F447571

General Info

Members Datasets Scaffolds Average Seq Length
455 319 910 371

Family's Representative Sequence

Representative Sequence 3300010159|Ga0099796_10017980|Ga0099796_100179802
Length 443
Sequence MQQMCQKLRQMRQKLGNRNVPEERPPSPIQFGEAVAATCISAIGDAGGRYGLPYPFVGPKMLKGKSMCTTSVNVVRIATKGPGDVSGMLSLIEQGKIDPKSIVAILGKTEGNGGVNDFTREYAVSALSAALAPYVGLPPHQVEQRIAFVMSGGTEGVLSPHITVFTRNGVANRCSEAVSGKRLSIGMAQTRDFLPEELGRSAQIRETARAVTAAMADAAIVDPQDVHFVQIKCPLLTSDRVEAAAARGNRTVTNSAYGSMAYSRGASALGVAVALREIEGEIDDKSVLSRFDFFSSVASTSAGIELMHNVVIVLGNSTSSAAPFEIGHAVMRDAIDSTAVIRALKSVGLHIEDGSGPATASRQLVNIFAKAEASPNGSIRGFRHIMLEDTDISSTRHARAAVGGLIAGLSGTGAIYVSGGAEHQGPPGGGPVAVIARLSNSSG

Samples

Sample ID Description Type Environment
1 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
15 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
16 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
17 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
18 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
19 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
20 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
21 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
22 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
23 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
24 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
25 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
26 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
27 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
30 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
31 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
32 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
33 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
38 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
42 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
46 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
47 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
48 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
49 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
50 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
51 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
52 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
53 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
54 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
55 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
56 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
57 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
59 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
64 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
88 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
89 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
90 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
91 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
97 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
100 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
101 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
102 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
113 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
114 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
115 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
116 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
117 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
118 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
119 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
120 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
121 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
122 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
123 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
124 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
125 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
126 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
127 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
128 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
129 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
130 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
133 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
134 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
135 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
139 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
140 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
141 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
144 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
145 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
146 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
147 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
148 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
152 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
153 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
154 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
155 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
156 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
157 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
161 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
162 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
165 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
166 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
167 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
170 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
171 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
176 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
177 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
178 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
179 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
180 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
181 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
184 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
185 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
186 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
187 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
199 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
200 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
201 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
202 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
203 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
204 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
207 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
208 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
219 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
220 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
221 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
222 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
223 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
224 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
225 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
226 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
227 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
228 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
229 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
230 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
231 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
232 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
233 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
234 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
235 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
236 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
239 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
240 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
241 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
242 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
243 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
244 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
245 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
246 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
247 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
248 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
249 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
250 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
251 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
252 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
253 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
254 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
255 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
256 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
257 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
258 2738541277 Variovorax sp. GV051 Isolate Unclassified
259 2738541307 Variovorax sp. GV008 Isolate Unclassified
260 2738543019 Variovorax sp. GV040 Isolate Unclassified
261 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
262 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
263 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
264 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
265 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
266 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
267 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
268 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
269 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
270 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
271 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
272 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
273 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
274 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
275 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
276 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
277 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
278 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
279 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
280 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
281 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
282 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
283 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
284 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
285 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
286 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
287 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
288 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
289 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
290 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
291 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
292 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
293 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
294 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
295 2922425934
296 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
297 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
298 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
299 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
300 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
301 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
302 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
303 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
304 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
305 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
306 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
307 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
308 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
309 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
310 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
311 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
312 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
313 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
314 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
315 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
316 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
317 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
318 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
319 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.58
Metatranscriptomes 0
Isolates 15.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.36
Nodule 9.45
Rhizoplane 5.49
Rhizosphere 50.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099796_10017980 3300010159 Bacteria 2115
2 JGI25153J46596_10002853 3300003215 Bacteria 9813
3 JGI25153J46596_10008802 3300003215 Bacteria 4776
4 JGI25153J46596_10016800 3300003215 Bacteria 2914
5 JGI25153J46596_10021256 3300003215 Bacteria 2424
6 JGI25160J50197_1002373 3300003354 Bacteria 8795
7 Ga0055531_10007800 3300003794 Bacteria 5765
8 Ga0055531_10010492 3300003794 Bacteria 4596
9 Ga0065165_1000704 3300005262 Bacteria 47537
10 Ga0065165_1010204 3300005262 Bacteria 4095
11 Ga0065165_1010683 3300005262 Bacteria 3931
12 Ga0070667_100111219 3300005367 Bacteria 2376
13 Ga0070709_10002668 3300005434 Bacteria 9636
14 Ga0070709_10005113 3300005434 Bacteria 7092
15 Ga0070709_10006033 3300005434 Bacteria 6589
16 Ga0070709_10074340 3300005434 Bacteria 2202
17 Ga0070714_100011992 3300005435 Bacteria 6897
18 Ga0070714_100063532 3300005435 Bacteria 3176
19 Ga0070713_100003901 3300005436 Bacteria 9889
20 Ga0070713_100004191 3300005436 Bacteria 9623
21 Ga0070713_100287594 3300005436 Bacteria 1510
22 Ga0070710_10001880 3300005437 Bacteria 9919
23 Ga0070710_10002372 3300005437 Bacteria 8918
24 Ga0070710_10008339 3300005437 Bacteria 5044
25 Ga0070711_100005028 3300005439 Bacteria 7863
26 Ga0070711_100007501 3300005439 Bacteria 6637
27 Ga0070711_100020339 3300005439 Bacteria 4276
28 Ga0070678_100017754 3300005456 Bacteria 4590
29 Ga0070662_100058474 3300005457 Bacteria 2805
30 Ga0070706_100005252 3300005467 Bacteria 12351
31 Ga0070706_100104631 3300005467 Bacteria 2633
32 Ga0070706_100216244 3300005467 Bacteria 1789
33 Ga0070707_100312552 3300005468 Bacteria 1527
34 Ga0070698_100015609 3300005471 Bacteria 8022
35 Ga0070698_100039959 3300005471 Bacteria 4823
36 Ga0070697_100000934 3300005536 Bacteria 21968
37 Ga0070665_100028600 3300005548 Bacteria 5613
38 Ga0070665_100041857 3300005548 Bacteria 4605
39 Ga0068859_100057614 3300005617 Bacteria 3914
40 Ga0068861_100146067 3300005719 Bacteria 1936
41 Ga0068860_100368321 3300005843 Bacteria 1416
42 Ga0068862_100162504 3300005844 Bacteria 1994
43 Ga0081540_1003913 3300005983 Bacteria 11600
44 Ga0070717_10003568 3300006028 Bacteria 11152
45 Ga0070717_10003698 3300006028 Bacteria 10991
46 Ga0070717_10172299 3300006028 Bacteria 1883
47 Ga0075364_10005186 3300006051 Bacteria 7558
48 Ga0075364_10102185 3300006051 Bacteria 1909
49 Ga0070715_10001833 3300006163 Bacteria 6347
50 Ga0070715_10084838 3300006163 Bacteria 1445
51 Ga0070716_100018059 3300006173 Bacteria 3669
52 Ga0070716_100099383 3300006173 Bacteria 1780
53 Ga0070712_100028225 3300006175 Bacteria 3752
54 Ga0070712_100033556 3300006175 Bacteria 3474
55 Ga0070712_100077948 3300006175 Bacteria 2390
56 Ga0070712_100136113 3300006175 Bacteria 1868
57 Ga0075362_10058931 3300006177 Bacteria 1733
58 Ga0075369_10006245 3300006186 Bacteria 4502
59 Ga0075369_10107340 3300006186 Bacteria 1256
60 Ga0075366_10013779 3300006195 Bacteria 4608
61 Ga0075366_10018558 3300006195 Bacteria 4018
62 Ga0075366_10049230 3300006195 Bacteria 2501
63 Ga0075370_10023182 3300006353 Bacteria 3416
64 Ga0075428_100020774 3300006844 Bacteria 7270
65 Ga0075428_100067572 3300006844 Bacteria 3912
66 Ga0075431_100004599 3300006847 Bacteria 13542
67 Ga0075433_10001276 3300006852 Bacteria 18416
68 Ga0075433_10201000 3300006852 Bacteria 1772
69 Ga0075434_100002724 3300006871 Bacteria 15605
70 Ga0075434_100004379 3300006871 Bacteria 12719
71 Ga0075434_100048666 3300006871 Bacteria 4207
72 Ga0075429_100003776 3300006880 Bacteria 12918
73 Ga0068865_100190883 3300006881 Bacteria 1584
74 Ga0097620_100057614 3300006931 Bacteria 3914
75 Ga0075435_100021502 3300007076 Bacteria 4963
76 Ga0099794_10001307 3300007265 Bacteria 8658
77 Ga0105250_10021450 3300009092 Bacteria 2607
78 Ga0114129_10010311 3300009147 Bacteria 13333
79 Ga0114129_10015415 3300009147 Bacteria 10874
80 Ga0105242_10301471 3300009176 Bacteria 1463
81 Ga0099796_10027350 3300010159 Bacteria 1821
82 Ga0163162_10100617 3300013306 Bacteria 2982
83 Ga0157375_10157452 3300013308 Bacteria 2411
84 Ga0163163_10211176 3300014325 Bacteria 1990
85 Ga0182007_10000258 3300015262 Bacteria 35539
86 Ga0163161_10000561 3300017792 Bacteria 29982
87 Ga0163161_10028754 3300017792 Bacteria 3949
88 Ga0163161_10182184 3300017792 Bacteria 1611
89 Ga0214544_1000578 3300021320 Bacteria 68951
90 Ga0214542_1000338 3300021321 Bacteria 80765
91 Ga0214545_1000186 3300021324 Bacteria 80765
92 Ga0214543_1000271 3300021327 Bacteria 80766
93 Ga0214543_1041406 3300021327 Bacteria 1191
94 Ga0213874_10009267 3300021377 Bacteria 2428
95 Ga0213876_10000531 3300021384 Bacteria 28855
96 Ga0213876_10028562 3300021384 Bacteria 2941
97 Ga0213876_10038957 3300021384 Bacteria 2510
98 Ga0207425_1019844 3300025245 Bacteria 1444
99 Ga0209148_1000445 3300025254 Bacteria 45388
100 Ga0209233_1004289 3300025261 Bacteria 4877
101 Ga0209233_1010726 3300025261 Bacteria 2728
102 Ga0209455_1002155 3300025272 Bacteria 7804
103 Ga0209564_1007915 3300025295 Bacteria 5363
104 Ga0209758_1000109 3300025297 Bacteria 214759
105 Ga0209758_1000176 3300025297 Bacteria 143504
106 Ga0209758_1001659 3300025297 Bacteria 25224
107 Ga0209758_1002229 3300025297 Bacteria 20140
108 Ga0209758_1003698 3300025297 Bacteria 13571
109 Ga0209758_1015309 3300025297 Bacteria 3985
110 Ga0209256_1011161 3300025299 Bacteria 3633
111 Ga0209256_1014122 3300025299 Bacteria 2904
112 Ga0207426_1000522 3300025302 Bacteria 55802
113 Ga0207426_1000635 3300025302 Bacteria 44397
114 Ga0209257_1000781 3300025304 Bacteria 46905
115 Ga0207692_10003821 3300025898 Bacteria 5920
116 Ga0207692_10004026 3300025898 Bacteria 5785
117 Ga0207680_10051253 3300025903 Bacteria 2467
118 Ga0207680_10123599 3300025903 Bacteria 1696
119 Ga0207699_10002225 3300025906 Bacteria 9151
120 Ga0207699_10054711 3300025906 Bacteria 2372
121 Ga0207699_10072876 3300025906 Bacteria 2105
122 Ga0207684_10006677 3300025910 Bacteria 10484
123 Ga0207684_10255261 3300025910 Bacteria 1513
124 Ga0207671_10134067 3300025914 Bacteria 1903
125 Ga0207693_10004244 3300025915 Bacteria 12153
126 Ga0207693_10016892 3300025915 Bacteria 5827
127 Ga0207693_10037955 3300025915 Bacteria 3795
128 Ga0207693_10199688 3300025915 Bacteria 1573
129 Ga0207663_10002039 3300025916 Bacteria 9607
130 Ga0207663_10013434 3300025916 Bacteria 4452
131 Ga0207663_10021314 3300025916 Bacteria 3687
132 Ga0207646_10003508 3300025922 Bacteria 17671
133 Ga0207700_10025721 3300025928 Bacteria 4093
134 Ga0207700_10048319 3300025928 Bacteria 3159
135 Ga0207700_10122964 3300025928 Bacteria 2107
136 Ga0207664_10005949 3300025929 Bacteria 8351
137 Ga0207664_10052336 3300025929 Bacteria 3229
138 Ga0207664_10067630 3300025929 Bacteria 2868
139 Ga0207706_10155715 3300025933 Bacteria 2010
140 Ga0207706_10191630 3300025933 Bacteria 1794
141 Ga0207704_10055969 3300025938 Bacteria 2413
142 Ga0207665_10007339 3300025939 Bacteria 7288
143 Ga0207689_10028674 3300025942 Bacteria 4655
144 Ga0207651_10048172 3300025960 Bacteria 2879
145 Ga0207658_10023459 3300025986 Bacteria 4307
146 Ga0207658_10096474 3300025986 Bacteria 2306
147 Ga0207639_10118774 3300026041 Bacteria 2169
148 Ga0207678_10016716 3300026067 Bacteria 6444
149 Ga0207708_10078649 3300026075 Bacteria 2533
150 Ga0207702_10208726 3300026078 Bacteria 1815
151 Ga0207675_100056901 3300026118 Bacteria 3648
152 Ga0207683_10008440 3300026121 Bacteria 8817
153 Ga0209389_1000045 3300027296 Bacteria 118598
154 Ga0209389_1000355 3300027296 Bacteria 27572
155 Ga0209589_1003826 3300027357 Bacteria 26213
156 Ga0209489_100110 3300027361 Bacteria 117680
157 Ga0209489_100210 3300027361 Bacteria 96217
158 Ga0209700_100116 3300027363 Bacteria 115661
159 Ga0209588_1005429 3300027671 Bacteria 3655
160 Ga0268266_10005077 3300028379 Bacteria 12414
161 Ga0268266_10429614 3300028379 Bacteria 1253
162 Ga0268265_10276475 3300028380 Bacteria 1500
163 Ga0307517_10000008 3300028786 Bacteria 243202
164 Ga0307515_10227102 3300028794 Bacteria 1669
165 Ga0265325_10017619 3300031241 Bacteria 3969
166 Ga0265339_10040853 3300031249 Bacteria 2577
167 Ga0265316_10232456 3300031344 Bacteria 1357
168 Ga0307513_10053702 3300031456 Bacteria 4328
169 Ga0307513_10099941 3300031456 Bacteria 2928
170 Ga0307513_10116626 3300031456 Bacteria 2649
171 Ga0307513_10269254 3300031456 Bacteria 1488
172 Ga0307509_10122578 3300031507 Bacteria 2574
173 Ga0265313_10061306 3300031595 Bacteria 1761
174 Ga0307508_10037396 3300031616 Bacteria 4366
175 Ga0265314_10067897 3300031711 Bacteria 2399
176 Ga0265342_10123601 3300031712 Bacteria 1455
177 Ga0307516_10003542 3300031730 Bacteria 19966
178 Ga0307516_10014375 3300031730 Bacteria 8377
179 Ga0307516_10032629 3300031730 Bacteria 5243
180 Ga0307415_100205905 3300032126 Bacteria 1565
181 Ga0307510_10027613 3300033180 Bacteria 6497
182 Ga0307510_10115702 3300033180 Bacteria 2405
183 Ga0373954_0019530 3300035118 Bacteria 3058
184 Ga0373931_0080997 3300035691 Bacteria 1792
185 Ga0395900_0452983 3300037418 Bacteria 1239
186 Ga0395905_0000548 3300037471 Bacteria 51350
187 Ga0395905_0447774 3300037471 Bacteria 1189
188 Ga0395901_0107274 3300038443 Bacteria 2931
189 Ga0436365_0012708 3300039437 Bacteria 3642
190 Ga0436365_0612221 3300039437 Bacteria 8371
191 Ga0436363_1602871 3300039450 Bacteria 4949
192 Ga0439436_0000089 3300041404 Bacteria 21892
193 Ga0439461_0009636 3300041410 Bacteria 1756
194 Ga0439466_0008222 3300041411 Bacteria 3934
195 Ga0439465_0000306 3300041413 Bacteria 13858
196 Ga0451833_0358655 3300041491 Bacteria 1428
197 Ga0439431_0000537 3300041997 Bacteria 8043
198 Ga0439433_0007118 3300041999 Bacteria 2415
199 Ga0439442_000868 3300042002 Bacteria 6221
200 Ga0439445_0000482 3300042004 Bacteria 8089
201 Ga0439432_000424 3300042006 Bacteria 15760
202 Ga0439449_0000280 3300042007 Bacteria 18428
203 Ga0439452_000869 3300042010 Bacteria 13980
204 Ga0439457_019034 3300042014 Bacteria 1525
205 Ga0439462_0037053 3300042015 Bacteria 1298
206 Ga0439446_0000322 3300042156 Bacteria 9178
207 Ga0439434_0001202 3300042435 Bacteria 7458
208 Ga0451577_0193234 3300042876 Bacteria 1836
209 Ga0466972_0001838 3300044658 Bacteria 10389
210 Ga0466972_0013922 3300044658 Bacteria 4034
211 Ga0466966_0014385 3300044684 Bacteria 5239
212 Ga0466963_0006291 3300044694 Bacteria 7021
213 Ga0466957_0020281 3300044842 Bacteria 3911
214 Ga0466959_0033938 3300045049 Bacteria 3775
215 Ga0466959_0064865 3300045049 Bacteria 2651
216 Ga0451576_0370965 3300045051 Bacteria 1499
217 Ga0466967_0020653 3300045976 Bacteria 5329
218 Ga0495617_037388 3300046452 Bacteria 1626
219 Ga0495627_008960 3300046453 Bacteria 3700
220 Ga0495592_0220939 3300046454 Bacteria 1267
221 Ga0495603_0009099 3300046455 Bacteria 6004
222 Ga0495603_0170390 3300046455 Bacteria 1261
223 Ga0495638_0008675 3300046460 Bacteria 7190
224 Ga0495638_0015731 3300046460 Bacteria 5072
225 Ga0495638_0127485 3300046460 Bacteria 1498
226 Ga0495651_0058888 3300046462 Bacteria 2947
227 Ga0495651_0059689 3300046462 Bacteria 2924
228 Ga0495651_0161564 3300046462 Bacteria 1604
229 Ga0495653_0044682 3300046463 Bacteria 3438
230 Ga0495653_0143436 3300046463 Bacteria 1677
231 Ga0495639_0096887 3300046475 Bacteria 1389
232 Ga0495662_0129003 3300046476 Bacteria 1243
233 Ga0495607_0000060 3300046501 Bacteria 108449
234 Ga0495606_0019863 3300046507 Bacteria 4975
235 Ga0495606_0187385 3300046507 Bacteria 1188
236 Ga0495608_0147187 3300046511 Bacteria 1502
237 Ga0495616_0000562 3300046513 Bacteria 28069
238 Ga0495618_0039747 3300046514 Bacteria 2958
239 Ga0495620_0015159 3300046515 Bacteria 3898
240 Ga0495620_0028018 3300046515 Bacteria 2626
241 Ga0495631_0071426 3300046518 Bacteria 1500
242 Ga0495632_0010701 3300046519 Bacteria 5407
243 Ga0495637_0019284 3300046520 Bacteria 3155
244 Ga0495643_0032779 3300046522 Bacteria 2881
245 Ga0495648_0075806 3300046524 Bacteria 1933
246 Ga0495663_0037193 3300046525 Bacteria 1467
247 Ga0495642_0078582 3300046528 Bacteria 1387
248 Ga0495654_0003171 3300046530 Bacteria 10202
249 Ga0495654_0007228 3300046530 Bacteria 6227
250 Ga0495640_0032211 3300046533 Bacteria 3735
251 Ga0495587_0054906 3300046536 Bacteria 2347
252 Ga0495621_0008436 3300046539 Bacteria 3090
253 Ga0495622_0004569 3300046557 Bacteria 6409
254 Ga0495667_0081636 3300046559 Bacteria 2101
255 Ga0495656_0000198 3300046615 Bacteria 21587
256 Ga0495668_0035944 3300046616 Bacteria 2777
257 Ga0495668_0093282 3300046616 Bacteria 1649
258 Ga0495611_0056954 3300046648 Bacteria 1771
259 Ga0495625_0011649 3300046660 Bacteria 7154
260 Ga0495635_0041397 3300046663 Bacteria 3182
261 Ga0495657_0007621 3300046675 Bacteria 8338
262 Ga0495646_0105476 3300046680 Bacteria 1610
263 Ga0495613_0177390 3300046689 Bacteria 1510
264 Ga0495613_0185174 3300046689 Bacteria 1473
265 Ga0495624_0059421 3300046690 Bacteria 2399
266 Ga0495670_0092256 3300046691 Bacteria 1551
267 Ga0495600_0183621 3300046809 Bacteria 1347
268 Ga0495581_0019611 3300047315 Bacteria 3925
269 Ga0495672_0020076 3300047320 Bacteria 4388
270 Ga0495676_0023112 3300047321 Bacteria 5400
271 Ga0495676_0167492 3300047321 Bacteria 1549
272 Ga0495673_0030904 3300047469 Bacteria 2511
273 Ga0495673_0081026 3300047469 Bacteria 1345
274 Ga0495686_0112575 3300047472 Bacteria 1630
275 Ga0495593_0025679 3300047673 Bacteria 3260
276 Ga0495593_0099672 3300047673 Bacteria 1491
277 Ga0495615_0004234 3300048090 Bacteria 2486
278 Ga0496100_0003079 3300048903 Bacteria 8626
279 Ga0496100_0067682 3300048903 Bacteria 2373
280 Ga0496101_0008166 3300048904 Bacteria 6835
281 Ga0496102_0003422 3300048905 Bacteria 13462
282 Ga0496102_0390517 3300048905 Bacteria 1309
283 Ga0496104_0001742 3300048907 Bacteria 18797
284 Ga0496104_0008069 3300048907 Bacteria 9340
285 Ga0496104_0185598 3300048907 Bacteria 1990
286 Ga0496105_0001065 3300048908 Bacteria 18990
287 Ga0496105_0014413 3300048908 Bacteria 6293
288 Ga0496106_0026058 3300048909 Bacteria 4351
289 Ga0496106_0220673 3300048909 Bacteria 1512
290 Ga0496109_0133311 3300048912 Bacteria 2320
291 Ga0496109_0195177 3300048912 Bacteria 1903
292 Ga0496110_0014308 3300048913 Bacteria 6583
293 Ga0496110_0079971 3300048913 Bacteria 2911
294 Ga0496110_0311662 3300048913 Bacteria 1433
295 Ga0496114_0010148 3300048917 Bacteria 7495
296 Ga0496114_0068563 3300048917 Bacteria 2978
297 Ga0496114_0117385 3300048917 Bacteria 2286
298 Ga0496114_0202941 3300048917 Bacteria 1737
299 Ga0496114_0363148 3300048917 Bacteria 1281
300 Ga0496115_0110231 3300048918 Bacteria 2261
301 Ga0496115_0142006 3300048918 Bacteria 1981
302 Ga0496117_0072555 3300048920 Bacteria 2300
303 Ga0496118_0045939 3300048921 Bacteria 3402
304 Ga0496118_0047065 3300048921 Bacteria 3348
305 Ga0496119_0111361 3300048922 Bacteria 1519
306 Ga0496120_0024157 3300048923 Bacteria 3793
307 Ga0496120_0063511 3300048923 Bacteria 2054
308 Ga0496121_0078391 3300048924 Bacteria 2626
309 Ga0496121_0139088 3300048924 Bacteria 1804
310 Ga0496122_0010784 3300048925 Bacteria 9368
311 Ga0496122_0060404 3300048925 Bacteria 2792
312 Ga0496122_0088314 3300048925 Bacteria 2125
313 Ga0496123_0068433 3300048926 Bacteria 2236
314 Ga0496124_0064469 3300048927 Bacteria 3058
315 Ga0496124_0180776 3300048927 Bacteria 1623
316 Ga0496125_0025027 3300048928 Bacteria 5476
317 Ga0496125_0033810 3300048928 Bacteria 4517
318 Ga0496125_0137916 3300048928 Bacteria 1702
319 Ga0496126_0018069 3300048929 Bacteria 7004
320 Ga0496126_0023637 3300048929 Bacteria 5954
321 Ga0496126_0032695 3300048929 Bacteria 4898
322 Ga0496126_0086606 3300048929 Bacteria 2761
323 Ga0496126_0136439 3300048929 Bacteria 2116
324 Ga0501034_0141259 3300049571 Bacteria 2387
325 Ga0501072_0117045 3300049588 Bacteria 2123
326 Ga0501076_0258007 3300049592 Bacteria 1427
327 nmdc:mga00v17_177539_c1 3300050491 Bacteria 1374
328 nmdc:mga00v17_9032_c1 3300050491 Bacteria 5378
329 nmdc:mga00v17_97259_c1 3300050491 Bacteria 1855
330 nmdc:mga0yw44_24969_c1 3300050492 Bacteria 3391
331 nmdc:mga0k408_41914_c1 3300050493 Bacteria 2636
332 nmdc:mga05p37_2581_c1 3300050507 Bacteria 21054
333 nmdc:mga05p37_78589_c1 3300050507 Bacteria 4063
334 nmdc:mga05p37_88256_c1 3300050507 Bacteria 3823
335 nmdc:mga06r32_14727_c1 3300050510 Bacteria 7098
336 nmdc:mga06r32_147320_c1 3300050510 Bacteria 2332
337 nmdc:mga06r32_210667_c1 3300050510 Bacteria 1931
338 nmdc:mga08y16_111375_c1 3300050511 Bacteria 2849
339 nmdc:mga0n895_186954_c1 3300050512 Bacteria 2102
340 nmdc:mga0n895_29055_c1 3300050512 Bacteria 5268
341 nmdc:mga0n895_302446_c1 3300050512 Bacteria 1621
342 nmdc:mga0rr50_20064_c1 3300050513 Bacteria 4529
343 nmdc:mga0rr50_36647_c1 3300050513 Bacteria 3534
344 nmdc:mga08x19_222316_c1 3300050514 Bacteria 1298
345 nmdc:mga0a205_190866_c1 3300050515 Bacteria 1941
346 nmdc:mga0a205_4866_c1 3300050515 Bacteria 12080
347 nmdc:mga0sz30_27855_c1 3300050516 Bacteria 2323
348 Ga0500643_000013 3300053087 Bacteria 324296
349 Ga0500643_001421 3300053087 Bacteria 13818
350 Ga0500644_0000877 3300053088 Bacteria 9814
351 Ga0500581_091633 3300053089 Bacteria 1505
352 Ga0500647_0035169 3300053091 Bacteria 2394
353 Ga0500583_0055115 3300053092 Bacteria 1858
354 Ga0500651_0000136 3300053093 Bacteria 45911
355 Ga0500566_0000175 3300053094 Bacteria 32618
356 Ga0500555_018139 3300053103 Bacteria 2028
357 Ga0500571_002109 3300053110 Bacteria 9740
358 Ga0500572_000114 3300053111 Bacteria 26963
359 Ga0500594_0004339 3300053118 Bacteria 3123
360 Ga0500595_000003 3300053119 Bacteria 419332
361 Ga0500614_003437 3300053123 Bacteria 3406
362 Ga0500642_0000089 3300053130 Bacteria 47311
363 Ga0500642_0014527 3300053130 Bacteria 2933
364 Ga0500658_0000533 3300053134 Bacteria 16061
365 Ga0500658_0000760 3300053134 Bacteria 13287
366 Ga0500658_0031169 3300053134 Bacteria 2085
367 Ga0500658_0085240 3300053134 Bacteria 1358
368 Ga0500559_0001756 3300053136 Bacteria 11890
369 Ga0500568_0002408 3300053139 Bacteria 11035
370 Ga0500603_000248 3300053150 Bacteria 14177
371 Ga0500616_0000002 3300053153 Bacteria 1611257
372 Ga0500616_0048187 3300053153 Bacteria 2259
373 Ga0500620_017128 3300053155 Bacteria 2085
374 Ga0500622_0012792 3300053156 Bacteria 4534
375 Ga0500630_002060 3300053159 Bacteria 9670
376 Ga0500633_0026072 3300053160 Bacteria 1836
377 Ga0500634_0008813 3300053161 Bacteria 5063
378 Ga0500639_000006 3300053163 Bacteria 165068
379 Ga0500637_0028942 3300053178 Bacteria 3069
380 Ga0500611_008126 3300053727 Bacteria 1610
381 Ga0500645_000226 3300053730 Bacteria 42982
382 Ga0500645_007179 3300053730 Bacteria 3905
383 Ga0500596_000235 3300053735 Bacteria 9494
384 Ga0500599_003019 3300053736 Bacteria 2042
385 2511396793 2511231028 Bacteria 8046582
386 2513642604 2513237094 Bacteria 8789602
387 2513702651 2513237102 Bacteria 7703324
388 2513720595 2513237104 Bacteria 10034502
389 2517106111 2517093001 Bacteria 9002274
390 2574432112 2574179768 Bacteria 4907129
391 2617349512 2617270735 Bacteria 9163226
392 2617375108 2617270741 Bacteria 8201522
393 2671122014 2667528175 Bacteria 7532676
394 2738719325 2738541277 Bacteria 7458140
395 2738883329 2738541307 Bacteria 8606193
396 2739282944 2738543019 Bacteria 7459457
397 2793068990 2791355197 Bacteria 8420563
398 2818239863 2816332527 Bacteria 8933356
399 2824605972 2824600985 Bacteria 8488197
400 2824613455 2824609381 Bacteria 8672835
401 2824623699 2824617872 Bacteria 8814715
402 2824633463 2824626560 Bacteria 8813858
403 2824640238 2824635225 Bacteria 8785348
404 2824650887 2824644064 Bacteria 8743947
405 2824657003 2824653114 Bacteria 8493680
406 2824684595 2824679649 Bacteria 8248951
407 2824711246 2824704595 Bacteria 9667483
408 2824720765 2824714736 Bacteria 8717648
409 2824730966 2824723954 Bacteria 8758240
410 2824737133 2824732956 Bacteria 7810675
411 2824749715 2824746037 Bacteria 7911610
412 2824760706 2824753945 Bacteria 9787441
413 2824770423 2824763712 Bacteria 9792355
414 2824777947 2824773399 Bacteria 8360218
415 2841963643 2841957949 Bacteria 8652217
416 2857515023 2857509624 Bacteria 7472071
417 2857577433 2857576091 Bacteria 5465855
418 2874624982 2874620515 Bacteria 8290088
419 2874631095 2874628541 Bacteria 8630250
420 2881371259 2881364244 Bacteria 7710352
421 2881667901 2881665667 Bacteria 8175609
422 2888386346 2888378607 Bacteria 9652610
423 2888426507 2888419890 Bacteria 7857137
424 2903730781 2903727486 Bacteria 8281579
425 2903750269 2903748898 Bacteria 9972761
426 2904669043 2904666416 Bacteria 8226587
427 2904715623 2904711408 Bacteria 9771557
428 2908763927 2908756301 Bacteria 8864324
429 2908782608 2908775508 Bacteria 8092255
430 2922396140 2922393267 Bacteria 8285685
431 2922433818
432 2935635635 2935630451 Bacteria 8169952
433 2935911133 2935908558 Bacteria 8568796
434 2935920636 2935916978 Bacteria 9113783
435 2935928162 2935926038 Bacteria 8601059
436 2935937807 2935934488 Bacteria 8602579
437 2935945089 2935942939 Bacteria 8599779
438 2935954406 2935951376 Bacteria 8602333
439 2935967358 2935959822 Bacteria 7869783
440 2935971327 2935967501 Bacteria 8603075
441 2941509284 2941507105 Bacteria 8166816
442 2941517113 2941515067 Bacteria 8166720
443 2941524792 2941523033 Bacteria 8169134
444 2945989064 2945984333 Bacteria 7358892
445 3005475417 3005474847 Bacteria 9259049
446 3005487593 3005483717 Bacteria 7877331
447 3005591354 3005587118 Bacteria 7794411
448 3005601274 3005594810 Bacteria 8716512
449 3005716752 3005710791 Bacteria 7622528
450 3005724016 3005718088 Bacteria 8283608
451 8019562923 8019555841 Bacteria 9642137
452 8019573002 8019565922 Bacteria 9639779
453 8019653811 8019648815 Bacteria 10014479
454 8019694884 8019687851 Bacteria 8712826
455 8056969781 8056967851 Bacteria 9038162
456 Ga0099796_10017980
457 JGI25153J46596_10002853
458 JGI25153J46596_10008802
459 JGI25153J46596_10016800
460 JGI25153J46596_10021256
461 JGI25160J50197_1002373
462 Ga0055531_10007800
463 Ga0055531_10010492
464 Ga0065165_1000704
465 Ga0065165_1010204
466 Ga0065165_1010683
467 Ga0070667_100111219
468 Ga0070709_10002668
469 Ga0070709_10005113
470 Ga0070709_10006033
471 Ga0070709_10074340
472 Ga0070714_100011992
473 Ga0070714_100063532
474 Ga0070713_100003901
475 Ga0070713_100004191
476 Ga0070713_100287594
477 Ga0070710_10001880
478 Ga0070710_10002372
479 Ga0070710_10008339
480 Ga0070711_100005028
481 Ga0070711_100007501
482 Ga0070711_100020339
483 Ga0070678_100017754
484 Ga0070662_100058474
485 Ga0070706_100005252
486 Ga0070706_100104631
487 Ga0070706_100216244
488 Ga0070707_100312552
489 Ga0070698_100015609
490 Ga0070698_100039959
491 Ga0070697_100000934
492 Ga0070665_100028600
493 Ga0070665_100041857
494 Ga0068859_100057614
495 Ga0068861_100146067
496 Ga0068860_100368321
497 Ga0068862_100162504
498 Ga0081540_1003913
499 Ga0070717_10003568
500 Ga0070717_10003698
501 Ga0070717_10172299
502 Ga0075364_10005186
503 Ga0075364_10102185
504 Ga0070715_10001833
505 Ga0070715_10084838
506 Ga0070716_100018059
507 Ga0070716_100099383
508 Ga0070712_100028225
509 Ga0070712_100033556
510 Ga0070712_100077948
511 Ga0070712_100136113
512 Ga0075362_10058931
513 Ga0075369_10006245
514 Ga0075369_10107340
515 Ga0075366_10013779
516 Ga0075366_10018558
517 Ga0075366_10049230
518 Ga0075370_10023182
519 Ga0075428_100020774
520 Ga0075428_100067572
521 Ga0075431_100004599
522 Ga0075433_10001276
523 Ga0075433_10201000
524 Ga0075434_100002724
525 Ga0075434_100004379
526 Ga0075434_100048666
527 Ga0075429_100003776
528 Ga0068865_100190883
529 Ga0097620_100057614
530 Ga0075435_100021502
531 Ga0099794_10001307
532 Ga0105250_10021450
533 Ga0114129_10010311
534 Ga0114129_10015415
535 Ga0105242_10301471
536 Ga0099796_10027350
537 Ga0163162_10100617
538 Ga0157375_10157452
539 Ga0163163_10211176
540 Ga0182007_10000258
541 Ga0163161_10000561
542 Ga0163161_10028754
543 Ga0163161_10182184
544 Ga0214544_1000578
545 Ga0214542_1000338
546 Ga0214545_1000186
547 Ga0214543_1000271
548 Ga0214543_1041406
549 Ga0213874_10009267
550 Ga0213876_10000531
551 Ga0213876_10028562
552 Ga0213876_10038957
553 Ga0207425_1019844
554 Ga0209148_1000445
555 Ga0209233_1004289
556 Ga0209233_1010726
557 Ga0209455_1002155
558 Ga0209564_1007915
559 Ga0209758_1000109
560 Ga0209758_1000176
561 Ga0209758_1001659
562 Ga0209758_1002229
563 Ga0209758_1003698
564 Ga0209758_1015309
565 Ga0209256_1011161
566 Ga0209256_1014122
567 Ga0207426_1000522
568 Ga0207426_1000635
569 Ga0209257_1000781
570 Ga0207692_10003821
571 Ga0207692_10004026
572 Ga0207680_10051253
573 Ga0207680_10123599
574 Ga0207699_10002225
575 Ga0207699_10054711
576 Ga0207699_10072876
577 Ga0207684_10006677
578 Ga0207684_10255261
579 Ga0207671_10134067
580 Ga0207693_10004244
581 Ga0207693_10016892
582 Ga0207693_10037955
583 Ga0207693_10199688
584 Ga0207663_10002039
585 Ga0207663_10013434
586 Ga0207663_10021314
587 Ga0207646_10003508
588 Ga0207700_10025721
589 Ga0207700_10048319
590 Ga0207700_10122964
591 Ga0207664_10005949
592 Ga0207664_10052336
593 Ga0207664_10067630
594 Ga0207706_10155715
595 Ga0207706_10191630
596 Ga0207704_10055969
597 Ga0207665_10007339
598 Ga0207689_10028674
599 Ga0207651_10048172
600 Ga0207658_10023459
601 Ga0207658_10096474
602 Ga0207639_10118774
603 Ga0207678_10016716
604 Ga0207708_10078649
605 Ga0207702_10208726
606 Ga0207675_100056901
607 Ga0207683_10008440
608 Ga0209389_1000045
609 Ga0209389_1000355
610 Ga0209589_1003826
611 Ga0209489_100110
612 Ga0209489_100210
613 Ga0209700_100116
614 Ga0209588_1005429
615 Ga0268266_10005077
616 Ga0268266_10429614
617 Ga0268265_10276475
618 Ga0307517_10000008
619 Ga0307515_10227102
620 Ga0265325_10017619
621 Ga0265339_10040853
622 Ga0265316_10232456
623 Ga0307513_10053702
624 Ga0307513_10099941
625 Ga0307513_10116626
626 Ga0307513_10269254
627 Ga0307509_10122578
628 Ga0265313_10061306
629 Ga0307508_10037396
630 Ga0265314_10067897
631 Ga0265342_10123601
632 Ga0307516_10003542
633 Ga0307516_10014375
634 Ga0307516_10032629
635 Ga0307415_100205905
636 Ga0307510_10027613
637 Ga0307510_10115702
638 Ga0373954_0019530
639 Ga0373931_0080997
640 Ga0395900_0452983
641 Ga0395905_0000548
642 Ga0395905_0447774
643 Ga0395901_0107274
644 Ga0436365_0012708
645 Ga0436365_0612221
646 Ga0436363_1602871
647 Ga0439436_0000089
648 Ga0439461_0009636
649 Ga0439466_0008222
650 Ga0439465_0000306
651 Ga0451833_0358655
652 Ga0439431_0000537
653 Ga0439433_0007118
654 Ga0439442_000868
655 Ga0439445_0000482
656 Ga0439432_000424
657 Ga0439449_0000280
658 Ga0439452_000869
659 Ga0439457_019034
660 Ga0439462_0037053
661 Ga0439446_0000322
662 Ga0439434_0001202
663 Ga0451577_0193234
664 Ga0466972_0001838
665 Ga0466972_0013922
666 Ga0466966_0014385
667 Ga0466963_0006291
668 Ga0466957_0020281
669 Ga0466959_0033938
670 Ga0466959_0064865
671 Ga0451576_0370965
672 Ga0466967_0020653
673 Ga0495617_037388
674 Ga0495627_008960
675 Ga0495592_0220939
676 Ga0495603_0009099
677 Ga0495603_0170390
678 Ga0495638_0008675
679 Ga0495638_0015731
680 Ga0495638_0127485
681 Ga0495651_0058888
682 Ga0495651_0059689
683 Ga0495651_0161564
684 Ga0495653_0044682
685 Ga0495653_0143436
686 Ga0495639_0096887
687 Ga0495662_0129003
688 Ga0495607_0000060
689 Ga0495606_0019863
690 Ga0495606_0187385
691 Ga0495608_0147187
692 Ga0495616_0000562
693 Ga0495618_0039747
694 Ga0495620_0015159
695 Ga0495620_0028018
696 Ga0495631_0071426
697 Ga0495632_0010701
698 Ga0495637_0019284
699 Ga0495643_0032779
700 Ga0495648_0075806
701 Ga0495663_0037193
702 Ga0495642_0078582
703 Ga0495654_0003171
704 Ga0495654_0007228
705 Ga0495640_0032211
706 Ga0495587_0054906
707 Ga0495621_0008436
708 Ga0495622_0004569
709 Ga0495667_0081636
710 Ga0495656_0000198
711 Ga0495668_0035944
712 Ga0495668_0093282
713 Ga0495611_0056954
714 Ga0495625_0011649
715 Ga0495635_0041397
716 Ga0495657_0007621
717 Ga0495646_0105476
718 Ga0495613_0177390
719 Ga0495613_0185174
720 Ga0495624_0059421
721 Ga0495670_0092256
722 Ga0495600_0183621
723 Ga0495581_0019611
724 Ga0495672_0020076
725 Ga0495676_0023112
726 Ga0495676_0167492
727 Ga0495673_0030904
728 Ga0495673_0081026
729 Ga0495686_0112575
730 Ga0495593_0025679
731 Ga0495593_0099672
732 Ga0495615_0004234
733 Ga0496100_0003079
734 Ga0496100_0067682
735 Ga0496101_0008166
736 Ga0496102_0003422
737 Ga0496102_0390517
738 Ga0496104_0001742
739 Ga0496104_0008069
740 Ga0496104_0185598
741 Ga0496105_0001065
742 Ga0496105_0014413
743 Ga0496106_0026058
744 Ga0496106_0220673
745 Ga0496109_0133311
746 Ga0496109_0195177
747 Ga0496110_0014308
748 Ga0496110_0079971
749 Ga0496110_0311662
750 Ga0496114_0010148
751 Ga0496114_0068563
752 Ga0496114_0117385
753 Ga0496114_0202941
754 Ga0496114_0363148
755 Ga0496115_0110231
756 Ga0496115_0142006
757 Ga0496117_0072555
758 Ga0496118_0045939
759 Ga0496118_0047065
760 Ga0496119_0111361
761 Ga0496120_0024157
762 Ga0496120_0063511
763 Ga0496121_0078391
764 Ga0496121_0139088
765 Ga0496122_0010784
766 Ga0496122_0060404
767 Ga0496122_0088314
768 Ga0496123_0068433
769 Ga0496124_0064469
770 Ga0496124_0180776
771 Ga0496125_0025027
772 Ga0496125_0033810
773 Ga0496125_0137916
774 Ga0496126_0018069
775 Ga0496126_0023637
776 Ga0496126_0032695
777 Ga0496126_0086606
778 Ga0496126_0136439
779 Ga0501034_0141259
780 Ga0501072_0117045
781 Ga0501076_0258007
782 nmdc:mga00v17_177539_c1
783 nmdc:mga00v17_9032_c1
784 nmdc:mga00v17_97259_c1
785 nmdc:mga0yw44_24969_c1
786 nmdc:mga0k408_41914_c1
787 nmdc:mga05p37_2581_c1
788 nmdc:mga05p37_78589_c1
789 nmdc:mga05p37_88256_c1
790 nmdc:mga06r32_14727_c1
791 nmdc:mga06r32_147320_c1
792 nmdc:mga06r32_210667_c1
793 nmdc:mga08y16_111375_c1
794 nmdc:mga0n895_186954_c1
795 nmdc:mga0n895_29055_c1
796 nmdc:mga0n895_302446_c1
797 nmdc:mga0rr50_20064_c1
798 nmdc:mga0rr50_36647_c1
799 nmdc:mga08x19_222316_c1
800 nmdc:mga0a205_190866_c1
801 nmdc:mga0a205_4866_c1
802 nmdc:mga0sz30_27855_c1
803 Ga0500643_000013
804 Ga0500643_001421
805 Ga0500644_0000877
806 Ga0500581_091633
807 Ga0500647_0035169
808 Ga0500583_0055115
809 Ga0500651_0000136
810 Ga0500566_0000175
811 Ga0500555_018139
812 Ga0500571_002109
813 Ga0500572_000114
814 Ga0500594_0004339
815 Ga0500595_000003
816 Ga0500614_003437
817 Ga0500642_0000089
818 Ga0500642_0014527
819 Ga0500658_0000533
820 Ga0500658_0000760
821 Ga0500658_0031169
822 Ga0500658_0085240
823 Ga0500559_0001756
824 Ga0500568_0002408
825 Ga0500603_000248
826 Ga0500616_0000002
827 Ga0500616_0048187
828 Ga0500620_017128
829 Ga0500622_0012792
830 Ga0500630_002060
831 Ga0500633_0026072
832 Ga0500634_0008813
833 Ga0500639_000006
834 Ga0500637_0028942
835 Ga0500611_008126
836 Ga0500645_000226
837 Ga0500645_007179
838 Ga0500596_000235
839 Ga0500599_003019
840 2511396793
841 2513642604
842 2513702651
843 2513720595
844 2517106111
845 2574432112
846 2617349512
847 2617375108
848 2671122014
849 2738719325
850 2738883329
851 2739282944
852 2793068990
853 2818239863
854 2824605972
855 2824613455
856 2824623699
857 2824633463
858 2824640238
859 2824650887
860 2824657003
861 2824684595
862 2824711246
863 2824720765
864 2824730966
865 2824737133
866 2824749715
867 2824760706
868 2824770423
869 2824777947
870 2841963643
871 2857515023
872 2857577433
873 2874624982
874 2874631095
875 2881371259
876 2881667901
877 2888386346
878 2888426507
879 2903730781
880 2903750269
881 2904669043
882 2904715623
883 2908763927
884 2908782608
885 2922396140
886 2922433818
887 2935635635
888 2935911133
889 2935920636
890 2935928162
891 2935937807
892 2935945089
893 2935954406
894 2935967358
895 2935971327
896 2941509284
897 2941517113
898 2941524792
899 2945989064
900 3005475417
901 3005487593
902 3005591354
903 3005601274
904 3005716752
905 3005724016
906 8019562923
907 8019573002
908 8019653811
909 8019694884
910 8056969781

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09663

Amido_AtzD_TrzD

Amidohydrolase ring-opening protein (Amido_AtzD_TrzD)

73

437

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bun-assembly1.cif.gz_B crystal structures of cyanuric acid hydrolase from moorella thermoacetica 0.9597 46 415
5t13-assembly1.cif.gz_A structure of the cyanuric acid hydrolase trzd reveals product exit channel 0.9561 45 415
6bun-assembly1.cif.gz_B crystal structures of cyanuric acid hydrolase from moorella thermoacetica 0.9545 46 415
6dhj-assembly1.cif.gz_F crystal structures of cyanuric acid hydrolase from moorella thermoacetica 0.954 47 415
4bvq-assembly1.cif.gz_A cyanuric acid hydrolase: evolutionary innovation by structural concatenation. 0.9526 46 414
ID Description Score Start End Superfamily
3zgrA02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Cyanuric acid hydrolase/Barbiturase, RU B 0.9756 154 294 3.30.1330.180
5hxzB02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Cyanuric acid hydrolase/Barbiturase, RU B 0.9676 154 294 3.30.1330.180
4nq3B02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Cyanuric acid hydrolase/Barbiturase, RU B 0.9656 160 292 3.30.1330.180
5hy4G02 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Cyanuric acid hydrolase/Barbiturase, RU B 0.9573 157 292 3.30.1330.180
4bvrA01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Cyanuric acid hydrolase/Barbiturase, RU A 0.9546 46 145 3.30.1330.170
ID Description Score Start End GO Terms
AF-A0A508SW83-F1-model_v4 Cyanuric acid amidohydrolase (EC 3.5.2.15) 0.9664 44 236 GO:0018753
AF-A0A0K2F1X3-F1-model_v4 TrzD 0.966 107 296 GO:0016812
AF-C7EY81-F1-model_v4 Cyanuric acid amidohydrolase 0.9648 99 270 GO:0016812
AF-A0A0K2F269-F1-model_v4 TrzD 0.9628 107 283 GO:0016812
AF-A0A842SD09-F1-model_v4 Ring-opening amidohydrolase 0.9621 47 294 GO:0016812

Map