F447547

General Info

Members Datasets Scaffolds Average Seq Length
455 249 910 69

Family's Representative Sequence

Representative Sequence 3300006038|Ga0075365_10420287|Ga0075365_104202872
Length 81
Sequence MRERPVSRVNRVPLMAEPEHGFKEGDPVWVEDGDGKHHPGVFVGDNEAPGWFGGGPSAYVAHPEAHQAEVVSIFRITPREE

Samples

Sample ID Description Type Environment
1 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
43 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
44 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
45 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
78 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
114 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
115 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
116 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
119 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
120 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
121 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
122 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
132 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
133 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
140 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
141 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
142 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
143 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
144 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
145 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
146 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
147 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
148 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
149 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
156 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
157 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
158 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
159 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
174 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
175 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
176 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
177 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
178 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
179 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
186 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
187 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
188 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
200 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
217 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
221 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
222 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
223 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
227 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
228 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
231 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
232 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
233 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
234 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
235 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
236 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
237 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
238 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
241 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
242 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
243 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
244 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
245 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
246 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.79
Nodule 0
Rhizoplane 8.79
Rhizosphere 79.78
Stem 0
Stem Tuber 0
Unclassified 16.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075365_10420287 3300006038 Bacteria 944
2 JGI24740J21852_10012572 3300001979 Bacteria 3188
3 JGI24748J21848_1000307 3300002074 Bacteria 5690
4 JGI24034J26672_10000119 3300002239 Bacteria 12014
5 JGI24742J22300_10001957 3300002244 Bacteria 3282
6 Ga0070676_11195002 3300005328 Bacteria 578
7 Ga0070683_101858864 3300005329 Bacteria 579
8 Ga0070670_100058698 3300005331 Bacteria 3303
9 Ga0070666_10494959 3300005335 Bacteria 886
10 Ga0070682_100000556 3300005337 Bacteria 23033
11 Ga0068868_101306536 3300005338 Unclassified 674
12 Ga0070691_10000074 3300005341 Bacteria 27912
13 Ga0070691_10025951 3300005341 Bacteria 2730
14 Ga0070691_10222437 3300005341 Bacteria 1001
15 Ga0070691_10494607 3300005341 Bacteria 706
16 Ga0070661_100000004 3300005344 Bacteria 243876
17 Ga0070661_100939961 3300005344 Bacteria 715
18 Ga0070661_101451168 3300005344 Bacteria 578
19 Ga0070692_10227161 3300005345 Bacteria 1106
20 Ga0070668_100544294 3300005347 Bacteria 1010
21 Ga0070668_101376163 3300005347 Bacteria 643
22 Ga0070675_100000078 3300005354 Bacteria 56469
23 Ga0070674_100000030 3300005356 Bacteria 69481
24 Ga0070673_100031795 3300005364 Bacteria 3965
25 Ga0070688_100001862 3300005365 Bacteria 10574
26 Ga0070688_100002739 3300005365 Bacteria 8952
27 Ga0070667_100133714 3300005367 Bacteria 2167
28 Ga0070701_10940642 3300005438 Bacteria 599
29 Ga0070701_10991896 3300005438 Bacteria 585
30 Ga0070700_100289426 3300005441 Unclassified 1191
31 Ga0070700_100586339 3300005441 Bacteria 871
32 Ga0070678_100004618 3300005456 Bacteria 7826
33 Ga0070685_10000189 3300005466 Bacteria 41176
34 Ga0070685_10002457 3300005466 Bacteria 9510
35 Ga0070684_100020411 3300005535 Bacteria 5498
36 Ga0070684_101165193 3300005535 Bacteria 725
37 Ga0068853_101189713 3300005539 Bacteria 736
38 Ga0070686_100136141 3300005544 Bacteria 1705
39 Ga0070686_100336405 3300005544 Unclassified 1130
40 Ga0070686_101452221 3300005544 Bacteria 577
41 Ga0070695_100145570 3300005545 Unclassified 1648
42 Ga0070696_101228596 3300005546 Bacteria 634
43 Ga0070665_100000682 3300005548 Bacteria 45471
44 Ga0070704_102133956 3300005549 Unclassified 521
45 Ga0068855_100465422 3300005563 Bacteria 1378
46 Ga0070664_100521275 3300005564 Bacteria 1097
47 Ga0068854_100000062 3300005578 Bacteria 78159
48 Ga0068856_100000377 3300005614 Bacteria 48877
49 Ga0068856_100077139 3300005614 Bacteria 3302
50 Ga0068852_100000093 3300005616 Bacteria 60834
51 Ga0068852_100108127 3300005616 Bacteria 2524
52 Ga0068864_100000043 3300005618 Bacteria 162928
53 Ga0068866_10000382 3300005718 Bacteria 20838
54 Ga0068866_10012759 3300005718 Bacteria 3667
55 Ga0068866_10066218 3300005718 Bacteria 1892
56 Ga0068851_10000297 3300005834 Bacteria 22748
57 Ga0068851_10015205 3300005834 Bacteria 3664
58 Ga0068863_100852496 3300005841 Bacteria 910
59 Ga0068863_101637795 3300005841 Bacteria 653
60 Ga0068858_100000017 3300005842 Bacteria 186913
61 Ga0081455_10023910 3300005937 Bacteria 5675
62 Ga0081455_10095488 3300005937 Bacteria 2399
63 Ga0081455_10466250 3300005937 Unclassified 859
64 Ga0075365_10002852 3300006038 Bacteria 8679
65 Ga0075365_10002884 3300006038 Bacteria 8657
66 Ga0075365_10041723 3300006038 Bacteria 2998
67 Ga0075365_10554652 3300006038 Bacteria 813
68 Ga0075365_10633515 3300006038 Bacteria 756
69 Ga0075365_10699335 3300006038 Bacteria 716
70 Ga0075365_10880592 3300006038 Unclassified 631
71 Ga0075368_10046025 3300006042 Bacteria 1725
72 Ga0075368_10393650 3300006042 Bacteria 608
73 Ga0075368_10475318 3300006042 Bacteria 556
74 Ga0075368_10561931 3300006042 Bacteria 514
75 Ga0075363_100061011 3300006048 Bacteria 2031
76 Ga0075363_100480888 3300006048 Bacteria 736
77 Ga0075363_100504249 3300006048 Bacteria 719
78 Ga0075364_10021442 3300006051 Bacteria 4072
79 Ga0075364_10027559 3300006051 Bacteria 3630
80 Ga0075364_10056496 3300006051 Bacteria 2570
81 Ga0075364_10386013 3300006051 Bacteria 955
82 Ga0070712_101955211 3300006175 Bacteria 514
83 Ga0097621_100184659 3300006237 Bacteria 1803
84 Ga0097621_101987150 3300006237 Unclassified 555
85 Ga0068871_100307811 3300006358 Unclassified 1392
86 Ga0075428_100197443 3300006844 Bacteria 2176
87 Ga0075428_102320552 3300006844 Bacteria 552
88 Ga0075430_100177755 3300006846 Bacteria 1770
89 Ga0075431_100023812 3300006847 Bacteria 6267
90 Ga0075433_11611497 3300006852 Unclassified 560
91 Ga0075434_100222854 3300006871 Bacteria 1906
92 Ga0075429_101142895 3300006880 Bacteria 680
93 Ga0068865_100216839 3300006881 Unclassified 1494
94 Ga0075436_100745088 3300006914 Bacteria 727
95 Ga0111539_10128832 3300009094 Unclassified 2964
96 Ga0111539_12146258 3300009094 Bacteria 648
97 Ga0111539_13321703 3300009094 Bacteria 518
98 Ga0105245_10001831 3300009098 Bacteria 19354
99 Ga0105245_10005744 3300009098 Bacteria 10888
100 Ga0105245_10308240 3300009098 Bacteria 1556
101 Ga0105245_11933173 3300009098 Bacteria 643
102 Ga0105247_10137206 3300009101 Bacteria 1599
103 Ga0105247_10881580 3300009101 Unclassified 689
104 Ga0114129_10068723 3300009147 Unclassified 4939
105 Ga0114129_10621598 3300009147 Archaea 1397
106 Ga0114129_10709951 3300009147 Bacteria 1291
107 Ga0114129_11374182 3300009147 Bacteria 872
108 Ga0105243_10053059 3300009148 Bacteria 3215
109 Ga0105243_10508999 3300009148 Bacteria 1142
110 Ga0105243_10811439 3300009148 Unclassified 923
111 Ga0105243_11794225 3300009148 Bacteria 644
112 Ga0105241_10083959 3300009174 Bacteria 2500
113 Ga0105241_10120186 3300009174 Unclassified 2114
114 Ga0105242_10000034 3300009176 Bacteria 95536
115 Ga0105242_10022832 3300009176 Bacteria 4926
116 Ga0105242_11920673 3300009176 Bacteria 633
117 Ga0105248_10000008 3300009177 Bacteria 403910
118 Ga0105248_10446267 3300009177 Bacteria 1458
119 Ga0105249_10186539 3300009553 Unclassified 2021
120 Ga0105239_10043707 3300010375 Bacteria 4912
121 Ga0105239_11568049 3300010375 Unclassified 761
122 Ga0105239_12119327 3300010375 Unclassified 653
123 Ga0105246_10690672 3300011119 Bacteria 893
124 Ga0157329_1012388 3300012491 Bacteria 697
125 Ga0157371_11602338 3300013102 Unclassified 510
126 Ga0157370_10132387 3300013104 Bacteria 2325
127 Ga0157369_10000110 3300013105 Bacteria 115514
128 Ga0157378_10001375 3300013297 Bacteria 21833
129 Ga0157378_10031676 3300013297 Bacteria 4671
130 Ga0157378_11642021 3300013297 Unclassified 689
131 Ga0157378_13209417 3300013297 Bacteria 508
132 Ga0157375_10000765 3300013308 Bacteria 28141
133 Ga0157375_10000885 3300013308 Bacteria 25959
134 Ga0157375_11936289 3300013308 Unclassified 700
135 Ga0163163_10264988 3300014325 Bacteria 1769
136 Ga0163163_10379427 3300014325 Bacteria 1471
137 Ga0157377_10713493 3300014745 Bacteria 729
138 Ga0157376_12403247 3300014969 Unclassified 566
139 Ga0206353_11289487 3300020082 Unclassified 1534
140 Ga0207656_10000084 3300025321 Bacteria 35284
141 Ga0207656_10463700 3300025321 Unclassified 641
142 Ga0207642_10005123 3300025899 Bacteria 4265
143 Ga0207642_10067087 3300025899 Bacteria 1692
144 Ga0207710_10000477 3300025900 Bacteria 25496
145 Ga0207710_10662480 3300025900 Unclassified 547
146 Ga0207680_10025490 3300025903 Bacteria 3262
147 Ga0207705_10153233 3300025909 Bacteria 1728
148 Ga0207654_10040090 3300025911 Bacteria 2637
149 Ga0207649_10000003 3300025920 Bacteria 388908
150 Ga0207649_10952511 3300025920 Bacteria 674
151 Ga0207650_10049183 3300025925 Bacteria 3112
152 Ga0207659_10000018 3300025926 Bacteria 156920
153 Ga0207687_10000007 3300025927 Bacteria 604185
154 Ga0207687_10003583 3300025927 Bacteria 10452
155 Ga0207687_10259620 3300025927 Unclassified 1384
156 Ga0207687_10831440 3300025927 Bacteria 788
157 Ga0207664_10302769 3300025929 Bacteria 1407
158 Ga0207686_10000223 3300025934 Bacteria 43288
159 Ga0207686_10000667 3300025934 Bacteria 21210
160 Ga0207686_10045574 3300025934 Bacteria 2699
161 Ga0207686_10072382 3300025934 Bacteria 2221
162 Ga0207709_10024483 3300025935 Bacteria 3447
163 Ga0207709_10331555 3300025935 Unclassified 1142
164 Ga0207709_11268017 3300025935 Bacteria 608
165 Ga0207669_10000262 3300025937 Bacteria 23932
166 Ga0207704_10224281 3300025938 Unclassified 1393
167 Ga0207711_10000006 3300025941 Bacteria 792692
168 Ga0207711_10315375 3300025941 Bacteria 1444
169 Ga0207661_10000247 3300025944 Bacteria 35222
170 Ga0207661_10588974 3300025944 Bacteria 1020
171 Ga0207679_10398005 3300025945 Bacteria 1211
172 Ga0207679_10800857 3300025945 Bacteria 859
173 Ga0207667_10405470 3300025949 Bacteria 1388
174 Ga0207651_10018543 3300025960 Bacteria 4145
175 Ga0207712_10276940 3300025961 Unclassified 1368
176 Ga0207712_11063448 3300025961 Bacteria 719
177 Ga0207668_10239059 3300025972 Bacteria 1468
178 Ga0207668_10400289 3300025972 Unclassified 1161
179 Ga0207668_11202642 3300025972 Bacteria 681
180 Ga0207668_11610781 3300025972 Bacteria 586
181 Ga0207640_10000074 3300025981 Bacteria 78164
182 Ga0207640_10349471 3300025981 Bacteria 1188
183 Ga0207658_10205483 3300025986 Bacteria 1647
184 Ga0207677_10003263 3300026023 Bacteria 8568
185 Ga0207677_11420702 3300026023 Unclassified 639
186 Ga0207703_10000030 3300026035 Bacteria 199014
187 Ga0207703_11254942 3300026035 Bacteria 712
188 Ga0207639_10289387 3300026041 Bacteria 1444
189 Ga0207708_10046221 3300026075 Bacteria 3316
190 Ga0207708_10435811 3300026075 Unclassified 1089
191 Ga0207702_10000085 3300026078 Bacteria 106728
192 Ga0207702_10012965 3300026078 Bacteria 6934
193 Ga0207641_10002678 3300026088 Bacteria 16262
194 Ga0207641_11260548 3300026088 Bacteria 739
195 Ga0207676_10000042 3300026095 Bacteria 163475
196 Ga0207683_10005878 3300026121 Bacteria 10524
197 Ga0207683_10387885 3300026121 Bacteria 1284
198 Ga0207698_10000440 3300026142 Bacteria 23916
199 Ga0207698_10068547 3300026142 Bacteria 2802
200 Ga0209813_10025044 3300027866 Bacteria 1712
201 Ga0209813_10319235 3300027866 Bacteria 608
202 Ga0268266_10000731 3300028379 Bacteria 44067
203 Ga0268266_10760683 3300028379 Bacteria 935
204 Ga0268266_10831419 3300028379 Bacteria 892
205 Ga0265337_1000254 3300028556 Bacteria 28842
206 Ga0265326_10000079 3300028558 Bacteria 51707
207 Ga0265322_10000004 3300028654 Bacteria 275155
208 Ga0265336_10033026 3300028666 Bacteria 1603
209 Ga0265338_10560397 3300028800 Bacteria 799
210 Ga0265324_10000747 3300029957 Bacteria 21609
211 Ga0307511_10285932 3300030521 Unclassified 758
212 Ga0265328_10014255 3300031239 Bacteria 3132
213 Ga0265320_10000029 3300031240 Bacteria 159627
214 Ga0265329_10006945 3300031242 Bacteria 4426
215 Ga0265331_10006096 3300031250 Bacteria 7174
216 Ga0265327_10000723 3300031251 Bacteria 51798
217 Ga0265316_10048559 3300031344 Bacteria 3349
218 Ga0265314_10000484 3300031711 Bacteria 52007
219 Ga0307413_10929717 3300031824 Bacteria 741
220 Ga0307410_10016537 3300031852 Bacteria 4403
221 Ga0307406_11380317 3300031901 Bacteria 617
222 Ga0307416_100115763 3300032002 Bacteria 2375
223 Ga0307415_100013593 3300032126 Bacteria 4756
224 Ga0373953_0170781 3300035117 Bacteria 936
225 Ga0316574_0279564 3300035398 Bacteria 1063
226 Ga0316574_0651467 3300035398 Bacteria 648
227 Ga0373933_0731023 3300035724 Bacteria 651
228 Ga0395900_0127654 3300037418 Bacteria 2607
229 Ga0395900_0859586 3300037418 Bacteria 832
230 Ga0395898_0002556 3300037466 Bacteria 21342
231 Ga0395898_0010927 3300037466 Bacteria 9470
232 Ga0395905_0097284 3300037471 Bacteria 2763
233 Ga0395905_1716403 3300037471 Bacteria 533
234 Ga0395901_0037726 3300038443 Bacteria 4997
235 Ga0395901_0099723 3300038443 Bacteria 3046
236 Ga0451807_0527994 3300041486 Bacteria 1031
237 Ga0451807_1623212 3300041486 Bacteria 876
238 Ga0451833_1008300 3300041491 Bacteria 1070
239 Ga0451847_0162868 3300041503 Bacteria 546
240 Ga0451849_1510230 3300041505 Bacteria 1008
241 Ga0451853_0045614 3300041512 Bacteria 625
242 Ga0451853_1286025 3300041512 Bacteria 993
243 Ga0451853_2168460 3300041512 Bacteria 540
244 Ga0451853_2295057 3300041512 Bacteria 591
245 Ga0451853_2500954 3300041512 Bacteria 519
246 Ga0466963_0130356 3300044694 Bacteria 1736
247 Ga0466958_0078583 3300045836 Bacteria 2028
248 Ga0466967_0011675 3300045976 Bacteria 6674
249 Ga0466967_0759431 3300045976 Unclassified 962
250 Ga0466967_0973862 3300045976 Bacteria 844
251 Ga0495592_0217873 3300046454 Bacteria 1278
252 Ga0495592_0496993 3300046454 Bacteria 757
253 Ga0495603_0066301 3300046455 Bacteria 2126
254 Ga0495591_081679 3300046458 Bacteria 823
255 Ga0495629_0000025 3300046459 Bacteria 135624
256 Ga0495629_0001779 3300046459 Bacteria 16906
257 Ga0495629_0452652 3300046459 Unclassified 869
258 Ga0495641_0008978 3300046461 Bacteria 6007
259 Ga0495641_0009617 3300046461 Bacteria 5723
260 Ga0495641_0025870 3300046461 Bacteria 2874
261 Ga0495641_0060516 3300046461 Bacteria 1711
262 Ga0495641_0506610 3300046461 Bacteria 550
263 Ga0495651_0311204 3300046462 Bacteria 1053
264 Ga0495653_0031504 3300046463 Bacteria 4214
265 Ga0495653_0426870 3300046463 Bacteria 838
266 Ga0495653_0680187 3300046463 Unclassified 626
267 Ga0495582_0041284 3300046473 Unclassified 2542
268 Ga0495662_0393984 3300046476 Unclassified 680
269 Ga0495594_0040804 3300046499 Unclassified 2541
270 Ga0495596_0176884 3300046500 Bacteria 830
271 Ga0495606_0000017 3300046507 Bacteria 284549
272 Ga0495610_0034248 3300046512 Bacteria 2617
273 Ga0495618_0534272 3300046514 Bacteria 704
274 Ga0495628_0000437 3300046516 Bacteria 37922
275 Ga0495628_0639452 3300046516 Bacteria 756
276 Ga0495628_0674901 3300046516 Bacteria 732
277 Ga0495630_0000034 3300046517 Bacteria 126055
278 Ga0495630_0004372 3300046517 Bacteria 9923
279 Ga0495630_0407793 3300046517 Bacteria 1041
280 Ga0495663_0297783 3300046525 Unclassified 580
281 Ga0495652_0008710 3300046529 Bacteria 9244
282 Ga0495652_0519155 3300046529 Bacteria 823
283 Ga0495587_0422833 3300046536 Bacteria 739
284 Ga0495645_0132645 3300046543 Bacteria 1744
285 Ga0495667_0000322 3300046559 Bacteria 30286
286 Ga0495667_0050252 3300046559 Bacteria 2753
287 Ga0495656_0000600 3300046615 Bacteria 11626
288 Ga0495656_0178281 3300046615 Bacteria 1043
289 Ga0495634_0000558 3300046642 Bacteria 36397
290 Ga0495634_0001012 3300046642 Bacteria 26406
291 Ga0495634_0004991 3300046642 Bacteria 10248
292 Ga0495634_0143751 3300046642 Bacteria 1513
293 Ga0495635_0057992 3300046663 Bacteria 2664
294 Ga0495635_0224945 3300046663 Bacteria 1268
295 Ga0495588_0000073 3300046674 Bacteria 219005
296 Ga0495588_0129313 3300046674 Bacteria 1332
297 Ga0495588_0753878 3300046674 Unclassified 509
298 Ga0495657_0346067 3300046675 Bacteria 880
299 Ga0495647_0000079 3300046681 Bacteria 23665
300 Ga0495647_0136511 3300046681 Bacteria 1043
301 Ga0495647_0294495 3300046681 Unclassified 730
302 Ga0495658_0002349 3300046683 Bacteria 9558
303 Ga0495658_0663214 3300046683 Unclassified 668
304 Ga0495658_0814722 3300046683 Archaea 598
305 Ga0495613_0000094 3300046689 Bacteria 86601
306 Ga0495613_0046202 3300046689 Bacteria 3220
307 Ga0495613_0229859 3300046689 Bacteria 1300
308 Ga0495624_0000220 3300046690 Bacteria 44376
309 Ga0495624_0157051 3300046690 Bacteria 1390
310 Ga0495589_0270028 3300046794 Unclassified 792
311 Ga0495600_0005499 3300046809 Bacteria 7645
312 Ga0495660_0403310 3300046810 Bacteria 598
313 Ga0495581_0112129 3300047315 Bacteria 1586
314 Ga0495604_0000293 3300047317 Bacteria 44767
315 Ga0495604_0058301 3300047317 Bacteria 2965
316 Ga0495672_0050776 3300047320 Bacteria 2446
317 Ga0495672_0053831 3300047320 Bacteria 2356
318 Ga0495676_0002271 3300047321 Bacteria 17047
319 Ga0495676_0076637 3300047321 Unclassified 2552
320 Ga0495676_0365283 3300047321 Bacteria 963
321 Ga0495676_0581806 3300047321 Bacteria 730
322 Ga0495680_0006019 3300047322 Bacteria 11345
323 Ga0495684_0234533 3300047471 Bacteria 1341
324 Ga0495593_0024905 3300047673 Bacteria 3312
325 Ga0495593_0391246 3300047673 Bacteria 695
326 Ga0495593_0613124 3300047673 Archaea 546
327 Ga0495602_0000041 3300048088 Bacteria 126954
328 Ga0495602_0036860 3300048088 Bacteria 4545
329 Ga0495602_0113032 3300048088 Bacteria 2202
330 Ga0495614_0454937 3300048089 Unclassified 606
331 Ga0496100_0000001 3300048903 Bacteria 530179
332 Ga0496100_0881009 3300048903 Unclassified 703
333 Ga0496100_1515562 3300048903 Unclassified 530
334 Ga0496101_0000028 3300048904 Bacteria 198664
335 Ga0496102_0000075 3300048905 Bacteria 147013
336 Ga0496102_0223829 3300048905 Bacteria 1774
337 Ga0496102_1437865 3300048905 Bacteria 608
338 Ga0496103_0000329 3300048906 Bacteria 43481
339 Ga0496104_0027822 3300048907 Bacteria 5233
340 Ga0496104_0113363 3300048907 Bacteria 2600
341 Ga0496105_0000005 3300048908 Bacteria 475797
342 Ga0496105_0146523 3300048908 Unclassified 1941
343 Ga0496106_0000055 3300048909 Bacteria 91570
344 Ga0496107_0000002 3300048910 Bacteria 320871
345 Ga0496107_0521039 3300048910 Bacteria 881
346 Ga0496107_0886958 3300048910 Unclassified 650
347 Ga0496108_0000005 3300048911 Bacteria 535059
348 Ga0496108_0000413 3300048911 Bacteria 34974
349 Ga0496108_1527332 3300048911 Unclassified 555
350 Ga0496109_0000002 3300048912 Bacteria 443393
351 Ga0496109_0000333 3300048912 Bacteria 44006
352 Ga0496109_0013316 3300048912 Bacteria 7127
353 Ga0496109_0083317 3300048912 Bacteria 2949
354 Ga0496109_0136198 3300048912 Bacteria 2295
355 Ga0496109_0705920 3300048912 Bacteria 946
356 Ga0496110_0000235 3300048913 Bacteria 35772
357 Ga0496110_0053987 3300048913 Bacteria 3534
358 Ga0496111_0000011 3300048914 Bacteria 88409
359 Ga0496111_0023479 3300048914 Bacteria 4330
360 Ga0496112_0005405 3300048915 Bacteria 11044
361 Ga0496113_0000001 3300048916 Bacteria 224977
362 Ga0496113_0033539 3300048916 Bacteria 3739
363 Ga0496113_0569111 3300048916 Unclassified 908
364 Ga0496114_0000003 3300048917 Bacteria 630981
365 Ga0496114_0326997 3300048917 Bacteria 1355
366 Ga0496115_0000016 3300048918 Bacteria 187067
367 Ga0496115_0000031 3300048918 Bacteria 138258
368 Ga0496115_0034932 3300048918 Bacteria 3975
369 Ga0496119_0014028 3300048922 Bacteria 6312
370 Ga0496120_0054476 3300048923 Bacteria 2266
371 Ga0496124_0157424 3300048927 Bacteria 1775
372 Ga0501031_0683051 3300049568 Bacteria 659
373 Ga0501036_0490197 3300049572 Bacteria 1023
374 Ga0501039_0380961 3300049575 Bacteria 1108
375 Ga0501040_0620285 3300049576 Bacteria 781
376 Ga0501040_0926288 3300049576 Unclassified 631
377 Ga0501041_0168049 3300049577 Bacteria 1372
378 Ga0501042_0197948 3300049578 Bacteria 1449
379 Ga0501046_0633732 3300049580 Unclassified 757
380 Ga0501048_1313082 3300049582 Bacteria 520
381 Ga0501068_0607621 3300049584 Bacteria 713
382 Ga0501069_0297806 3300049585 Bacteria 946
383 Ga0501069_0548926 3300049585 Unclassified 691
384 Ga0501070_1057072 3300049586 Bacteria 628
385 Ga0501070_1148735 3300049586 Bacteria 597
386 Ga0501071_0252638 3300049587 Unclassified 1331
387 Ga0501072_0039329 3300049588 Bacteria 3714
388 Ga0501072_0398354 3300049588 Bacteria 1092
389 Ga0501072_0869464 3300049588 Bacteria 705
390 Ga0501072_0871934 3300049588 Unclassified 704
391 Ga0501072_1040728 3300049588 Bacteria 638
392 Ga0501072_1070111 3300049588 Bacteria 628
393 Ga0501073_0110821 3300049589 Bacteria 1904
394 Ga0501073_0873753 3300049589 Bacteria 619
395 Ga0501074_0111311 3300049590 Bacteria 1959
396 Ga0501074_0331673 3300049590 Bacteria 1080
397 Ga0501074_0641548 3300049590 Unclassified 750
398 Ga0501074_0845555 3300049590 Unclassified 645
399 Ga0501075_0063897 3300049591 Unclassified 2776
400 Ga0501076_0642289 3300049592 Unclassified 876
401 Ga0501077_0087878 3300049593 Bacteria 1970
402 Ga0501079_0157648 3300049741 Unclassified 1769
403 Ga0501080_0006672 3300049742 Bacteria 10387
404 Ga0501081_0801392 3300049743 Unclassified 709
405 Ga0501083_0189346 3300049744 Bacteria 1343
406 Ga0501045_0180930 3300049824 Bacteria 1571
407 nmdc:mga03n38_55379_c1 3300050490 Bacteria 1786
408 nmdc:mga03n38_645464_c1 3300050490 Unclassified 606
409 nmdc:mga03n38_668197_c1 3300050490 Bacteria 597
410 nmdc:mga00v17_28412_c1 3300050491 Bacteria 3275
411 nmdc:mga00v17_59606_c1 3300050491 Bacteria 2342
412 nmdc:mga00v17_85861_c1 3300050491 Bacteria 1971
413 nmdc:mga0yw44_1019593_c1 3300050492 Bacteria 560
414 nmdc:mga0yw44_203781_c1 3300050492 Unclassified 1307
415 nmdc:mga0yw44_409995_c1 3300050492 Bacteria 917
416 nmdc:mga0yw44_505647_c1 3300050492 Bacteria 820
417 nmdc:mga0yw44_592255_c1 3300050492 Unclassified 753
418 nmdc:mga0yw44_685336_c1 3300050492 Unclassified 696
419 nmdc:mga0yw44_77397_c1 3300050492 Bacteria 2078
420 nmdc:mga0yw44_994593_c1 3300050492 Unclassified 568
421 nmdc:mga06z11_604071_c1 3300050494 Bacteria 667
422 nmdc:mga04h51_29806_c1 3300050495 Bacteria 1712
423 nmdc:mga04h51_353199_c1 3300050495 Bacteria 608
424 nmdc:mga05p37_1109693_c1 3300050507 Bacteria 827
425 nmdc:mga05p37_188856_c1 3300050507 Unclassified 2503
426 nmdc:mga05p37_2107324_c1 3300050507 Archaea 528
427 nmdc:mga05p37_828422_c1 3300050507 Archaea 1008
428 nmdc:mga0qj67_98605_c1 3300050509 Bacteria 2354
429 nmdc:mga06r32_154771_c1 3300050510 Bacteria 2273
430 nmdc:mga0a205_1135153_c1 3300050515 Unclassified 629
431 nmdc:mga0a205_872061_c1 3300050515 Unclassified 747
432 Ga0495601_0000017 3300053077 Bacteria 204209
433 Ga0495601_0028160 3300053077 Bacteria 3478
434 Ga0495601_0137921 3300053077 Bacteria 1590
435 Ga0495601_0393098 3300053077 Bacteria 899
436 Ga0495612_0009368 3300053078 Bacteria 3976
437 Ga0495612_0167665 3300053078 Bacteria 961
438 Ga0495655_0000005 3300053083 Bacteria 257472
439 Ga0495655_0000401 3300053083 Bacteria 7348
440 Ga0495595_0013646 3300053084 Bacteria 3434
441 Ga0495619_0000001 3300053085 Bacteria 586054
442 Ga0495619_0000413 3300053085 Bacteria 29033
443 Ga0495619_0004779 3300053085 Bacteria 8615
444 Ga0495619_0314175 3300053085 Bacteria 1085
445 Ga0495619_0483397 3300053085 Bacteria 852
446 Ga0495619_0774706 3300053085 Unclassified 650
447 Ga0495619_0913863 3300053085 Unclassified 590
448 Ga0500566_0008889 3300053094 Bacteria 5940
449 Ga0500628_000025 3300053129 Bacteria 62808
450 Ga0501084_0327394 3300054114 Bacteria 1294
451 Ga0501084_1165952 3300054114 Unclassified 646
452 Ga0501084_1189365 3300054114 Bacteria 640
453 Ga0501082_1655336 3300060353 Bacteria 559
454 Ga0530510_0367163 3300061734 Bacteria 1082
455 Ga0530510_0871567 3300061734 Bacteria 688
456 Ga0075365_10420287
457 JGI24740J21852_10012572
458 JGI24748J21848_1000307
459 JGI24034J26672_10000119
460 JGI24742J22300_10001957
461 Ga0070676_11195002
462 Ga0070683_101858864
463 Ga0070670_100058698
464 Ga0070666_10494959
465 Ga0070682_100000556
466 Ga0068868_101306536
467 Ga0070691_10000074
468 Ga0070691_10025951
469 Ga0070691_10222437
470 Ga0070691_10494607
471 Ga0070661_100000004
472 Ga0070661_100939961
473 Ga0070661_101451168
474 Ga0070692_10227161
475 Ga0070668_100544294
476 Ga0070668_101376163
477 Ga0070675_100000078
478 Ga0070674_100000030
479 Ga0070673_100031795
480 Ga0070688_100001862
481 Ga0070688_100002739
482 Ga0070667_100133714
483 Ga0070701_10940642
484 Ga0070701_10991896
485 Ga0070700_100289426
486 Ga0070700_100586339
487 Ga0070678_100004618
488 Ga0070685_10000189
489 Ga0070685_10002457
490 Ga0070684_100020411
491 Ga0070684_101165193
492 Ga0068853_101189713
493 Ga0070686_100136141
494 Ga0070686_100336405
495 Ga0070686_101452221
496 Ga0070695_100145570
497 Ga0070696_101228596
498 Ga0070665_100000682
499 Ga0070704_102133956
500 Ga0068855_100465422
501 Ga0070664_100521275
502 Ga0068854_100000062
503 Ga0068856_100000377
504 Ga0068856_100077139
505 Ga0068852_100000093
506 Ga0068852_100108127
507 Ga0068864_100000043
508 Ga0068866_10000382
509 Ga0068866_10012759
510 Ga0068866_10066218
511 Ga0068851_10000297
512 Ga0068851_10015205
513 Ga0068863_100852496
514 Ga0068863_101637795
515 Ga0068858_100000017
516 Ga0081455_10023910
517 Ga0081455_10095488
518 Ga0081455_10466250
519 Ga0075365_10002852
520 Ga0075365_10002884
521 Ga0075365_10041723
522 Ga0075365_10554652
523 Ga0075365_10633515
524 Ga0075365_10699335
525 Ga0075365_10880592
526 Ga0075368_10046025
527 Ga0075368_10393650
528 Ga0075368_10475318
529 Ga0075368_10561931
530 Ga0075363_100061011
531 Ga0075363_100480888
532 Ga0075363_100504249
533 Ga0075364_10021442
534 Ga0075364_10027559
535 Ga0075364_10056496
536 Ga0075364_10386013
537 Ga0070712_101955211
538 Ga0097621_100184659
539 Ga0097621_101987150
540 Ga0068871_100307811
541 Ga0075428_100197443
542 Ga0075428_102320552
543 Ga0075430_100177755
544 Ga0075431_100023812
545 Ga0075433_11611497
546 Ga0075434_100222854
547 Ga0075429_101142895
548 Ga0068865_100216839
549 Ga0075436_100745088
550 Ga0111539_10128832
551 Ga0111539_12146258
552 Ga0111539_13321703
553 Ga0105245_10001831
554 Ga0105245_10005744
555 Ga0105245_10308240
556 Ga0105245_11933173
557 Ga0105247_10137206
558 Ga0105247_10881580
559 Ga0114129_10068723
560 Ga0114129_10621598
561 Ga0114129_10709951
562 Ga0114129_11374182
563 Ga0105243_10053059
564 Ga0105243_10508999
565 Ga0105243_10811439
566 Ga0105243_11794225
567 Ga0105241_10083959
568 Ga0105241_10120186
569 Ga0105242_10000034
570 Ga0105242_10022832
571 Ga0105242_11920673
572 Ga0105248_10000008
573 Ga0105248_10446267
574 Ga0105249_10186539
575 Ga0105239_10043707
576 Ga0105239_11568049
577 Ga0105239_12119327
578 Ga0105246_10690672
579 Ga0157329_1012388
580 Ga0157371_11602338
581 Ga0157370_10132387
582 Ga0157369_10000110
583 Ga0157378_10001375
584 Ga0157378_10031676
585 Ga0157378_11642021
586 Ga0157378_13209417
587 Ga0157375_10000765
588 Ga0157375_10000885
589 Ga0157375_11936289
590 Ga0163163_10264988
591 Ga0163163_10379427
592 Ga0157377_10713493
593 Ga0157376_12403247
594 Ga0206353_11289487
595 Ga0207656_10000084
596 Ga0207656_10463700
597 Ga0207642_10005123
598 Ga0207642_10067087
599 Ga0207710_10000477
600 Ga0207710_10662480
601 Ga0207680_10025490
602 Ga0207705_10153233
603 Ga0207654_10040090
604 Ga0207649_10000003
605 Ga0207649_10952511
606 Ga0207650_10049183
607 Ga0207659_10000018
608 Ga0207687_10000007
609 Ga0207687_10003583
610 Ga0207687_10259620
611 Ga0207687_10831440
612 Ga0207664_10302769
613 Ga0207686_10000223
614 Ga0207686_10000667
615 Ga0207686_10045574
616 Ga0207686_10072382
617 Ga0207709_10024483
618 Ga0207709_10331555
619 Ga0207709_11268017
620 Ga0207669_10000262
621 Ga0207704_10224281
622 Ga0207711_10000006
623 Ga0207711_10315375
624 Ga0207661_10000247
625 Ga0207661_10588974
626 Ga0207679_10398005
627 Ga0207679_10800857
628 Ga0207667_10405470
629 Ga0207651_10018543
630 Ga0207712_10276940
631 Ga0207712_11063448
632 Ga0207668_10239059
633 Ga0207668_10400289
634 Ga0207668_11202642
635 Ga0207668_11610781
636 Ga0207640_10000074
637 Ga0207640_10349471
638 Ga0207658_10205483
639 Ga0207677_10003263
640 Ga0207677_11420702
641 Ga0207703_10000030
642 Ga0207703_11254942
643 Ga0207639_10289387
644 Ga0207708_10046221
645 Ga0207708_10435811
646 Ga0207702_10000085
647 Ga0207702_10012965
648 Ga0207641_10002678
649 Ga0207641_11260548
650 Ga0207676_10000042
651 Ga0207683_10005878
652 Ga0207683_10387885
653 Ga0207698_10000440
654 Ga0207698_10068547
655 Ga0209813_10025044
656 Ga0209813_10319235
657 Ga0268266_10000731
658 Ga0268266_10760683
659 Ga0268266_10831419
660 Ga0265337_1000254
661 Ga0265326_10000079
662 Ga0265322_10000004
663 Ga0265336_10033026
664 Ga0265338_10560397
665 Ga0265324_10000747
666 Ga0307511_10285932
667 Ga0265328_10014255
668 Ga0265320_10000029
669 Ga0265329_10006945
670 Ga0265331_10006096
671 Ga0265327_10000723
672 Ga0265316_10048559
673 Ga0265314_10000484
674 Ga0307413_10929717
675 Ga0307410_10016537
676 Ga0307406_11380317
677 Ga0307416_100115763
678 Ga0307415_100013593
679 Ga0373953_0170781
680 Ga0316574_0279564
681 Ga0316574_0651467
682 Ga0373933_0731023
683 Ga0395900_0127654
684 Ga0395900_0859586
685 Ga0395898_0002556
686 Ga0395898_0010927
687 Ga0395905_0097284
688 Ga0395905_1716403
689 Ga0395901_0037726
690 Ga0395901_0099723
691 Ga0451807_0527994
692 Ga0451807_1623212
693 Ga0451833_1008300
694 Ga0451847_0162868
695 Ga0451849_1510230
696 Ga0451853_0045614
697 Ga0451853_1286025
698 Ga0451853_2168460
699 Ga0451853_2295057
700 Ga0451853_2500954
701 Ga0466963_0130356
702 Ga0466958_0078583
703 Ga0466967_0011675
704 Ga0466967_0759431
705 Ga0466967_0973862
706 Ga0495592_0217873
707 Ga0495592_0496993
708 Ga0495603_0066301
709 Ga0495591_081679
710 Ga0495629_0000025
711 Ga0495629_0001779
712 Ga0495629_0452652
713 Ga0495641_0008978
714 Ga0495641_0009617
715 Ga0495641_0025870
716 Ga0495641_0060516
717 Ga0495641_0506610
718 Ga0495651_0311204
719 Ga0495653_0031504
720 Ga0495653_0426870
721 Ga0495653_0680187
722 Ga0495582_0041284
723 Ga0495662_0393984
724 Ga0495594_0040804
725 Ga0495596_0176884
726 Ga0495606_0000017
727 Ga0495610_0034248
728 Ga0495618_0534272
729 Ga0495628_0000437
730 Ga0495628_0639452
731 Ga0495628_0674901
732 Ga0495630_0000034
733 Ga0495630_0004372
734 Ga0495630_0407793
735 Ga0495663_0297783
736 Ga0495652_0008710
737 Ga0495652_0519155
738 Ga0495587_0422833
739 Ga0495645_0132645
740 Ga0495667_0000322
741 Ga0495667_0050252
742 Ga0495656_0000600
743 Ga0495656_0178281
744 Ga0495634_0000558
745 Ga0495634_0001012
746 Ga0495634_0004991
747 Ga0495634_0143751
748 Ga0495635_0057992
749 Ga0495635_0224945
750 Ga0495588_0000073
751 Ga0495588_0129313
752 Ga0495588_0753878
753 Ga0495657_0346067
754 Ga0495647_0000079
755 Ga0495647_0136511
756 Ga0495647_0294495
757 Ga0495658_0002349
758 Ga0495658_0663214
759 Ga0495658_0814722
760 Ga0495613_0000094
761 Ga0495613_0046202
762 Ga0495613_0229859
763 Ga0495624_0000220
764 Ga0495624_0157051
765 Ga0495589_0270028
766 Ga0495600_0005499
767 Ga0495660_0403310
768 Ga0495581_0112129
769 Ga0495604_0000293
770 Ga0495604_0058301
771 Ga0495672_0050776
772 Ga0495672_0053831
773 Ga0495676_0002271
774 Ga0495676_0076637
775 Ga0495676_0365283
776 Ga0495676_0581806
777 Ga0495680_0006019
778 Ga0495684_0234533
779 Ga0495593_0024905
780 Ga0495593_0391246
781 Ga0495593_0613124
782 Ga0495602_0000041
783 Ga0495602_0036860
784 Ga0495602_0113032
785 Ga0495614_0454937
786 Ga0496100_0000001
787 Ga0496100_0881009
788 Ga0496100_1515562
789 Ga0496101_0000028
790 Ga0496102_0000075
791 Ga0496102_0223829
792 Ga0496102_1437865
793 Ga0496103_0000329
794 Ga0496104_0027822
795 Ga0496104_0113363
796 Ga0496105_0000005
797 Ga0496105_0146523
798 Ga0496106_0000055
799 Ga0496107_0000002
800 Ga0496107_0521039
801 Ga0496107_0886958
802 Ga0496108_0000005
803 Ga0496108_0000413
804 Ga0496108_1527332
805 Ga0496109_0000002
806 Ga0496109_0000333
807 Ga0496109_0013316
808 Ga0496109_0083317
809 Ga0496109_0136198
810 Ga0496109_0705920
811 Ga0496110_0000235
812 Ga0496110_0053987
813 Ga0496111_0000011
814 Ga0496111_0023479
815 Ga0496112_0005405
816 Ga0496113_0000001
817 Ga0496113_0033539
818 Ga0496113_0569111
819 Ga0496114_0000003
820 Ga0496114_0326997
821 Ga0496115_0000016
822 Ga0496115_0000031
823 Ga0496115_0034932
824 Ga0496119_0014028
825 Ga0496120_0054476
826 Ga0496124_0157424
827 Ga0501031_0683051
828 Ga0501036_0490197
829 Ga0501039_0380961
830 Ga0501040_0620285
831 Ga0501040_0926288
832 Ga0501041_0168049
833 Ga0501042_0197948
834 Ga0501046_0633732
835 Ga0501048_1313082
836 Ga0501068_0607621
837 Ga0501069_0297806
838 Ga0501069_0548926
839 Ga0501070_1057072
840 Ga0501070_1148735
841 Ga0501071_0252638
842 Ga0501072_0039329
843 Ga0501072_0398354
844 Ga0501072_0869464
845 Ga0501072_0871934
846 Ga0501072_1040728
847 Ga0501072_1070111
848 Ga0501073_0110821
849 Ga0501073_0873753
850 Ga0501074_0111311
851 Ga0501074_0331673
852 Ga0501074_0641548
853 Ga0501074_0845555
854 Ga0501075_0063897
855 Ga0501076_0642289
856 Ga0501077_0087878
857 Ga0501079_0157648
858 Ga0501080_0006672
859 Ga0501081_0801392
860 Ga0501083_0189346
861 Ga0501045_0180930
862 nmdc:mga03n38_55379_c1
863 nmdc:mga03n38_645464_c1
864 nmdc:mga03n38_668197_c1
865 nmdc:mga00v17_28412_c1
866 nmdc:mga00v17_59606_c1
867 nmdc:mga00v17_85861_c1
868 nmdc:mga0yw44_1019593_c1
869 nmdc:mga0yw44_203781_c1
870 nmdc:mga0yw44_409995_c1
871 nmdc:mga0yw44_505647_c1
872 nmdc:mga0yw44_592255_c1
873 nmdc:mga0yw44_685336_c1
874 nmdc:mga0yw44_77397_c1
875 nmdc:mga0yw44_994593_c1
876 nmdc:mga06z11_604071_c1
877 nmdc:mga04h51_29806_c1
878 nmdc:mga04h51_353199_c1
879 nmdc:mga05p37_1109693_c1
880 nmdc:mga05p37_188856_c1
881 nmdc:mga05p37_2107324_c1
882 nmdc:mga05p37_828422_c1
883 nmdc:mga0qj67_98605_c1
884 nmdc:mga06r32_154771_c1
885 nmdc:mga0a205_1135153_c1
886 nmdc:mga0a205_872061_c1
887 Ga0495601_0000017
888 Ga0495601_0028160
889 Ga0495601_0137921
890 Ga0495601_0393098
891 Ga0495612_0009368
892 Ga0495612_0167665
893 Ga0495655_0000005
894 Ga0495655_0000401
895 Ga0495595_0013646
896 Ga0495619_0000001
897 Ga0495619_0000413
898 Ga0495619_0004779
899 Ga0495619_0314175
900 Ga0495619_0483397
901 Ga0495619_0774706
902 Ga0495619_0913863
903 Ga0500566_0008889
904 Ga0500628_000025
905 Ga0501084_0327394
906 Ga0501084_1165952
907 Ga0501084_1189365
908 Ga0501082_1655336
909 Ga0530510_0367163
910 Ga0530510_0871567

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2xk0-assembly1.cif.gz_A solution structure of the tudor domain from drosophila polycomblike (pcl) 0.8697 8 65
6kco-assembly8.cif.gz_P shuguo pwwp in complex with ssdna 0.8686 8 65
6ie7-assembly1.cif.gz_A crystal structure of adcp1 tandem agenet domain 1-2 in complex with h3k9me2 0.8641 7 68
8h43-assembly3.cif.gz_C crystal structure of phf1 tudor domain in complex with hit 1 0.8637 9 68
6ie7-assembly3.cif.gz_C crystal structure of adcp1 tandem agenet domain 1-2 in complex with h3k9me2 0.8599 7 68
ID Description Score Start End Superfamily
af_Q9ZVT1_72_152_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8869 8 66 2.30.30.140
af_A0A0N7KQS4_223_284_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8824 10 66 2.30.30.140
2xk0A00 Mainly Beta;Roll;SH3 type barrels.; 0.8697 8 65 2.30.30.140
af_Q9VFP7_9_111_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8691 8 65 2.30.30.140
af_K7K6T0_75_151_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.864 7 66 2.30.30.140
ID Description Score Start End GO Terms
AF-A0A7J9YY44-F1-model_v4 NlpC/P60 domain-containing protein 0.9302 8 68
AF-A0A7K0S257-F1-model_v4 Uncharacterized protein 0.9283 9 68
AF-A0A1M3BBJ3-F1-model_v4 Uncharacterized protein 0.9261 3 67
AF-D3F1R1-F1-model_v4 Uncharacterized protein 0.9234 9 67
AF-A0A7J9YY44-F1-model_v4 NlpC/P60 domain-containing protein 0.8891 8 68

Map