F447607

General Info

Members Datasets Scaffolds Average Seq Length
455 291 910 437

Family's Representative Sequence

Representative Sequence 3300031665|Ga0316575_10004568|Ga0316575_100045682
Length 505
Sequence VRSRRDGAVSGRGRDVGDRLRHGPPADQPTRGTGEDPEEQTDAGPPEVATHAAIVGLLPPTLAPVSDPTAGEGRSLRHGSRLDAYVDRYAERTLGMTASQIRALFAVASRPEVVSLAGGMPTIASLPLDVIGDQMADLVRGHGQTALQYGSGQGDPLLREQITDVMHTVGISGHPDDVVVTVGSQQALDLVTRIFIDPGDTILAEAPSYVGALSTFRSYQAVVHHVAMDDHGLVPEALRDAIRAAHARGSRPTFLYTIPSYHNPAGVTQTEQRRKEVLAIADEADLLVIEDDPYGLLGFSGPPPRALRADAEDRVIYLGSFSKTFAPGLRVGWVLAPHAVREKLVLAAEASVLCPPSLNQMVVSRYLAQSDWMGQVEVFRGLYRERRDAMLSSLHELFPAGSHWTQPEGGFYVWLTLPEGLDSQAMLPRAVTERVAYVPGTAFYADGFGTREMRLSYCFPTPERIREGVRRLAAVVEAELDLVRTFGPGHLASRAGMGLPGPDLA

Samples

Sample ID Description Type Environment
1 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
7 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
8 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
9 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
10 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
26 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
27 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
28 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
51 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
52 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
53 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
61 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
91 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
92 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
93 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
94 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
95 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
96 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
97 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
98 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
99 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
100 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
104 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
105 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
106 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
107 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
108 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
109 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
110 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
111 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
112 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
115 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
116 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
117 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
118 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
119 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
120 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
121 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
122 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
123 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
124 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
125 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
128 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
129 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
136 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
139 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
143 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
146 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
147 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
148 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
149 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
150 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
151 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
152 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
153 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
154 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
155 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
156 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
157 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
183 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
184 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
185 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
186 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
187 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
188 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
189 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
190 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
191 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
192 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
193 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
194 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
195 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
196 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
199 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
200 2501939600 Micromonospora sp. L5 Isolate Unclassified
201 2515154088 Salinispora arenicola CNT800 Isolate Rhizosphere
202 2515154129 Salinispora pacifica CNS103 Isolate Rhizosphere
203 2515154137 Salinispora arenicola CNX482 Isolate Rhizosphere
204 2515154202 Salinispora pacifica CNT084 Isolate Rhizosphere
205 2515154203 Salinispora arenicola CNR921 Isolate Rhizosphere
206 2558860280 Kutzneria sp. 744 Isolate Unclassified
207 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
208 2585428094 Herbiconiux sp. YR403 Isolate Rhizosphere
209 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
210 2643221549 Agromyces sp. Root1464 Isolate Unclassified
211 2643221572 Leifsonia sp. Root60 Isolate Unclassified
212 2643221616 Leifsonia sp. Root227 Isolate Unclassified
213 2643221619 Agromyces sp. Root81 Isolate Unclassified
214 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
215 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
216 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
217 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
218 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
219 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
220 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
221 2808606372 Agromyces sp. 23-23 Isolate Unclassified
222 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
223 2831935698 Jishengella sp. AZ1-13 Isolate Unclassified
224 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
225 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
226 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
227 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
228 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
229 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
230 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
231 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
232 2855683550 Micromonospora sp. RP3T Isolate Unclassified
233 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
234 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
235 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
236 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
237 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
238 2858868258 Micromonospora sp. MH33 Isolate Unclassified
239 2858882152 Micromonospora noduli MED15 Isolate Nodule
240 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
241 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
242 2858902515 Micromonospora sp. MW-13 Isolate Rhizosphere
243 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
244 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
245 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
246 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
247 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
248 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
249 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
250 2869061728 Micromonospora noduli ONO86 Isolate Unclassified
251 2869068681 Micromonospora noduli GUI43 Isolate Unclassified
252 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
253 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
254 2880495981 Micromonospora vinacea DSM 101695 Isolate Unclassified
255 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
256 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
257 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
258 2902582711 Micromonospora sp. AP08 Isolate Unclassified
259 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
260 2904501621 Curtobacterium sp. 1909 Isolate Unclassified
261 2908674828 Curtobacterium sp. 1517 Isolate Rhizosphere
262 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
263 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
264 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
265 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
266 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
267 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
268 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
269 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
270 2928153084 Leifsonia sp. 563 Isolate Unclassified
271 2928500415 Curtobacterium oceanosedimentum 1257 Isolate Rhizosphere
272 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
273 2929226422 Micromonospora sp. R-74116 Hybrid assembly Isolate Unclassified
274 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
275 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
276 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
277 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
278 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
279 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
280 649633069 Micromonospora sp. L5 Isolate Unclassified
281 8003830390 Micromonospora parastrephiae STR1_7 Isolate Rhizosphere
282 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
283 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
284 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
285 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified
286 8054704163 Micromonospora trifolii NIE79 Isolate Nodule
287 8054727385 Micromonospora alfalfae MED01 Isolate Nodule
288 8054734606 Micromonospora hortensis NIE111 Isolate Nodule
289 8055412473 Micromonospora phytophila DSM 105363 Isolate Nodule
290 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
291 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.12
Metatranscriptomes 0.66
Isolates 20.22

Biome Distribution

Category Percentage (%)
Aerial Root 0.22
Bulb 0
Endosphere 12.09
Nodule 1.32
Rhizoplane 5.71
Rhizosphere 60
Stem 0
Stem Tuber 0.22
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316575_10004568 3300031665 Bacteria 4874
2 JGI24740J21852_10013695 3300001979 Bacteria 3016
3 JGI24739J22299_10004756 3300001989 Bacteria 5183
4 JGI25164J39214_1001499 3300002772 Bacteria 5285
5 JGI25165J46597_1000005 3300003214 Bacteria 623702
6 Ga0055533_1000002 3300003756 Bacteria 1196393
7 Ga0055525_1000630 3300003759 Bacteria 14363
8 Ga0055527_1000004 3300003760 Bacteria 570634
9 Ga0055542_1000019 3300003762 Bacteria 341174
10 Ga0055529_1000008 3300003763 Bacteria 394786
11 Ga0065714_10009929 3300005288 Bacteria 6105
12 Ga0070658_10000380 3300005327 Bacteria 38742
13 Ga0070658_10028821 3300005327 Bacteria 4458
14 Ga0070658_10041771 3300005327 Bacteria 3700
15 Ga0070690_100140798 3300005330 Bacteria 1637
16 Ga0070682_100111081 3300005337 Bacteria 1827
17 Ga0068868_100147288 3300005338 Bacteria 1937
18 Ga0070660_100053744 3300005339 Bacteria 3107
19 Ga0070661_100148731 3300005344 Bacteria 1770
20 Ga0070668_100005063 3300005347 Bacteria 9756
21 Ga0070668_100135120 3300005347 Bacteria 1983
22 Ga0070668_100138420 3300005347 Bacteria 1960
23 Ga0070671_100030554 3300005355 Bacteria 4445
24 Ga0070671_100124005 3300005355 Bacteria 2174
25 Ga0070659_100022248 3300005366 Bacteria 4838
26 Ga0070659_100097996 3300005366 Bacteria 2357
27 Ga0070667_100016686 3300005367 Bacteria 6078
28 Ga0070667_100021246 3300005367 Bacteria 5393
29 Ga0070667_100087969 3300005367 Bacteria 2667
30 Ga0070710_10004155 3300005437 Bacteria 6874
31 Ga0070684_100105865 3300005535 Bacteria 2517
32 Ga0068853_100008802 3300005539 Bacteria 8118
33 Ga0068853_100111035 3300005539 Bacteria 2435
34 Ga0070665_100131018 3300005548 Bacteria 2510
35 Ga0068855_100030061 3300005563 Bacteria 6497
36 Ga0068855_100045411 3300005563 Bacteria 5197
37 Ga0068857_100001906 3300005577 Bacteria 16804
38 Ga0068854_100051018 3300005578 Bacteria 2962
39 Ga0068852_100009235 3300005616 Bacteria 7306
40 Ga0068852_100035377 3300005616 Bacteria 4166
41 Ga0068851_10000053 3300005834 Bacteria 71192
42 Ga0068863_100052942 3300005841 Bacteria 3846
43 Ga0068858_100000176 3300005842 Bacteria 68056
44 Ga0081455_10001057 3300005937 Bacteria 34651
45 Ga0081539_10002979 3300005985 Bacteria 22217
46 Ga0081539_10004168 3300005985 Bacteria 16407
47 Ga0081539_10004819 3300005985 Bacteria 14467
48 Ga0070717_10089057 3300006028 Bacteria 2603
49 Ga0075365_10007956 3300006038 Bacteria 5979
50 Ga0075364_10076913 3300006051 Bacteria 2203
51 Ga0075428_100000567 3300006844 Bacteria 37710
52 Ga0105240_10005148 3300009093 Bacteria 19564
53 Ga0105240_10153287 3300009093 Bacteria 2743
54 Ga0105245_10005554 3300009098 Bacteria 11077
55 Ga0105247_10065822 3300009101 Bacteria 2255
56 Ga0105243_10029910 3300009148 Bacteria 4191
57 Ga0105243_10179369 3300009148 Bacteria 1841
58 Ga0105241_10000797 3300009174 Bacteria 23942
59 Ga0105248_10000897 3300009177 Bacteria 33319
60 Ga0105248_10038783 3300009177 Bacteria 5333
61 Ga0105237_10004763 3300009545 Bacteria 15599
62 Ga0105237_10006213 3300009545 Bacteria 13315
63 Ga0105237_10049224 3300009545 Bacteria 4236
64 Ga0105238_10000476 3300009551 Bacteria 42016
65 Ga0105238_10012941 3300009551 Bacteria 8420
66 Ga0105238_10183607 3300009551 Bacteria 2068
67 Ga0105238_10290028 3300009551 Bacteria 1618
68 Ga0105249_10054747 3300009553 Bacteria 3648
69 Ga0157371_10005769 3300013102 Bacteria 10372
70 Ga0157371_10061626 3300013102 Bacteria 2659
71 Ga0157369_10012548 3300013105 Bacteria 9613
72 Ga0157369_10049996 3300013105 Bacteria 4530
73 Ga0157375_10460939 3300013308 Bacteria 1436
74 Ga0163163_10024492 3300014325 Bacteria 5745
75 Ga0157380_10007733 3300014326 Bacteria 7651
76 Ga0206356_10714500 3300020070 Bacteria 2437
77 Ga0206354_11255560 3300020081 Bacteria 10711
78 Ga0206353_11401675 3300020082 Bacteria 4377
79 Ga0209566_100056 3300025225 Bacteria 209595
80 Ga0209674_100001 3300025226 Bacteria 4013750
81 Ga0209672_100011 3300025228 Bacteria 856297
82 Ga0209147_100289 3300025229 Bacteria 42738
83 Ga0209563_100001 3300025230 Bacteria 4013775
84 Ga0209563_101759 3300025230 Bacteria 5450
85 Ga0207427_100024 3300025231 Bacteria 438403
86 Ga0209437_100243 3300025233 Bacteria 88712
87 Ga0209677_100001 3300025253 Bacteria 4013787
88 Ga0209677_100271 3300025253 Bacteria 34642
89 Ga0209148_1000023 3300025254 Bacteria 680511
90 Ga0209148_1001423 3300025254 Bacteria 12233
91 Ga0209233_1000001 3300025261 Bacteria 2992747
92 Ga0209455_1000023 3300025272 Bacteria 680449
93 Ga0209455_1014271 3300025272 Bacteria 1805
94 Ga0207656_10000001 3300025321 Bacteria 1323684
95 Ga0207688_10076870 3300025901 Bacteria 1902
96 Ga0207647_10002880 3300025904 Bacteria 12964
97 Ga0207647_10046832 3300025904 Bacteria 2692
98 Ga0207705_10000001 3300025909 Bacteria 2061880
99 Ga0207705_10014710 3300025909 Bacteria 5627
100 Ga0207705_10021403 3300025909 Bacteria 4615
101 Ga0207705_10025588 3300025909 Bacteria 4211
102 Ga0207705_10033057 3300025909 Bacteria 3696
103 Ga0207654_10000001 3300025911 Bacteria 1816198
104 Ga0207695_10002309 3300025913 Bacteria 28441
105 Ga0207695_10056175 3300025913 Bacteria 4098
106 Ga0207671_10000001 3300025914 Bacteria 1318881
107 Ga0207671_10003504 3300025914 Bacteria 15592
108 Ga0207671_10064899 3300025914 Bacteria 2714
109 Ga0207657_10030411 3300025919 Bacteria 4901
110 Ga0207657_10037401 3300025919 Bacteria 4334
111 Ga0207694_10000019 3300025924 Bacteria 312382
112 Ga0207694_10045565 3300025924 Bacteria 3387
113 Ga0207687_10010330 3300025927 Bacteria 6101
114 Ga0207687_10023082 3300025927 Bacteria 4144
115 Ga0207644_10131353 3300025931 Bacteria 1917
116 Ga0207644_10194567 3300025931 Bacteria 1596
117 Ga0207690_10005324 3300025932 Bacteria 7584
118 Ga0207690_10080573 3300025932 Bacteria 2272
119 Ga0207709_10013195 3300025935 Bacteria 4558
120 Ga0207711_10000405 3300025941 Bacteria 45662
121 Ga0207667_10000498 3300025949 Bacteria 51911
122 Ga0207667_10029017 3300025949 Bacteria 6005
123 Ga0207667_10109863 3300025949 Bacteria 2844
124 Ga0207668_10001446 3300025972 Bacteria 13956
125 Ga0207668_10020437 3300025972 Bacteria 4207
126 Ga0207658_10013587 3300025986 Bacteria 5568
127 Ga0207703_10000121 3300026035 Bacteria 94523
128 Ga0207702_10015536 3300026078 Bacteria 6302
129 Ga0207702_10200770 3300026078 Bacteria 1848
130 Ga0207641_10010075 3300026088 Bacteria 7771
131 Ga0207641_10070398 3300026088 Bacteria 3005
132 Ga0207674_10018190 3300026116 Bacteria 7647
133 Ga0207674_10123332 3300026116 Bacteria 2557
134 Ga0207698_10000569 3300026142 Bacteria 21528
135 Ga0207698_10004534 3300026142 Bacteria 8477
136 Ga0207698_10032129 3300026142 Bacteria 3799
137 Ga0268266_10176983 3300028379 Bacteria 1940
138 Ga0307515_10004726 3300028794 Bacteria 27912
139 Ga0307515_10182915 3300028794 Bacteria 2038
140 Ga0307511_10002627 3300030521 Bacteria 18740
141 Ga0307512_10062952 3300030522 Bacteria 2841
142 Ga0307509_10008875 3300031507 Bacteria 12681
143 Ga0307509_10112986 3300031507 Bacteria 2714
144 Ga0307508_10011562 3300031616 Bacteria 8066
145 Ga0307514_10064224 3300031649 Bacteria 2785
146 Ga0316579_10012218 3300031691 Bacteria 3667
147 Ga0316576_10020677 3300031727 Bacteria 4539
148 Ga0316576_10020994 3300031727 Bacteria 4508
149 Ga0316576_10039134 3300031727 Bacteria 3403
150 Ga0316578_10012564 3300031728 Bacteria 4468
151 Ga0307516_10036802 3300031730 Bacteria 4896
152 Ga0316577_10033601 3300031733 Bacteria 2865
153 Ga0307409_100061445 3300031995 Bacteria 2936
154 Ga0307409_100114806 3300031995 Bacteria 2266
155 Ga0307409_100134083 3300031995 Bacteria 2122
156 Ga0307416_100050519 3300032002 Bacteria 3315
157 Ga0307416_100165812 3300032002 Bacteria 2049
158 Ga0307416_100275749 3300032002 Bacteria 1654
159 Ga0307415_100049030 3300032126 Bacteria 2852
160 Ga0307415_100049061 3300032126 Bacteria 2852
161 Ga0316585_10000595 3300032137 Bacteria 8845
162 Ga0307507_10034656 3300033179 Bacteria 5207
163 Ga0373940_0002064 3300035088 Bacteria 3816
164 Ga0373942_0000103 3300035207 Bacteria 18990
165 Ga0316574_0003143 3300035398 Bacteria 8448
166 Ga0316574_0016515 3300035398 Bacteria 4302
167 Ga0316574_0079202 3300035398 Bacteria 2084
168 Ga0316582_0048173 3300036647 Bacteria 2694
169 Ga0316584_0022311 3300036712 Bacteria 4615
170 Ga0395899_0012368 3300037312 Bacteria 6533
171 Ga0395899_0027971 3300037312 Bacteria 4246
172 Ga0395900_0000888 3300037418 Bacteria 39271
173 Ga0395900_0008604 3300037418 Bacteria 10487
174 Ga0395898_0000355 3300037466 Bacteria 101003
175 Ga0395898_0026345 3300037466 Bacteria 5853
176 Ga0395898_0229884 3300037466 Bacteria 1769
177 Ga0316581_0000334 3300037588 Bacteria 8529
178 Ga0395901_0001579 3300038443 Bacteria 23599
179 Ga0395901_0019074 3300038443 Bacteria 7014
180 Ga0395901_0041409 3300038443 Bacteria 4774
181 Ga0451791_1064226 3300041451 Bacteria 2954
182 Ga0451793_1372385 3300041452 Bacteria 5872
183 Ga0451837_0325826 3300041494 Bacteria 1942
184 Ga0451839_1225663 3300041496 Bacteria 2195
185 Ga0451841_0160199 3300041498 Bacteria 3443
186 Ga0451843_0815425 3300041509 Bacteria 6342
187 Ga0451853_0777022 3300041512 Bacteria 8132
188 Ga0451853_1209411 3300041512 Bacteria 6061
189 Ga0466969_0013278 3300044656 Bacteria 4337
190 Ga0466972_0005899 3300044658 Bacteria 6143
191 Ga0466965_0000004 3300044683 Bacteria 229348
192 Ga0466961_0006386 3300044693 Bacteria 7484
193 Ga0466961_0025225 3300044693 Bacteria 3823
194 Ga0466961_0037953 3300044693 Bacteria 3090
195 Ga0466961_0063183 3300044693 Bacteria 2352
196 Ga0466961_0069532 3300044693 Bacteria 2235
197 Ga0466963_0008036 3300044694 Bacteria 6315
198 Ga0466971_0045389 3300044719 Bacteria 1974
199 Ga0466970_0030763 3300044765 Bacteria 2832
200 Ga0466960_0029798 3300044901 Bacteria 2507
201 Ga0466960_0030605 3300044901 Bacteria 2478
202 Ga0466960_0089770 3300044901 Bacteria 1564
203 Ga0466959_0045659 3300045049 Bacteria 3226
204 Ga0466959_0053977 3300045049 Bacteria 2937
205 Ga0466959_0072950 3300045049 Bacteria 2483
206 Ga0466958_0050946 3300045836 Bacteria 2506
207 Ga0495650_0000211 3300046471 Bacteria 125248
208 Ga0495606_0001892 3300046507 Bacteria 26163
209 Ga0495632_0009475 3300046519 Bacteria 5870
210 Ga0495669_0009174 3300046684 Bacteria 4168
211 Ga0495672_0018755 3300047320 Bacteria 4582
212 Ga0495615_0004695 3300048090 Bacteria 2406
213 Ga0496101_0100611 3300048904 Bacteria 2163
214 Ga0496102_0018028 3300048905 Bacteria 6195
215 Ga0496102_0117081 3300048905 Bacteria 2487
216 Ga0496103_0056568 3300048906 Bacteria 2435
217 Ga0496103_0157371 3300048906 Bacteria 1457
218 Ga0496104_0024327 3300048907 Bacteria 5571
219 Ga0496105_0004142 3300048908 Bacteria 10877
220 Ga0496105_0026874 3300048908 Bacteria 4696
221 Ga0496108_0000196 3300048911 Bacteria 55981
222 Ga0496108_0001314 3300048911 Bacteria 19538
223 Ga0496108_0035420 3300048911 Bacteria 4149
224 Ga0496108_0086508 3300048911 Bacteria 2661
225 Ga0496109_0002656 3300048912 Bacteria 15001
226 Ga0496109_0083919 3300048912 Bacteria 2938
227 Ga0496110_0000656 3300048913 Bacteria 23611
228 Ga0496110_0212364 3300048913 Bacteria 1759
229 Ga0496111_0012380 3300048914 Bacteria 5773
230 Ga0496111_0065854 3300048914 Bacteria 2630
231 Ga0496113_0003887 3300048916 Bacteria 9048
232 Ga0496113_0166370 3300048916 Bacteria 1745
233 Ga0496114_0003739 3300048917 Bacteria 11722
234 Ga0496114_0016583 3300048917 Bacteria 5938
235 Ga0496114_0021592 3300048917 Bacteria 5239
236 Ga0496115_0137799 3300048918 Bacteria 2013
237 Ga0496117_0000669 3300048920 Bacteria 54825
238 Ga0496117_0001906 3300048920 Bacteria 27989
239 Ga0496117_0021298 3300048920 Bacteria 5251
240 Ga0496117_0069351 3300048920 Bacteria 2374
241 Ga0496117_0111557 3300048920 Bacteria 1702
242 Ga0496118_0000985 3300048921 Bacteria 44347
243 Ga0496118_0009039 3300048921 Bacteria 10155
244 Ga0496118_0047099 3300048921 Bacteria 3346
245 Ga0496119_0000553 3300048922 Bacteria 50775
246 Ga0496119_0003472 3300048922 Bacteria 16351
247 Ga0496119_0011186 3300048922 Bacteria 7470
248 Ga0496119_0039485 3300048922 Bacteria 3033
249 Ga0496119_0042303 3300048922 Bacteria 2890
250 Ga0496120_0001113 3300048923 Bacteria 34863
251 Ga0496120_0003581 3300048923 Bacteria 13969
252 Ga0496120_0020585 3300048923 Bacteria 4187
253 Ga0496120_0023193 3300048923 Bacteria 3888
254 Ga0496120_0054834 3300048923 Bacteria 2257
255 Ga0496121_0000046 3300048924 Bacteria 335942
256 Ga0496122_0002574 3300048925 Bacteria 25478
257 Ga0496122_0004413 3300048925 Bacteria 17513
258 Ga0496122_0015575 3300048925 Bacteria 7257
259 Ga0496123_0002281 3300048926 Bacteria 24132
260 Ga0496123_0026292 3300048926 Bacteria 4363
261 Ga0496124_0000090 3300048927 Bacteria 192095
262 Ga0496125_0000046 3300048928 Bacteria 295288
263 Ga0496126_0002342 3300048929 Bacteria 25941
264 Ga0501031_0001529 3300049568 Bacteria 14383
265 Ga0501031_0043332 3300049568 Bacteria 2937
266 Ga0501032_0001402 3300049569 Bacteria 19166
267 Ga0501033_0006614 3300049570 Bacteria 9063
268 Ga0501033_0007015 3300049570 Bacteria 8797
269 Ga0501033_0008041 3300049570 Bacteria 8169
270 Ga0501033_0008956 3300049570 Bacteria 7728
271 Ga0501033_0035165 3300049570 Bacteria 3756
272 Ga0501034_0004667 3300049571 Bacteria 15179
273 Ga0501034_0009557 3300049571 Bacteria 10151
274 Ga0501034_0013703 3300049571 Bacteria 8337
275 Ga0501034_0034004 3300049571 Bacteria 5169
276 Ga0501034_0046452 3300049571 Bacteria 4387
277 Ga0501034_0082754 3300049571 Bacteria 3211
278 Ga0501034_0083776 3300049571 Bacteria 3190
279 Ga0501034_0109778 3300049571 Bacteria 2749
280 Ga0501034_0163169 3300049571 Bacteria 2198
281 Ga0501034_0190873 3300049571 Bacteria 2011
282 Ga0501036_0016404 3300049572 Bacteria 6187
283 Ga0501036_0184470 3300049572 Bacteria 1756
284 Ga0501036_0218873 3300049572 Bacteria 1599
285 Ga0501037_0002176 3300049573 Bacteria 14181
286 Ga0501037_0030393 3300049573 Bacteria 3992
287 Ga0501037_0043521 3300049573 Bacteria 3299
288 Ga0501038_0001027 3300049574 Bacteria 25180
289 Ga0501038_0088093 3300049574 Bacteria 2606
290 Ga0501039_0011078 3300049575 Bacteria 6871
291 Ga0501039_0126737 3300049575 Bacteria 2003
292 Ga0501042_0002934 3300049578 Bacteria 10590
293 Ga0501042_0095698 3300049578 Bacteria 2133
294 Ga0501043_0035581 3300049579 Bacteria 3917
295 Ga0501043_0045364 3300049579 Bacteria 3457
296 Ga0501043_0101919 3300049579 Bacteria 2256
297 Ga0501043_0105147 3300049579 Bacteria 2218
298 Ga0501043_0130392 3300049579 Bacteria 1970
299 Ga0501043_0139047 3300049579 Bacteria 1902
300 Ga0501046_0002885 3300049580 Bacteria 15938
301 Ga0501046_0141330 3300049580 Bacteria 1821
302 Ga0501047_0037025 3300049581 Bacteria 4716
303 Ga0501047_0091594 3300049581 Bacteria 2918
304 Ga0501047_0095003 3300049581 Bacteria 2860
305 Ga0501047_0105006 3300049581 Bacteria 2705
306 Ga0501048_0049175 3300049582 Bacteria 3006
307 Ga0501048_0124195 3300049582 Bacteria 1825
308 Ga0501070_0000269 3300049586 Bacteria 49060
309 Ga0501070_0001674 3300049586 Bacteria 19652
310 Ga0501070_0002327 3300049586 Bacteria 16673
311 Ga0501070_0007555 3300049586 Bacteria 9238
312 Ga0501070_0061690 3300049586 Bacteria 3106
313 Ga0501071_0044176 3300049587 Bacteria 3195
314 Ga0501073_0000063 3300049589 Bacteria 66508
315 Ga0501073_0014271 3300049589 Bacteria 5769
316 Ga0501073_0030405 3300049589 Bacteria 3856
317 Ga0501073_0133429 3300049589 Bacteria 1721
318 Ga0501076_0117680 3300049592 Bacteria 2151
319 Ga0501080_0000331 3300049742 Bacteria 36170
320 Ga0501080_0208647 3300049742 Bacteria 1791
321 Ga0501083_0000990 3300049744 Bacteria 18870
322 Ga0501083_0008270 3300049744 Bacteria 7355
323 Ga0501035_0001926 3300049822 Bacteria 20795
324 Ga0501035_0029068 3300049822 Bacteria 5041
325 Ga0501035_0032143 3300049822 Bacteria 4776
326 Ga0501035_0032156 3300049822 Bacteria 4775
327 Ga0501035_0191515 3300049822 Bacteria 1758
328 Ga0501044_0000521 3300049823 Bacteria 46867
329 Ga0501044_0016576 3300049823 Bacteria 7908
330 Ga0501044_0017313 3300049823 Bacteria 7729
331 Ga0501044_0071565 3300049823 Bacteria 3525
332 Ga0501045_0085474 3300049824 Bacteria 2328
333 nmdc:mga00v17_7302_c1 3300050491 Bacteria 5889
334 nmdc:mga0yw44_1262_c1 3300050492 Bacteria 9956
335 nmdc:mga0sz30_10808_c1 3300050516 Bacteria 1996
336 Ga0500635_0000066 3300053080 Bacteria 69274
337 Ga0500643_000124 3300053087 Bacteria 79663
338 Ga0500643_000794 3300053087 Bacteria 20487
339 Ga0500556_0000008 3300053104 Bacteria 304943
340 Ga0500556_0000527 3300053104 Bacteria 26115
341 Ga0500562_000180 3300053108 Bacteria 17367
342 Ga0500652_039988 3300053131 Bacteria 1883
343 Ga0500655_001913 3300053133 Bacteria 3870
344 Ga0500559_0000420 3300053136 Bacteria 30370
345 Ga0500559_0001832 3300053136 Bacteria 11596
346 Ga0500568_0000003 3300053139 Bacteria 863587
347 Ga0500568_0000007 3300053139 Bacteria 292579
348 Ga0500568_0000099 3300053139 Bacteria 80197
349 Ga0500568_0017214 3300053139 Bacteria 3194
350 Ga0500573_0000005 3300053140 Bacteria 315762
351 Ga0500573_0004199 3300053140 Bacteria 7547
352 Ga0500573_0020760 3300053140 Bacteria 3761
353 Ga0500573_0023474 3300053140 Bacteria 3542
354 Ga0500573_0025369 3300053140 Bacteria 3408
355 Ga0500573_0027563 3300053140 Bacteria 3268
356 Ga0500573_0053983 3300053140 Bacteria 2308
357 Ga0500577_0010271 3300053142 Bacteria 2750
358 Ga0500590_001387 3300053148 Bacteria 9919
359 Ga0500616_0000010 3300053153 Bacteria 761410
360 Ga0500616_0000807 3300053153 Bacteria 35698
361 Ga0500616_0015095 3300053153 Bacteria 4426
362 Ga0500620_000266 3300053155 Bacteria 10153
363 Ga0500645_003342 3300053730 Bacteria 6574
364 2501944871 2501939600 Bacteria 6907073
365 2515498194 2515154088 Bacteria 5526283
366 2515721844 2515154129 Bacteria 5584369
367 2515759415 2515154137 Bacteria 5711575
368 2516084198 2515154202 Bacteria 5471270
369 2516092295 2515154203 Bacteria 5458536
370 2559427977 2558860280 Bacteria 11429938
371 2586065721 2585427649 Bacteria 9053857
372 2587861977 2585428094 Bacteria 3604039
373 2623585772 2622736626 Bacteria 7181580
374 2643767177 2643221549 Bacteria 4042819
375 2643877143 2643221572 Bacteria 3614809
376 2644097408 2643221616 Bacteria 4066575
377 2644112888 2643221619 Bacteria 4158469
378 2644181837 2643221632 Bacteria 3406696
379 2644197576 2643221635 Bacteria 2632343
380 2644384198 2643221669 Bacteria 3611286
381 2723644027 2721755702 Bacteria 4373124
382 2753269733 2751185782 Bacteria 11227053
383 2753303949 2751185788 Bacteria 4541048
384 2772642827 2772190715 Bacteria 6959372
385 2808899906 2808606372 Bacteria 4649509
386 2812363195 2811994880 Bacteria 4147780
387 2831938185 2831935698 Bacteria 5963223
388 2832005328 2832004796 Bacteria 6538017
389 2839988987 2839986021 Bacteria 3685650
390 2844844323 2844841374 Bacteria 3917147
391 2844853623 2844852863 Bacteria 3849151
392 2852644007 2852643534 Bacteria 3013378
393 2852677573 2852677369 Bacteria 3768884
394 2855675129 2855670206 Bacteria 7120389
395 2855679760 2855676851 Bacteria 7063653
396 2855688020 2855683550 Bacteria 7134265
397 2856859655 2856858025 Bacteria 7255264
398 2857294402 2857288857 Bacteria 7189066
399 2857735057 2857733635 Bacteria 3532004
400 2857738779 2857737099 Bacteria 3104305
401 2858854689 2858848962 Bacteria 6963058
402 2858868762 2858868258 Bacteria 7683772
403 2858885250 2858882152 Bacteria 7230291
404 2858891883 2858888857 Bacteria 7060307
405 2858899662 2858895516 Bacteria 7378898
406 2858904902 2858902515 Bacteria 7086037
407 2862994076 2862993130 Bacteria 3860849
408 2866071463 2866065130 Bacteria 6518152
409 2867304702 2867302475 Bacteria 7087181
410 2867318730 2867312974 Bacteria 7058875
411 2867323954 2867319477 Bacteria 7069771
412 2867509988 2867507094 Bacteria 6506033
413 2869052018 2869048445 Bacteria 6875584
414 2869067476 2869061728 Bacteria 7112407
415 2869074770 2869068681 Bacteria 7205615
416 2870625369 2870622029 Bacteria 3643329
417 2880494461 2880489317 Bacteria 7096270
418 2880497843 2880495981 Bacteria 7340502
419 2884767348 2884763398 Bacteria 4091164
420 2895662070 2895660088 Bacteria 3782833
421 2897561840 2897561785 Bacteria 3256946
422 2902588526 2902582711 Bacteria 6187705
423 2904432179 2904430863 Bacteria 3486923
424 2904502036 2904501621 Bacteria 3401437
425 2908677857 2908674828 Bacteria 3382763
426 2909076402 2909074476 Bacteria 3436050
427 2915774180 2915768154 Bacteria 8424322
428 2919040322 2919039151 Bacteria 3391018
429 2919044455 2919042368 Bacteria 3905917
430 2919056272 2919055335 Bacteria 3875751
431 2919444697 2919443155 Bacteria 4072969
432 2919526275 2919523602 Bacteria 3788128
433 2928105696 2928104781 Bacteria 3877447
434 2928154407 2928153084 Bacteria 4020257
435 2928502481 2928500415 Bacteria 3384541
436 2929226408 2929219909 Bacteria 6984360
437 2929233112 2929226422 Bacteria 7248583
438 2935412439 2935409751 Bacteria 4179611
439 2939660478 2939657138 Bacteria 3740283
440 2964327893 2964326757 Bacteria 3290868
441 2966926057 2966924647 Bacteria 3268643
442 2984552202 2984551494 Bacteria 3877562
443 2996222816 2996221748 Bacteria 6799777
444 649816363 649633069 Bacteria 6962533
445 8003836212 8003830390 Bacteria 6541657
446 8003860110 8003856774 Bacteria 7675274
447 8003874656 8003870546 Bacteria 7396674
448 8046354575 8046352972 Bacteria 3613806
449 8047719083 8047710418 Bacteria 11023148
450 8054709575 8054704163 Bacteria 7247792
451 8054729118 8054727385 Bacteria 7558670
452 8054740481 8054734606 Bacteria 6947278
453 8055417469 8055412473 Bacteria 6257500
454 8056040419 8056037122 Bacteria 3854319
455 8057346614 8057345674 Bacteria 4160394
456 Ga0316575_10004568
457 JGI24740J21852_10013695
458 JGI24739J22299_10004756
459 JGI25164J39214_1001499
460 JGI25165J46597_1000005
461 Ga0055533_1000002
462 Ga0055525_1000630
463 Ga0055527_1000004
464 Ga0055542_1000019
465 Ga0055529_1000008
466 Ga0065714_10009929
467 Ga0070658_10000380
468 Ga0070658_10028821
469 Ga0070658_10041771
470 Ga0070690_100140798
471 Ga0070682_100111081
472 Ga0068868_100147288
473 Ga0070660_100053744
474 Ga0070661_100148731
475 Ga0070668_100005063
476 Ga0070668_100135120
477 Ga0070668_100138420
478 Ga0070671_100030554
479 Ga0070671_100124005
480 Ga0070659_100022248
481 Ga0070659_100097996
482 Ga0070667_100016686
483 Ga0070667_100021246
484 Ga0070667_100087969
485 Ga0070710_10004155
486 Ga0070684_100105865
487 Ga0068853_100008802
488 Ga0068853_100111035
489 Ga0070665_100131018
490 Ga0068855_100030061
491 Ga0068855_100045411
492 Ga0068857_100001906
493 Ga0068854_100051018
494 Ga0068852_100009235
495 Ga0068852_100035377
496 Ga0068851_10000053
497 Ga0068863_100052942
498 Ga0068858_100000176
499 Ga0081455_10001057
500 Ga0081539_10002979
501 Ga0081539_10004168
502 Ga0081539_10004819
503 Ga0070717_10089057
504 Ga0075365_10007956
505 Ga0075364_10076913
506 Ga0075428_100000567
507 Ga0105240_10005148
508 Ga0105240_10153287
509 Ga0105245_10005554
510 Ga0105247_10065822
511 Ga0105243_10029910
512 Ga0105243_10179369
513 Ga0105241_10000797
514 Ga0105248_10000897
515 Ga0105248_10038783
516 Ga0105237_10004763
517 Ga0105237_10006213
518 Ga0105237_10049224
519 Ga0105238_10000476
520 Ga0105238_10012941
521 Ga0105238_10183607
522 Ga0105238_10290028
523 Ga0105249_10054747
524 Ga0157371_10005769
525 Ga0157371_10061626
526 Ga0157369_10012548
527 Ga0157369_10049996
528 Ga0157375_10460939
529 Ga0163163_10024492
530 Ga0157380_10007733
531 Ga0206356_10714500
532 Ga0206354_11255560
533 Ga0206353_11401675
534 Ga0209566_100056
535 Ga0209674_100001
536 Ga0209672_100011
537 Ga0209147_100289
538 Ga0209563_100001
539 Ga0209563_101759
540 Ga0207427_100024
541 Ga0209437_100243
542 Ga0209677_100001
543 Ga0209677_100271
544 Ga0209148_1000023
545 Ga0209148_1001423
546 Ga0209233_1000001
547 Ga0209455_1000023
548 Ga0209455_1014271
549 Ga0207656_10000001
550 Ga0207688_10076870
551 Ga0207647_10002880
552 Ga0207647_10046832
553 Ga0207705_10000001
554 Ga0207705_10014710
555 Ga0207705_10021403
556 Ga0207705_10025588
557 Ga0207705_10033057
558 Ga0207654_10000001
559 Ga0207695_10002309
560 Ga0207695_10056175
561 Ga0207671_10000001
562 Ga0207671_10003504
563 Ga0207671_10064899
564 Ga0207657_10030411
565 Ga0207657_10037401
566 Ga0207694_10000019
567 Ga0207694_10045565
568 Ga0207687_10010330
569 Ga0207687_10023082
570 Ga0207644_10131353
571 Ga0207644_10194567
572 Ga0207690_10005324
573 Ga0207690_10080573
574 Ga0207709_10013195
575 Ga0207711_10000405
576 Ga0207667_10000498
577 Ga0207667_10029017
578 Ga0207667_10109863
579 Ga0207668_10001446
580 Ga0207668_10020437
581 Ga0207658_10013587
582 Ga0207703_10000121
583 Ga0207702_10015536
584 Ga0207702_10200770
585 Ga0207641_10010075
586 Ga0207641_10070398
587 Ga0207674_10018190
588 Ga0207674_10123332
589 Ga0207698_10000569
590 Ga0207698_10004534
591 Ga0207698_10032129
592 Ga0268266_10176983
593 Ga0307515_10004726
594 Ga0307515_10182915
595 Ga0307511_10002627
596 Ga0307512_10062952
597 Ga0307509_10008875
598 Ga0307509_10112986
599 Ga0307508_10011562
600 Ga0307514_10064224
601 Ga0316579_10012218
602 Ga0316576_10020677
603 Ga0316576_10020994
604 Ga0316576_10039134
605 Ga0316578_10012564
606 Ga0307516_10036802
607 Ga0316577_10033601
608 Ga0307409_100061445
609 Ga0307409_100114806
610 Ga0307409_100134083
611 Ga0307416_100050519
612 Ga0307416_100165812
613 Ga0307416_100275749
614 Ga0307415_100049030
615 Ga0307415_100049061
616 Ga0316585_10000595
617 Ga0307507_10034656
618 Ga0373940_0002064
619 Ga0373942_0000103
620 Ga0316574_0003143
621 Ga0316574_0016515
622 Ga0316574_0079202
623 Ga0316582_0048173
624 Ga0316584_0022311
625 Ga0395899_0012368
626 Ga0395899_0027971
627 Ga0395900_0000888
628 Ga0395900_0008604
629 Ga0395898_0000355
630 Ga0395898_0026345
631 Ga0395898_0229884
632 Ga0316581_0000334
633 Ga0395901_0001579
634 Ga0395901_0019074
635 Ga0395901_0041409
636 Ga0451791_1064226
637 Ga0451793_1372385
638 Ga0451837_0325826
639 Ga0451839_1225663
640 Ga0451841_0160199
641 Ga0451843_0815425
642 Ga0451853_0777022
643 Ga0451853_1209411
644 Ga0466969_0013278
645 Ga0466972_0005899
646 Ga0466965_0000004
647 Ga0466961_0006386
648 Ga0466961_0025225
649 Ga0466961_0037953
650 Ga0466961_0063183
651 Ga0466961_0069532
652 Ga0466963_0008036
653 Ga0466971_0045389
654 Ga0466970_0030763
655 Ga0466960_0029798
656 Ga0466960_0030605
657 Ga0466960_0089770
658 Ga0466959_0045659
659 Ga0466959_0053977
660 Ga0466959_0072950
661 Ga0466958_0050946
662 Ga0495650_0000211
663 Ga0495606_0001892
664 Ga0495632_0009475
665 Ga0495669_0009174
666 Ga0495672_0018755
667 Ga0495615_0004695
668 Ga0496101_0100611
669 Ga0496102_0018028
670 Ga0496102_0117081
671 Ga0496103_0056568
672 Ga0496103_0157371
673 Ga0496104_0024327
674 Ga0496105_0004142
675 Ga0496105_0026874
676 Ga0496108_0000196
677 Ga0496108_0001314
678 Ga0496108_0035420
679 Ga0496108_0086508
680 Ga0496109_0002656
681 Ga0496109_0083919
682 Ga0496110_0000656
683 Ga0496110_0212364
684 Ga0496111_0012380
685 Ga0496111_0065854
686 Ga0496113_0003887
687 Ga0496113_0166370
688 Ga0496114_0003739
689 Ga0496114_0016583
690 Ga0496114_0021592
691 Ga0496115_0137799
692 Ga0496117_0000669
693 Ga0496117_0001906
694 Ga0496117_0021298
695 Ga0496117_0069351
696 Ga0496117_0111557
697 Ga0496118_0000985
698 Ga0496118_0009039
699 Ga0496118_0047099
700 Ga0496119_0000553
701 Ga0496119_0003472
702 Ga0496119_0011186
703 Ga0496119_0039485
704 Ga0496119_0042303
705 Ga0496120_0001113
706 Ga0496120_0003581
707 Ga0496120_0020585
708 Ga0496120_0023193
709 Ga0496120_0054834
710 Ga0496121_0000046
711 Ga0496122_0002574
712 Ga0496122_0004413
713 Ga0496122_0015575
714 Ga0496123_0002281
715 Ga0496123_0026292
716 Ga0496124_0000090
717 Ga0496125_0000046
718 Ga0496126_0002342
719 Ga0501031_0001529
720 Ga0501031_0043332
721 Ga0501032_0001402
722 Ga0501033_0006614
723 Ga0501033_0007015
724 Ga0501033_0008041
725 Ga0501033_0008956
726 Ga0501033_0035165
727 Ga0501034_0004667
728 Ga0501034_0009557
729 Ga0501034_0013703
730 Ga0501034_0034004
731 Ga0501034_0046452
732 Ga0501034_0082754
733 Ga0501034_0083776
734 Ga0501034_0109778
735 Ga0501034_0163169
736 Ga0501034_0190873
737 Ga0501036_0016404
738 Ga0501036_0184470
739 Ga0501036_0218873
740 Ga0501037_0002176
741 Ga0501037_0030393
742 Ga0501037_0043521
743 Ga0501038_0001027
744 Ga0501038_0088093
745 Ga0501039_0011078
746 Ga0501039_0126737
747 Ga0501042_0002934
748 Ga0501042_0095698
749 Ga0501043_0035581
750 Ga0501043_0045364
751 Ga0501043_0101919
752 Ga0501043_0105147
753 Ga0501043_0130392
754 Ga0501043_0139047
755 Ga0501046_0002885
756 Ga0501046_0141330
757 Ga0501047_0037025
758 Ga0501047_0091594
759 Ga0501047_0095003
760 Ga0501047_0105006
761 Ga0501048_0049175
762 Ga0501048_0124195
763 Ga0501070_0000269
764 Ga0501070_0001674
765 Ga0501070_0002327
766 Ga0501070_0007555
767 Ga0501070_0061690
768 Ga0501071_0044176
769 Ga0501073_0000063
770 Ga0501073_0014271
771 Ga0501073_0030405
772 Ga0501073_0133429
773 Ga0501076_0117680
774 Ga0501080_0000331
775 Ga0501080_0208647
776 Ga0501083_0000990
777 Ga0501083_0008270
778 Ga0501035_0001926
779 Ga0501035_0029068
780 Ga0501035_0032143
781 Ga0501035_0032156
782 Ga0501035_0191515
783 Ga0501044_0000521
784 Ga0501044_0016576
785 Ga0501044_0017313
786 Ga0501044_0071565
787 Ga0501045_0085474
788 nmdc:mga00v17_7302_c1
789 nmdc:mga0yw44_1262_c1
790 nmdc:mga0sz30_10808_c1
791 Ga0500635_0000066
792 Ga0500643_000124
793 Ga0500643_000794
794 Ga0500556_0000008
795 Ga0500556_0000527
796 Ga0500562_000180
797 Ga0500652_039988
798 Ga0500655_001913
799 Ga0500559_0000420
800 Ga0500559_0001832
801 Ga0500568_0000003
802 Ga0500568_0000007
803 Ga0500568_0000099
804 Ga0500568_0017214
805 Ga0500573_0000005
806 Ga0500573_0004199
807 Ga0500573_0020760
808 Ga0500573_0023474
809 Ga0500573_0025369
810 Ga0500573_0027563
811 Ga0500573_0053983
812 Ga0500577_0010271
813 Ga0500590_001387
814 Ga0500616_0000010
815 Ga0500616_0000807
816 Ga0500616_0015095
817 Ga0500620_000266
818 Ga0500645_003342
819 2501944871
820 2515498194
821 2515721844
822 2515759415
823 2516084198
824 2516092295
825 2559427977
826 2586065721
827 2587861977
828 2623585772
829 2643767177
830 2643877143
831 2644097408
832 2644112888
833 2644181837
834 2644197576
835 2644384198
836 2723644027
837 2753269733
838 2753303949
839 2772642827
840 2808899906
841 2812363195
842 2831938185
843 2832005328
844 2839988987
845 2844844323
846 2844853623
847 2852644007
848 2852677573
849 2855675129
850 2855679760
851 2855688020
852 2856859655
853 2857294402
854 2857735057
855 2857738779
856 2858854689
857 2858868762
858 2858885250
859 2858891883
860 2858899662
861 2858904902
862 2862994076
863 2866071463
864 2867304702
865 2867318730
866 2867323954
867 2867509988
868 2869052018
869 2869067476
870 2869074770
871 2870625369
872 2880494461
873 2880497843
874 2884767348
875 2895662070
876 2897561840
877 2902588526
878 2904432179
879 2904502036
880 2908677857
881 2909076402
882 2915774180
883 2919040322
884 2919044455
885 2919056272
886 2919444697
887 2919526275
888 2928105696
889 2928154407
890 2928502481
891 2929226408
892 2929233112
893 2935412439
894 2939660478
895 2964327893
896 2966926057
897 2984552202
898 2996222816
899 649816363
900 8003836212
901 8003860110
902 8003874656
903 8046354575
904 8047719083
905 8054709575
906 8054729118
907 8054740481
908 8055417469
909 8056040419
910 8057346614

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00155

Aminotran_1_2

Aminotransferase class I and II

111

472

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vp4-assembly1.cif.gz_B crystal structure of a putative aminotransferase (tm1131) from thermotoga maritima msb8 at 1.82 a resolution 0.9514 18 413
2z1y-assembly1.cif.gz_A crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27 0.9453 17 413
2zp7-assembly3.cif.gz_F crystal structure of lysn, alpha-aminoadipate aminotransferase (leucine complex), from thermus thermophilus hb27 0.9437 17 409
3av7-assembly1.cif.gz_A crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products 0.9358 14 410
2z1y-assembly1.cif.gz_A crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27 0.9358 17 413
ID Description Score Start End Superfamily
2zc0A02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9641 80 300 3.40.640.10
2z1yA01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1;Aspartate Aminotransferase, domain 1 0.9586 306 413 3.90.1150.10
1vp4B02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9517 80 303 3.40.640.10
2dtvA02 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9412 80 302 3.40.640.10
af_Q86AG8_30_465_3.40.640.10 Alpha Beta;3-Layer(aba) Sandwich;Aspartate Aminotransferase; domain 2;Type I PLP-dependent aspartate aminotransferase-like (Major domain) 0.9411 80 413 3.40.640.10
ID Description Score Start End GO Terms
AF-A0A6L6BRQ0-F1-model_v4 deleted 0.9823 24 415
AF-A0A6L6BRQ0-F1-model_v4 deleted 0.9701 24 415
AF-A0A7J9WHI1-F1-model_v4 Aminotransferase class I/II-fold pyridoxal phosphate-dependent enzyme 0.9683 29 419 GO:0008483
GO:0009058
GO:0030170
GO:1901605
AF-R6RNU4-F1-model_v4 Putative phage DNA packaging protein 0.9644 109 409 GO:0008483
GO:0009058
GO:0030170
GO:1901605
AF-A0A0R1FTE0-F1-model_v4 Aminotransferase, class I II 0.9642 35 411 GO:0008483
GO:0009058
GO:0030170
GO:1901605

Map