05p37_237955_c1
843 nmdc:mga05p37_23981_c1
844 nmdc:mga05p37_24513_c1
845 nmdc:mga05p37_247085_c1
846 nmdc:mga05p37_35191_c1
847 nmdc:mga05p37_37310_c1
848 nmdc:mga05p37_502_c1
849 nmdc:mga09592_142951_c1
850 nmdc:mga09592_3974_c1
851 nmdc:mga09592_536_c1
852 nmdc:mga09592_821_c1
853 nmdc:mga0qj67_286967_c1
854 nmdc:mga0qj67_301672_c1
855 nmdc:mga0qj67_4456_c1
856 nmdc:mga0qj67_632_c1
857 nmdc:mga06r32_1465_c1
858 nmdc:mga06r32_1523_c1
859 nmdc:mga06r32_181057_c1
860 nmdc:mga06r32_303850_c1
861 nmdc:mga06r32_348098_c1
862 nmdc:mga06r32_35738_c1
863 nmdc:mga06r32_3673_c1
864 nmdc:mga06r32_51562_c1
865 nmdc:mga08y16_2549_c1
866 nmdc:mga08y16_3120_c1
867 nmdc:mga08y16_35223_c1
868 nmdc:mga0n895_10199_c1
869 nmdc:mga0n895_13088_c1
870 nmdc:mga0n895_132_c1
871 nmdc:mga0n895_328098_c1
872 nmdc:mga0n895_361597_c1
873 nmdc:mga0n895_389657_c1
874 nmdc:mga0n895_84666_c1
875 nmdc:mga0rr50_124558_c1
876 nmdc:mga0rr50_132423_c1
877 nmdc:mga0rr50_149901_c1
878 nmdc:mga0rr50_18162_c1
879 nmdc:mga0rr50_220836_c1
880 nmdc:mga0rr50_23630_c1
881 nmdc:mga0rr50_41701_c1
882 nmdc:mga0rr50_6513_c1
883 nmdc:mga0rr50_75017_c1
884 nmdc:mga08x19_51658_c1
885 nmdc:mga0a205_154146_c1
886 nmdc:mga0a205_163_c1
887 nmdc:mga0a205_180308_c1
888 nmdc:mga0a205_192981_c1
889 nmdc:mga0a205_22020_c1
890 nmdc:mga0a205_27744_c1
891 nmdc:mga0a205_7019_c1
892 Ga0501084_0001122
893 Ga0501084_0006761
894 Ga0501084_0006878
895 Ga0501084_0008426
896 Ga0501082_0000297
897 Ga0501082_0004582
898 Ga0501082_0020097
899 Ga0501082_0022427
900 Ga0501082_0038062
901 Ga0501082_0046828
902 Ga0501082_0088045
903 Ga0501082_0125986
904 Ga0530510_0000009
905 Ga0530510_0009969
906 Ga0530510_0034326
907 Ga0530510_0050323
908 Ga0530510_0051607
909 Ga0530510_0223291
910 2883579827

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02277

DBI_PRT

Phosphoribosyltransferase

11

346

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b5f-assembly1.cif.gz_A crystal structure of nicotinate mononucleotide-5,6-dimethylbenzimidazole phosphoribosyltransferase cobt from yersinia enterocolitica 0.9724 2 340
4kqi-assembly1.cif.gz_A-2 crystal structure of cobt e317a complexed with its reaction products 0.9667 3 340
6b5f-assembly1.cif.gz_B crystal structure of nicotinate mononucleotide-5,6-dimethylbenzimidazole phosphoribosyltransferase cobt from yersinia enterocolitica 0.9664 2 340
1j33-assembly1.cif.gz_A-2 crystal structure of cobt from thermus thermophilus hb8 0.965 17 349
4hdm-assembly1.cif.gz_A crystal structure of arsab in complex with p-cresol 0.9643 4 337
ID Description Score Start End Superfamily
1d0sA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase (CobT), large domain 0.9816 56 327 3.40.50.10210
1d0sA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase (CobT), large domain 0.971 56 327 3.40.50.10210
1wx1B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase (CobT), large domain 0.9676 56 329 3.40.50.10210
1wx1B02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase (CobT), large domain 0.9641 56 329 3.40.50.10210
4hdkB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Nicotinate-nucleotide-dimethylbenzimidazole phosphoribosyltransferase (CobT), large domain 0.947 58 327 3.40.50.10210
ID Description Score Start End GO Terms
AF-A0A2V6YFG3-F1-model_v4 Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (NN:DBI PRT) (EC 2.4.2.21) (N(1)-alpha-phosphoribosyltransferase) 0.9968 4 349 GO:0008939
GO:0009236
AF-X1DC82-F1-model_v4 Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase 0.9926 173 327 GO:0008939
AF-A0A1F8QP42-F1-model_v4 Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (EC 2.4.2.21) 0.9912 35 350 GO:0008939
GO:0009236
AF-A0A381KMB5-F1-model_v4 Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (EC 2.4.2.21) 0.9912 226 345 GO:0008939
AF-A0A2D6F424-F1-model_v4 Nicotinate-nucleotide--dimethylbenzimidazole phosphoribosyltransferase (EC 2.4.2.21) 0.9905 89 349 GO:0008939
GO:0009236

Map