F447639

General Info

Members Datasets Scaffolds Average Seq Length
455 229 910 295

Family's Representative Sequence

Representative Sequence 3300046472|Ga0495580_0002278|Ga0495580_0002278_9852_10904
Length 350
Sequence MPALRKTAWRGGVSSGKQVSSRVFDGATFEPQTSVPGGTTVDRLTAMETFVCVVESGSFSAAARLLNVGQPAVSKSIAQLEERLAVRLLLRSTRGLTPTEAGHAFYERAKRAIEEADEAEVAARGSAGALSGRLRISAAVTFARIHILPRLQTFLDRHPELNIDIVLDDENIDLLERGIDVALRMGVLGDSNMTARKVGHGRRCVVGTPAWFAKAGEPRVPADLLSHQAIVYEQGGGGSVWSFRQGNSETSIVVAGRVRVNAAEGVRAAVLADMGVAIASEWMFTPELASGAVKRVLPDWELPGIDLWAVFPSGRMVSAKARAFVAWIEEIFGPQIDALPIEAPPSTNNV

Samples

Sample ID Description Type Environment
1 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
2 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
5 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
11 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
12 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
13 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
14 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
19 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
20 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
21 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
22 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
23 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
24 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
25 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
26 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
27 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
28 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
29 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
30 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
31 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
32 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
33 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
34 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
35 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
36 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
37 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
38 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
39 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
40 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
41 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
42 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
43 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
44 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
45 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
46 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
47 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
48 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
49 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
50 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
51 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
61 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
65 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
66 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
67 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
68 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
69 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
70 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
71 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
72 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
73 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
74 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
75 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
78 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
79 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
80 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
81 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
82 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
83 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
84 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
85 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
86 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
87 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
88 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
89 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
90 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
91 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
92 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
93 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
94 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
95 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
96 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
97 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
98 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
99 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
100 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
101 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
102 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
103 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
104 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
105 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
106 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
107 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
108 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
109 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
110 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
111 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
112 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
113 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
114 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
115 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
116 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
117 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
118 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
119 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
120 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
121 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
122 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
123 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
124 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
125 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
126 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
127 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
128 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
129 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
130 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
131 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
132 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
133 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
134 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
135 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
136 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
137 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
138 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
139 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
140 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
141 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
142 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
143 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
144 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
145 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
146 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
147 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
148 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
149 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
150 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
153 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
164 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
165 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
166 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
167 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
168 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
169 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
174 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
183 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
184 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
185 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
186 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
189 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
190 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
191 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
192 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
193 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
194 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
195 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
196 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
197 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
198 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
199 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
200 2511231008 Pseudomonas sp. GM21 Isolate Nodule
201 2511231010 Pseudomonas sp. GM25 Isolate Nodule
202 2511231023 Pseudomonas sp. GM80 Isolate Nodule
203 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
204 2738541297 Duganella sp. GV083 Isolate Unclassified
205 2738541357 Duganella sp. GV053 Isolate Unclassified
206 2738543003 Duganella sp. GV066 Isolate Unclassified
207 2738543026 Duganella sp. GV089 Isolate Unclassified
208 2738543029 Duganella sp. GV039 Isolate Unclassified
209 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
210 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
211 2821131069 Duganella sp. 1224 Isolate Unclassified
212 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
213 2857558681 Duganella sp. R-74565 Isolate Unclassified
214 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
215 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
216 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
217 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
218 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
219 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
220 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
221 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
222 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
223 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
224 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
225 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
226 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
227 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
228 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
229 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.19
Metatranscriptomes 0
Isolates 6.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.59
Nodule 0.88
Rhizoplane 3.08
Rhizosphere 76.26
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495580_0002278 3300046472 Bacteria 16753
2 JGI25155J39150_1000470 3300002704 Bacteria 10098
3 JGI25155J39150_1000570 3300002704 Bacteria 8215
4 JGI25156J39149_1000039 3300002705 Bacteria 107108
5 JGI25162J39368_1002450 3300002737 Bacteria 7195
6 JGI25154J39366_1000059 3300002738 Bacteria 107114
7 JGI25154J39366_1000162 3300002738 Bacteria 51833
8 JGI25157J39369_1000057 3300002741 Bacteria 107108
9 JGI25152J39213_1002578 3300002773 Bacteria 6785
10 rootH2_10285126 3300003320 Bacteria 1740
11 rootH1_10225905 3300003323 Bacteria 1746
12 JGI25407J50210_10034864 3300003373 Bacteria 1297
13 Ga0055532_1000018 3300003758 Bacteria 305466
14 Ga0055535_1003268 3300003761 Bacteria 4715
15 Ga0065165_1001722 3300005262 Bacteria 21921
16 Ga0065714_10003690 3300005288 Bacteria 9561
17 Ga0070658_10001034 3300005327 Bacteria 23804
18 Ga0070667_100102080 3300005367 Bacteria 2478
19 Ga0070663_100272396 3300005455 Bacteria 1346
20 Ga0070662_100102832 3300005457 Bacteria 2165
21 Ga0070665_100232368 3300005548 Bacteria 1844
22 Ga0068855_100054388 3300005563 Bacteria 4705
23 Ga0068855_100456553 3300005563 Bacteria 1394
24 Ga0068854_100006819 3300005578 Bacteria 7282
25 Ga0081455_10008451 3300005937 Bacteria 10705
26 Ga0081538_10005569 3300005981 Bacteria 11304
27 Ga0075362_10288680 3300006177 Unclassified 812
28 Ga0075366_10138575 3300006195 Unclassified 1470
29 Ga0105244_10120551 3300009036 Bacteria 1270
30 Ga0105240_10056446 3300009093 Bacteria 4913
31 Ga0105237_10004327 3300009545 Bacteria 16462
32 Ga0105238_10000869 3300009551 Bacteria 31184
33 Ga0157373_10088364 3300013100 Bacteria 2183
34 Ga0157370_10049460 3300013104 Bacteria 4023
35 Ga0163162_10006360 3300013306 Bacteria 11435
36 Ga0163162_10103974 3300013306 Bacteria 2934
37 Ga0157375_10043208 3300013308 Bacteria 4369
38 Ga0182008_10003299 3300014497 Bacteria 9823
39 Ga0182006_1001179 3300015261 Bacteria 16418
40 Ga0182007_10030937 3300015262 Bacteria 1826
41 Ga0163161_10016829 3300017792 Bacteria 5112
42 Ga0213872_10027967 3300021361 Bacteria 2587
43 Ga0209435_100007 3300025206 Bacteria 516857
44 Ga0209435_100196 3300025206 Bacteria 17747
45 Ga0209147_100017 3300025229 Bacteria 516857
46 Ga0209437_100088 3300025233 Bacteria 251174
47 Ga0209258_100318 3300025242 Bacteria 74657
48 Ga0209646_1000061 3300025246 Bacteria 255495
49 Ga0209646_1000096 3300025246 Bacteria 182388
50 Ga0209026_1000052 3300025250 Bacteria 248897
51 Ga0209026_1006244 3300025250 Bacteria 2971
52 Ga0209148_1000658 3300025254 Bacteria 29762
53 Ga0209759_1000174 3300025256 Bacteria 107149
54 Ga0209759_1000707 3300025256 Bacteria 29735
55 Ga0209129_1000097 3300025258 Bacteria 165504
56 Ga0209455_1009705 3300025272 Bacteria 2507
57 Ga0209025_1000163 3300025294 Bacteria 165492
58 Ga0209051_1072546 3300025303 Bacteria 1029
59 Ga0207695_10002002 3300025913 Bacteria 31431
60 Ga0207671_10067415 3300025914 Bacteria 2665
61 Ga0207649_10062789 3300025920 Bacteria 2343
62 Ga0207694_10002124 3300025924 Bacteria 16322
63 Ga0207706_10118354 3300025933 Bacteria 2330
64 Ga0207667_10004680 3300025949 Bacteria 16750
65 Ga0207667_10034944 3300025949 Bacteria 5395
66 Ga0207667_10092742 3300025949 Bacteria 3119
67 Ga0207640_10065466 3300025981 Bacteria 2425
68 Ga0207658_10079848 3300025986 Bacteria 2504
69 Ga0207678_10292674 3300026067 Bacteria 1399
70 Ga0207428_10000305 3300027907 Bacteria 65062
71 Ga0395899_0000016 3300037312 Bacteria 468322
72 Ga0395899_0005773 3300037312 Bacteria 9606
73 Ga0395899_0065115 3300037312 Bacteria 2679
74 Ga0395899_0115833 3300037312 Bacteria 1923
75 Ga0395900_0011643 3300037418 Bacteria 8998
76 Ga0395900_0078217 3300037418 Bacteria 3398
77 Ga0395900_0117590 3300037418 Bacteria 2727
78 Ga0395900_0172589 3300037418 Bacteria 2200
79 Ga0395898_0002097 3300037466 Bacteria 24778
80 Ga0395905_0001930 3300037471 Bacteria 23804
81 Ga0395905_0012057 3300037471 Bacteria 8331
82 Ga0395905_0013955 3300037471 Bacteria 7683
83 Ga0395901_0106656 3300038443 Bacteria 2940
84 Ga0395901_0274841 3300038443 Bacteria 1751
85 Ga0237819_00652 3300038705 Bacteria 11273
86 Ga0436361_0532127 3300039447 Bacteria 2687
87 Ga0450889_002593 3300042144 Bacteria 1793
88 Ga0450893_0001544 3300042532 Bacteria 3537
89 Ga0495617_000004 3300046452 Bacteria 511274
90 Ga0495617_000573 3300046452 Bacteria 18878
91 Ga0495617_006372 3300046452 Bacteria 4143
92 Ga0495617_009365 3300046452 Bacteria 3361
93 Ga0495617_055506 3300046452 Bacteria 1314
94 Ga0495627_002439 3300046453 Bacteria 8964
95 Ga0495627_019172 3300046453 Bacteria 2298
96 Ga0495627_050213 3300046453 Bacteria 1257
97 Ga0495592_0021591 3300046454 Bacteria 4897
98 Ga0495592_0037804 3300046454 Bacteria 3633
99 Ga0495603_0008824 3300046455 Bacteria 6093
100 Ga0495603_0010017 3300046455 Bacteria 5734
101 Ga0495603_0054839 3300046455 Bacteria 2362
102 Ga0495590_0000132 3300046457 Bacteria 44154
103 Ga0495590_0000390 3300046457 Bacteria 22199
104 Ga0495590_0004502 3300046457 Bacteria 5623
105 Ga0495590_0009833 3300046457 Bacteria 3619
106 Ga0495590_0012986 3300046457 Bacteria 3073
107 Ga0495590_0016620 3300046457 Bacteria 2655
108 Ga0495591_000132 3300046458 Bacteria 81947
109 Ga0495591_001838 3300046458 Bacteria 12517
110 Ga0495591_010753 3300046458 Bacteria 3519
111 Ga0495591_029166 3300046458 Bacteria 1679
112 Ga0495629_0000138 3300046459 Bacteria 63867
113 Ga0495629_0000325 3300046459 Bacteria 40912
114 Ga0495638_0000047 3300046460 Bacteria 216004
115 Ga0495638_0001528 3300046460 Bacteria 20839
116 Ga0495638_0061907 3300046460 Bacteria 2311
117 Ga0495638_0091325 3300046460 Bacteria 1834
118 Ga0495638_0101656 3300046460 Bacteria 1718
119 Ga0495638_0143648 3300046460 Bacteria 1390
120 Ga0495653_0000007 3300046463 Bacteria 314281
121 Ga0495653_0000446 3300046463 Bacteria 32368
122 Ga0495653_0002298 3300046463 Bacteria 15155
123 Ga0495653_0004003 3300046463 Bacteria 11899
124 Ga0495650_0000086 3300046471 Bacteria 235224
125 Ga0495650_0000547 3300046471 Bacteria 53772
126 Ga0495650_0001202 3300046471 Bacteria 27277
127 Ga0495650_0002285 3300046471 Bacteria 15937
128 Ga0495650_0010729 3300046471 Bacteria 5090
129 Ga0495650_0020808 3300046471 Bacteria 3189
130 Ga0495650_0024248 3300046471 Bacteria 2867
131 Ga0495650_0025750 3300046471 Bacteria 2750
132 Ga0495650_0080025 3300046471 Bacteria 1262
133 Ga0495580_0000567 3300046472 Bacteria 31212
134 Ga0495582_0252920 3300046473 Bacteria 1011
135 Ga0495605_0000060 3300046474 Bacteria 145530
136 Ga0495605_0005840 3300046474 Bacteria 7118
137 Ga0495605_0036986 3300046474 Bacteria 2458
138 Ga0495639_0121292 3300046475 Bacteria 1247
139 Ga0495662_0191297 3300046476 Bacteria 1009
140 Ga0495664_0047177 3300046477 Bacteria 2556
141 Ga0495584_0000135 3300046491 Bacteria 50619
142 Ga0495584_0000850 3300046491 Bacteria 19728
143 Ga0495584_0004108 3300046491 Bacteria 7857
144 Ga0495584_0112162 3300046491 Bacteria 1380
145 Ga0495585_0000492 3300046492 Bacteria 37424
146 Ga0495585_0005878 3300046492 Bacteria 7683
147 Ga0495585_0013437 3300046492 Bacteria 4791
148 Ga0495594_0000810 3300046499 Bacteria 16150
149 Ga0495594_0024675 3300046499 Bacteria 3231
150 Ga0495596_0003753 3300046500 Bacteria 7580
151 Ga0495596_0013483 3300046500 Bacteria 3467
152 Ga0495596_0039718 3300046500 Bacteria 1858
153 Ga0495607_0001893 3300046501 Bacteria 17752
154 Ga0495607_0009613 3300046501 Bacteria 6536
155 Ga0495607_0067071 3300046501 Bacteria 2017
156 Ga0495607_0199497 3300046501 Bacteria 991
157 Ga0495583_0000092 3300046506 Bacteria 158865
158 Ga0495583_0000282 3300046506 Bacteria 82063
159 Ga0495583_0001548 3300046506 Bacteria 22788
160 Ga0495583_0002281 3300046506 Bacteria 16780
161 Ga0495583_0002524 3300046506 Bacteria 15494
162 Ga0495583_0007962 3300046506 Bacteria 6557
163 Ga0495606_0000135 3300046507 Bacteria 125830
164 Ga0495606_0000188 3300046507 Bacteria 108100
165 Ga0495606_0000305 3300046507 Bacteria 84602
166 Ga0495606_0001722 3300046507 Bacteria 28126
167 Ga0495606_0004352 3300046507 Bacteria 14211
168 Ga0495606_0004768 3300046507 Bacteria 13335
169 Ga0495606_0011536 3300046507 Bacteria 7197
170 Ga0495606_0030042 3300046507 Bacteria 3803
171 Ga0495606_0048324 3300046507 Bacteria 2800
172 Ga0495606_0050667 3300046507 Bacteria 2714
173 Ga0495606_0060845 3300046507 Bacteria 2417
174 Ga0495606_0122548 3300046507 Bacteria 1554
175 Ga0495610_0000010 3300046512 Bacteria 538821
176 Ga0495610_0000413 3300046512 Bacteria 43813
177 Ga0495610_0002714 3300046512 Bacteria 14573
178 Ga0495610_0008782 3300046512 Bacteria 6483
179 Ga0495610_0096432 3300046512 Bacteria 1331
180 Ga0495616_0002236 3300046513 Bacteria 12958
181 Ga0495616_0005432 3300046513 Bacteria 7848
182 Ga0495616_0020321 3300046513 Bacteria 3615
183 Ga0495616_0022981 3300046513 Bacteria 3360
184 Ga0495618_0119468 3300046514 Bacteria 1688
185 Ga0495620_0000061 3300046515 Bacteria 94469
186 Ga0495620_0008617 3300046515 Bacteria 5469
187 Ga0495628_0095834 3300046516 Bacteria 2292
188 Ga0495628_0152767 3300046516 Bacteria 1757
189 Ga0495628_0191187 3300046516 Bacteria 1545
190 Ga0495630_0036140 3300046517 Bacteria 3692
191 Ga0495631_0002060 3300046518 Bacteria 11721
192 Ga0495631_0011585 3300046518 Bacteria 4332
193 Ga0495631_0012314 3300046518 Bacteria 4183
194 Ga0495631_0040877 3300046518 Bacteria 2053
195 Ga0495631_0125128 3300046518 Bacteria 1105
196 Ga0495632_0000072 3300046519 Bacteria 104826
197 Ga0495637_0000028 3300046520 Bacteria 144203
198 Ga0495637_0000783 3300046520 Bacteria 21362
199 Ga0495637_0006560 3300046520 Bacteria 5824
200 Ga0495637_0021336 3300046520 Bacteria 2972
201 Ga0495643_0000098 3300046522 Bacteria 145645
202 Ga0495643_0040538 3300046522 Bacteria 2543
203 Ga0495644_0004247 3300046523 Bacteria 5626
204 Ga0495644_0004431 3300046523 Bacteria 5515
205 Ga0495648_0000019 3300046524 Bacteria 276407
206 Ga0495648_0001101 3300046524 Bacteria 27484
207 Ga0495648_0002945 3300046524 Bacteria 15279
208 Ga0495648_0005218 3300046524 Bacteria 10869
209 Ga0495648_0031473 3300046524 Bacteria 3492
210 Ga0495648_0042864 3300046524 Bacteria 2843
211 Ga0495648_0055266 3300046524 Bacteria 2394
212 Ga0495648_0143362 3300046524 Bacteria 1254
213 Ga0495648_0148051 3300046524 Bacteria 1227
214 Ga0495666_0000127 3300046526 Bacteria 31925
215 Ga0495642_0001227 3300046528 Bacteria 11786
216 Ga0495642_0007426 3300046528 Bacteria 4201
217 Ga0495654_0002472 3300046530 Bacteria 11886
218 Ga0495654_0007838 3300046530 Bacteria 5938
219 Ga0495654_0015870 3300046530 Bacteria 3992
220 Ga0495665_0029478 3300046531 Bacteria 2939
221 Ga0495640_0076202 3300046533 Bacteria 2238
222 Ga0495587_0012784 3300046536 Bacteria 5280
223 Ga0495609_0000144 3300046538 Bacteria 74360
224 Ga0495609_0000512 3300046538 Bacteria 31250
225 Ga0495609_0005864 3300046538 Bacteria 6367
226 Ga0495609_0006450 3300046538 Bacteria 5982
227 Ga0495609_0027325 3300046538 Bacteria 2608
228 Ga0495597_0000854 3300046542 Bacteria 23949
229 Ga0495645_0005900 3300046543 Bacteria 8458
230 Ga0495645_0038603 3300046543 Bacteria 3483
231 Ga0495622_0000037 3300046557 Bacteria 119690
232 Ga0495622_0075302 3300046557 Bacteria 1555
233 Ga0495633_0000139 3300046558 Bacteria 96799
234 Ga0495633_0000846 3300046558 Bacteria 26772
235 Ga0495633_0004054 3300046558 Bacteria 9468
236 Ga0495668_0000105 3300046616 Bacteria 133981
237 Ga0495668_0000779 3300046616 Bacteria 37172
238 Ga0495668_0004581 3300046616 Bacteria 9725
239 Ga0495668_0010449 3300046616 Bacteria 5617
240 Ga0495668_0076024 3300046616 Bacteria 1844
241 Ga0495634_0002166 3300046642 Bacteria 16535
242 Ga0495634_0016788 3300046642 Bacteria 5229
243 Ga0495634_0242175 3300046642 Bacteria 1106
244 Ga0495611_0000744 3300046648 Bacteria 18344
245 Ga0495611_0006692 3300046648 Bacteria 4904
246 Ga0495611_0052786 3300046648 Bacteria 1834
247 Ga0495625_0000336 3300046660 Bacteria 71606
248 Ga0495625_0000432 3300046660 Bacteria 63013
249 Ga0495625_0003626 3300046660 Bacteria 15146
250 Ga0495625_0006517 3300046660 Bacteria 10371
251 Ga0495625_0067797 3300046660 Bacteria 2510
252 Ga0495625_0248464 3300046660 Bacteria 1155
253 Ga0495659_0001246 3300046664 Bacteria 8797
254 Ga0495659_0032704 3300046664 Bacteria 1822
255 Ga0495661_0000155 3300046665 Bacteria 80777
256 Ga0495661_0001701 3300046665 Bacteria 17826
257 Ga0495661_0012673 3300046665 Bacteria 5690
258 Ga0495661_0036829 3300046665 Bacteria 3059
259 Ga0495661_0147177 3300046665 Bacteria 1275
260 Ga0495588_0075413 3300046674 Bacteria 1757
261 Ga0495588_0115557 3300046674 Bacteria 1414
262 Ga0495599_0001513 3300046678 Bacteria 13381
263 Ga0495623_0183777 3300046679 Bacteria 1212
264 Ga0495646_0031755 3300046680 Bacteria 3289
265 Ga0495646_0145206 3300046680 Bacteria 1323
266 Ga0495613_0010823 3300046689 Bacteria 6767
267 Ga0495613_0033058 3300046689 Bacteria 3843
268 Ga0495624_0000612 3300046690 Bacteria 27861
269 Ga0495670_0018236 3300046691 Bacteria 3455
270 Ga0495671_0000002 3300046692 Bacteria 1136189
271 Ga0495671_0008544 3300046692 Bacteria 5754
272 Ga0495671_0022014 3300046692 Bacteria 3343
273 Ga0495671_0023829 3300046692 Bacteria 3195
274 Ga0495671_0070260 3300046692 Bacteria 1720
275 Ga0495649_0000185 3300046694 Bacteria 54619
276 Ga0495649_0010785 3300046694 Bacteria 5383
277 Ga0495649_0018046 3300046694 Bacteria 3975
278 Ga0495649_0027136 3300046694 Bacteria 3178
279 Ga0495589_0000509 3300046794 Bacteria 27368
280 Ga0495589_0009984 3300046794 Bacteria 4933
281 Ga0495589_0126474 3300046794 Bacteria 1229
282 Ga0495600_0104232 3300046809 Bacteria 1848
283 Ga0495660_0002602 3300046810 Bacteria 11466
284 Ga0495660_0003147 3300046810 Bacteria 10280
285 Ga0495660_0007443 3300046810 Bacteria 6429
286 Ga0495660_0010453 3300046810 Bacteria 5399
287 Ga0495660_0013495 3300046810 Bacteria 4733
288 Ga0495660_0028160 3300046810 Bacteria 3176
289 Ga0495660_0028867 3300046810 Bacteria 3132
290 Ga0495660_0119375 3300046810 Bacteria 1336
291 Ga0495660_0119562 3300046810 Bacteria 1334
292 Ga0495581_0001090 3300047315 Bacteria 14779
293 Ga0495604_0000888 3300047317 Bacteria 24870
294 Ga0495636_0004010 3300047318 Bacteria 5755
295 Ga0495674_0016585 3300047319 Bacteria 6873
296 Ga0495674_0035058 3300047319 Bacteria 4530
297 Ga0495674_0087710 3300047319 Bacteria 2662
298 Ga0495672_0000166 3300047320 Bacteria 95954
299 Ga0495672_0000305 3300047320 Bacteria 66204
300 Ga0495672_0000588 3300047320 Bacteria 41086
301 Ga0495676_0012631 3300047321 Bacteria 7601
302 Ga0495676_0022495 3300047321 Bacteria 5482
303 Ga0495680_0009564 3300047322 Bacteria 8709
304 Ga0495680_0027295 3300047322 Bacteria 4692
305 Ga0495683_0000020 3300047323 Bacteria 181773
306 Ga0495683_0000263 3300047323 Bacteria 47152
307 Ga0495683_0008731 3300047323 Bacteria 5407
308 Ga0495683_0048906 3300047323 Bacteria 2119
309 Ga0495687_001244 3300047443 Bacteria 24274
310 Ga0495687_014424 3300047443 Bacteria 4069
311 Ga0495675_0016754 3300047444 Bacteria 4634
312 Ga0495675_0117075 3300047444 Bacteria 1661
313 Ga0495677_0000193 3300047445 Bacteria 28150
314 Ga0495677_0013391 3300047445 Bacteria 2985
315 Ga0495677_0015997 3300047445 Bacteria 2723
316 Ga0495677_0029908 3300047445 Bacteria 1981
317 Ga0495679_000036 3300047446 Bacteria 161473
318 Ga0495679_000124 3300047446 Bacteria 68362
319 Ga0495679_006475 3300047446 Bacteria 5030
320 Ga0495679_012930 3300047446 Bacteria 3155
321 Ga0495679_033944 3300047446 Bacteria 1626
322 Ga0495685_000598 3300047447 Bacteria 11120
323 Ga0495673_0000005 3300047469 Bacteria 943364
324 Ga0495673_0000026 3300047469 Bacteria 476378
325 Ga0495673_0000121 3300047469 Bacteria 144619
326 Ga0495673_0003276 3300047469 Bacteria 10782
327 Ga0495673_0009248 3300047469 Bacteria 5468
328 Ga0495673_0027084 3300047469 Bacteria 2732
329 Ga0495681_0007618 3300047470 Bacteria 6886
330 Ga0495681_0009582 3300047470 Bacteria 5948
331 Ga0495681_0015824 3300047470 Bacteria 4256
332 Ga0495681_0018946 3300047470 Bacteria 3775
333 Ga0495681_0127266 3300047470 Bacteria 1087
334 Ga0495684_0025451 3300047471 Bacteria 4547
335 Ga0495684_0079102 3300047471 Bacteria 2496
336 Ga0495686_0000080 3300047472 Bacteria 201665
337 Ga0495686_0000768 3300047472 Bacteria 42318
338 Ga0495686_0000793 3300047472 Bacteria 41237
339 Ga0495686_0028554 3300047472 Bacteria 3632
340 Ga0495686_0035986 3300047472 Bacteria 3178
341 Ga0495686_0038656 3300047472 Bacteria 3051
342 Ga0495593_0008248 3300047673 Bacteria 6062
343 Ga0495593_0030838 3300047673 Bacteria 2931
344 Ga0495602_0066127 3300048088 Bacteria 3116
345 Ga0495614_0003092 3300048089 Bacteria 7413
346 Ga0495626_0000048 3300048091 Bacteria 161634
347 Ga0495626_0014343 3300048091 Bacteria 4092
348 Ga0495626_0078847 3300048091 Bacteria 1466
349 Ga0495626_0140061 3300048091 Bacteria 1026
350 Ga0496100_0052388 3300048903 Bacteria 2653
351 Ga0496101_0027253 3300048904 Bacteria 3979
352 Ga0496101_0045161 3300048904 Bacteria 3155
353 Ga0496102_0008795 3300048905 Bacteria 8661
354 Ga0496102_0128878 3300048905 Bacteria 2366
355 Ga0496102_0145001 3300048905 Bacteria 2228
356 Ga0496103_0114664 3300048906 Bacteria 1713
357 Ga0496104_0169541 3300048907 Bacteria 2093
358 Ga0496106_0006183 3300048909 Bacteria 8853
359 Ga0496106_0153669 3300048909 Bacteria 1816
360 Ga0496107_0081282 3300048910 Bacteria 2363
361 Ga0496110_0081353 3300048913 Bacteria 2887
362 Ga0496114_0227968 3300048917 Bacteria 1636
363 Ga0496115_0165299 3300048918 Bacteria 1830
364 Ga0496117_0004142 3300048920 Bacteria 16215
365 Ga0496117_0018532 3300048920 Bacteria 5760
366 Ga0496117_0109336 3300048920 Bacteria 1726
367 Ga0496118_0020013 3300048921 Bacteria 5955
368 Ga0496120_0174904 3300048923 Bacteria 1059
369 Ga0496121_0000201 3300048924 Bacteria 131246
370 Ga0496121_0001787 3300048924 Bacteria 34789
371 Ga0496121_0027822 3300048924 Bacteria 5280
372 Ga0496121_0071380 3300048924 Bacteria 2793
373 Ga0496121_0173257 3300048924 Bacteria 1565
374 Ga0496122_0011533 3300048925 Bacteria 8938
375 Ga0496122_0056229 3300048925 Bacteria 2935
376 Ga0496123_0009364 3300048926 Bacteria 8829
377 Ga0496123_0018831 3300048926 Bacteria 5471
378 Ga0496124_0018152 3300048927 Bacteria 6601
379 Ga0496124_0065961 3300048927 Bacteria 3016
380 Ga0496125_0000569 3300048928 Bacteria 63317
381 Ga0496125_0038016 3300048928 Bacteria 4175
382 Ga0496125_0127971 3300048928 Bacteria 1795
383 Ga0496126_0000105 3300048929 Bacteria 198893
384 Ga0496126_0017671 3300048929 Bacteria 7104
385 Ga0496126_0039211 3300048929 Bacteria 4398
386 Ga0496126_0045753 3300048929 Bacteria 4020
387 Ga0495678_000077 3300049459 Bacteria 125025
388 Ga0495678_000188 3300049459 Bacteria 72283
389 Ga0495678_000445 3300049459 Bacteria 41172
390 Ga0495678_001769 3300049459 Bacteria 16004
391 Ga0495678_002973 3300049459 Bacteria 10811
392 Ga0495678_009328 3300049459 Bacteria 4864
393 Ga0495678_011197 3300049459 Bacteria 4309
394 Ga0495678_016535 3300049459 Bacteria 3369
395 Ga0495678_029748 3300049459 Bacteria 2291
396 Ga0495682_0001392 3300049460 Bacteria 13194
397 Ga0495682_0004259 3300049460 Bacteria 6184
398 Ga0495682_0044615 3300049460 Bacteria 1621
399 Ga0501031_0109363 3300049568 Bacteria 1805
400 Ga0501032_0114853 3300049569 Bacteria 1780
401 Ga0501043_0086494 3300049579 Bacteria 2463
402 Ga0501046_0197312 3300049580 Bacteria 1499
403 Ga0501047_0043344 3300049581 Bacteria 4346
404 Ga0501047_0044827 3300049581 Bacteria 4274
405 Ga0501070_0341332 3300049586 Bacteria 1217
406 Ga0501035_0118187 3300049822 Bacteria 2319
407 Ga0501035_0330547 3300049822 Bacteria 1279
408 Ga0501044_0126870 3300049823 Bacteria 2548
409 nmdc:mga03683_256922_c1 3300050489 Unclassified 812
410 nmdc:mga0k408_117141_c1 3300050493 Unclassified 1576
411 nmdc:mga06z11_16192_c1 3300050494 Bacteria 3351
412 nmdc:mga07m45_1375_c1 3300050496 Bacteria 11088
413 nmdc:mga08y16_33_c1 3300050511 Bacteria 172528
414 Ga0500647_0093300 3300053091 Bacteria 1440
415 Ga0500566_0007836 3300053094 Bacteria 6327
416 Ga0500640_000992 3300053095 Bacteria 8092
417 Ga0500554_000417 3300053102 Bacteria 9012
418 Ga0500572_008539 3300053111 Bacteria 2399
419 Ga0500595_000964 3300053119 Bacteria 16184
420 Ga0500597_079295 3300053120 Bacteria 1424
421 Ga0500614_000185 3300053123 Bacteria 16111
422 Ga0500618_000167 3300053125 Bacteria 54849
423 Ga0500559_0002619 3300053136 Bacteria 9187
424 Ga0500586_002112 3300053145 Bacteria 4397
425 2511252310 2511231003 Bacteria 5606035
426 2511278633 2511231008 Bacteria 6624100
427 2511292551 2511231010 Bacteria 6373152
428 2511370078 2511231023 Bacteria 6808468
429 2512032796 2511231221 Bacteria 6846400
430 2738829072 2738541297 Bacteria 6549566
431 2739152868 2738541357 Bacteria 6549408
432 2739194788 2738543003 Bacteria 6549560
433 2739321264 2738543026 Bacteria 6549408
434 2739339505 2738543029 Bacteria 6549249
435 2819594196 2818991445 Bacteria 4955017
436 2819617842 2818991449 Bacteria 5518009
437 2821134302 2821131069 Bacteria 6108407
438 2821450009 2821443989 Bacteria 7658172
439 2857563230 2857558681 Bacteria 6617694
440 2884813270 2884811622 Bacteria 5552861
441 2884839526 2884836552 Bacteria 5219991
442 2884856664 2884852848 Bacteria 5221161
443 2896158010 2896154374 Bacteria 5221518
444 2902409394 2902405164 Bacteria 6784948
445 2904443485 2904439833 Bacteria 5931679
446 2904532466 2904530477 Bacteria 5876334
447 2904584936 2904584206 Bacteria 6028872
448 2904591458 2904589729 Bacteria 6113573
449 2904605480 2904601388 Bacteria 5884906
450 2919081253 2919079590 Bacteria 5946433
451 3003671728 3003665799 Bacteria 7279786
452 3007617593 3007614139 Bacteria 6053559
453 3007723333 3007718800 Bacteria 5971527
454 8047676766 8047673197 Bacteria 7395230
455 8056175562 8056172158 Bacteria 6133900
456 Ga0495580_0002278
457 JGI25155J39150_1000470
458 JGI25155J39150_1000570
459 JGI25156J39149_1000039
460 JGI25162J39368_1002450
461 JGI25154J39366_1000059
462 JGI25154J39366_1000162
463 JGI25157J39369_1000057
464 JGI25152J39213_1002578
465 rootH2_10285126
466 rootH1_10225905
467 JGI25407J50210_10034864
468 Ga0055532_1000018
469 Ga0055535_1003268
470 Ga0065165_1001722
471 Ga0065714_10003690
472 Ga0070658_10001034
473 Ga0070667_100102080
474 Ga0070663_100272396
475 Ga0070662_100102832
476 Ga0070665_100232368
477 Ga0068855_100054388
478 Ga0068855_100456553
479 Ga0068854_100006819
480 Ga0081455_10008451
481 Ga0081538_10005569
482 Ga0075362_10288680
483 Ga0075366_10138575
484 Ga0105244_10120551
485 Ga0105240_10056446
486 Ga0105237_10004327
487 Ga0105238_10000869
488 Ga0157373_10088364
489 Ga0157370_10049460
490 Ga0163162_10006360
491 Ga0163162_10103974
492 Ga0157375_10043208
493 Ga0182008_10003299
494 Ga0182006_1001179
495 Ga0182007_10030937
496 Ga0163161_10016829
497 Ga0213872_10027967
498 Ga0209435_100007
499 Ga0209435_100196
500 Ga0209147_100017
501 Ga0209437_100088
502 Ga0209258_100318
503 Ga0209646_1000061
504 Ga0209646_1000096
505 Ga0209026_1000052
506 Ga0209026_1006244
507 Ga0209148_1000658
508 Ga0209759_1000174
509 Ga0209759_1000707
510 Ga0209129_1000097
511 Ga0209455_1009705
512 Ga0209025_1000163
513 Ga0209051_1072546
514 Ga0207695_10002002
515 Ga0207671_10067415
516 Ga0207649_10062789
517 Ga0207694_10002124
518 Ga0207706_10118354
519 Ga0207667_10004680
520 Ga0207667_10034944
521 Ga0207667_10092742
522 Ga0207640_10065466
523 Ga0207658_10079848
524 Ga0207678_10292674
525 Ga0207428_10000305
526 Ga0395899_0000016
527 Ga0395899_0005773
528 Ga0395899_0065115
529 Ga0395899_0115833
530 Ga0395900_0011643
531 Ga0395900_0078217
532 Ga0395900_0117590
533 Ga0395900_0172589
534 Ga0395898_0002097
535 Ga0395905_0001930
536 Ga0395905_0012057
537 Ga0395905_0013955
538 Ga0395901_0106656
539 Ga0395901_0274841
540 Ga0237819_00652
541 Ga0436361_0532127
542 Ga0450889_002593
543 Ga0450893_0001544
544 Ga0495617_000004
545 Ga0495617_000573
546 Ga0495617_006372
547 Ga0495617_009365
548 Ga0495617_055506
549 Ga0495627_002439
550 Ga0495627_019172
551 Ga0495627_050213
552 Ga0495592_0021591
553 Ga0495592_0037804
554 Ga0495603_0008824
555 Ga0495603_0010017
556 Ga0495603_0054839
557 Ga0495590_0000132
558 Ga0495590_0000390
559 Ga0495590_0004502
560 Ga0495590_0009833
561 Ga0495590_0012986
562 Ga0495590_0016620
563 Ga0495591_000132
564 Ga0495591_001838
565 Ga0495591_010753
566 Ga0495591_029166
567 Ga0495629_0000138
568 Ga0495629_0000325
569 Ga0495638_0000047
570 Ga0495638_0001528
571 Ga0495638_0061907
572 Ga0495638_0091325
573 Ga0495638_0101656
574 Ga0495638_0143648
575 Ga0495653_0000007
576 Ga0495653_0000446
577 Ga0495653_0002298
578 Ga0495653_0004003
579 Ga0495650_0000086
580 Ga0495650_0000547
581 Ga0495650_0001202
582 Ga0495650_0002285
583 Ga0495650_0010729
584 Ga0495650_0020808
585 Ga0495650_0024248
586 Ga0495650_0025750
587 Ga0495650_0080025
588 Ga0495580_0000567
589 Ga0495582_0252920
590 Ga0495605_0000060
591 Ga0495605_0005840
592 Ga0495605_0036986
593 Ga0495639_0121292
594 Ga0495662_0191297
595 Ga0495664_0047177
596 Ga0495584_0000135
597 Ga0495584_0000850
598 Ga0495584_0004108
599 Ga0495584_0112162
600 Ga0495585_0000492
601 Ga0495585_0005878
602 Ga0495585_0013437
603 Ga0495594_0000810
604 Ga0495594_0024675
605 Ga0495596_0003753
606 Ga0495596_0013483
607 Ga0495596_0039718
608 Ga0495607_0001893
609 Ga0495607_0009613
610 Ga0495607_0067071
611 Ga0495607_0199497
612 Ga0495583_0000092
613 Ga0495583_0000282
614 Ga0495583_0001548
615 Ga0495583_0002281
616 Ga0495583_0002524
617 Ga0495583_0007962
618 Ga0495606_0000135
619 Ga0495606_0000188
620 Ga0495606_0000305
621 Ga0495606_0001722
622 Ga0495606_0004352
623 Ga0495606_0004768
624 Ga0495606_0011536
625 Ga0495606_0030042
626 Ga0495606_0048324
627 Ga0495606_0050667
628 Ga0495606_0060845
629 Ga0495606_0122548
630 Ga0495610_0000010
631 Ga0495610_0000413
632 Ga0495610_0002714
633 Ga0495610_0008782
634 Ga0495610_0096432
635 Ga0495616_0002236
636 Ga0495616_0005432
637 Ga0495616_0020321
638 Ga0495616_0022981
639 Ga0495618_0119468
640 Ga0495620_0000061
641 Ga0495620_0008617
642 Ga0495628_0095834
643 Ga0495628_0152767
644 Ga0495628_0191187
645 Ga0495630_0036140
646 Ga0495631_0002060
647 Ga0495631_0011585
648 Ga0495631_0012314
649 Ga0495631_0040877
650 Ga0495631_0125128
651 Ga0495632_0000072
652 Ga0495637_0000028
653 Ga0495637_0000783
654 Ga0495637_0006560
655 Ga0495637_0021336
656 Ga0495643_0000098
657 Ga0495643_0040538
658 Ga0495644_0004247
659 Ga0495644_0004431
660 Ga0495648_0000019
661 Ga0495648_0001101
662 Ga0495648_0002945
663 Ga0495648_0005218
664 Ga0495648_0031473
665 Ga0495648_0042864
666 Ga0495648_0055266
667 Ga0495648_0143362
668 Ga0495648_0148051
669 Ga0495666_0000127
670 Ga0495642_0001227
671 Ga0495642_0007426
672 Ga0495654_0002472
673 Ga0495654_0007838
674 Ga0495654_0015870
675 Ga0495665_0029478
676 Ga0495640_0076202
677 Ga0495587_0012784
678 Ga0495609_0000144
679 Ga0495609_0000512
680 Ga0495609_0005864
681 Ga0495609_0006450
682 Ga0495609_0027325
683 Ga0495597_0000854
684 Ga0495645_0005900
685 Ga0495645_0038603
686 Ga0495622_0000037
687 Ga0495622_0075302
688 Ga0495633_0000139
689 Ga0495633_0000846
690 Ga0495633_0004054
691 Ga0495668_0000105
692 Ga0495668_0000779
693 Ga0495668_0004581
694 Ga0495668_0010449
695 Ga0495668_0076024
696 Ga0495634_0002166
697 Ga0495634_0016788
698 Ga0495634_0242175
699 Ga0495611_0000744
700 Ga0495611_0006692
701 Ga0495611_0052786
702 Ga0495625_0000336
703 Ga0495625_0000432
704 Ga0495625_0003626
705 Ga0495625_0006517
706 Ga0495625_0067797
707 Ga0495625_0248464
708 Ga0495659_0001246
709 Ga0495659_0032704
710 Ga0495661_0000155
711 Ga0495661_0001701
712 Ga0495661_0012673
713 Ga0495661_0036829
714 Ga0495661_0147177
715 Ga0495588_0075413
716 Ga0495588_0115557
717 Ga0495599_0001513
718 Ga0495623_0183777
719 Ga0495646_0031755
720 Ga0495646_0145206
721 Ga0495613_0010823
722 Ga0495613_0033058
723 Ga0495624_0000612
724 Ga0495670_0018236
725 Ga0495671_0000002
726 Ga0495671_0008544
727 Ga0495671_0022014
728 Ga0495671_0023829
729 Ga0495671_0070260
730 Ga0495649_0000185
731 Ga0495649_0010785
732 Ga0495649_0018046
733 Ga0495649_0027136
734 Ga0495589_0000509
735 Ga0495589_0009984
736 Ga0495589_0126474
737 Ga0495600_0104232
738 Ga0495660_0002602
739 Ga0495660_0003147
740 Ga0495660_0007443
741 Ga0495660_0010453
742 Ga0495660_0013495
743 Ga0495660_0028160
744 Ga0495660_0028867
745 Ga0495660_0119375
746 Ga0495660_0119562
747 Ga0495581_0001090
748 Ga0495604_0000888
749 Ga0495636_0004010
750 Ga0495674_0016585
751 Ga0495674_0035058
752 Ga0495674_0087710
753 Ga0495672_0000166
754 Ga0495672_0000305
755 Ga0495672_0000588
756 Ga0495676_0012631
757 Ga0495676_0022495
758 Ga0495680_0009564
759 Ga0495680_0027295
760 Ga0495683_0000020
761 Ga0495683_0000263
762 Ga0495683_0008731
763 Ga0495683_0048906
764 Ga0495687_001244
765 Ga0495687_014424
766 Ga0495675_0016754
767 Ga0495675_0117075
768 Ga0495677_0000193
769 Ga0495677_0013391
770 Ga0495677_0015997
771 Ga0495677_0029908
772 Ga0495679_000036
773 Ga0495679_000124
774 Ga0495679_006475
775 Ga0495679_012930
776 Ga0495679_033944
777 Ga0495685_000598
778 Ga0495673_0000005
779 Ga0495673_0000026
780 Ga0495673_0000121
781 Ga0495673_0003276
782 Ga0495673_0009248
783 Ga0495673_0027084
784 Ga0495681_0007618
785 Ga0495681_0009582
786 Ga0495681_0015824
787 Ga0495681_0018946
788 Ga0495681_0127266
789 Ga0495684_0025451
790 Ga0495684_0079102
791 Ga0495686_0000080
792 Ga0495686_0000768
793 Ga0495686_0000793
794 Ga0495686_0028554
795 Ga0495686_0035986
796 Ga0495686_0038656
797 Ga0495593_0008248
798 Ga0495593_0030838
799 Ga0495602_0066127
800 Ga0495614_0003092
801 Ga0495626_0000048
802 Ga0495626_0014343
803 Ga0495626_0078847
804 Ga0495626_0140061
805 Ga0496100_0052388
806 Ga0496101_0027253
807 Ga0496101_0045161
808 Ga0496102_0008795
809 Ga0496102_0128878
810 Ga0496102_0145001
811 Ga0496103_0114664
812 Ga0496104_0169541
813 Ga0496106_0006183
814 Ga0496106_0153669
815 Ga0496107_0081282
816 Ga0496110_0081353
817 Ga0496114_0227968
818 Ga0496115_0165299
819 Ga0496117_0004142
820 Ga0496117_0018532
821 Ga0496117_0109336
822 Ga0496118_0020013
823 Ga0496120_0174904
824 Ga0496121_0000201
825 Ga0496121_0001787
826 Ga0496121_0027822
827 Ga0496121_0071380
828 Ga0496121_0173257
829 Ga0496122_0011533
830 Ga0496122_0056229
831 Ga0496123_0009364
832 Ga0496123_0018831
833 Ga0496124_0018152
834 Ga0496124_0065961
835 Ga0496125_0000569
836 Ga0496125_0038016
837 Ga0496125_0127971
838 Ga0496126_0000105
839 Ga0496126_0017671
840 Ga0496126_0039211
841 Ga0496126_0045753
842 Ga0495678_000077
843 Ga0495678_000188
844 Ga0495678_000445
845 Ga0495678_001769
846 Ga0495678_002973
847 Ga0495678_009328
848 Ga0495678_011197
849 Ga0495678_016535
850 Ga0495678_029748
851 Ga0495682_0001392
852 Ga0495682_0004259
853 Ga0495682_0044615
854 Ga0501031_0109363
855 Ga0501032_0114853
856 Ga0501043_0086494
857 Ga0501046_0197312
858 Ga0501047_0043344
859 Ga0501047_0044827
860 Ga0501070_0341332
861 Ga0501035_0118187
862 Ga0501035_0330547
863 Ga0501044_0126870
864 nmdc:mga03683_256922_c1
865 nmdc:mga0k408_117141_c1
866 nmdc:mga06z11_16192_c1
867 nmdc:mga07m45_1375_c1
868 nmdc:mga08y16_33_c1
869 Ga0500647_0093300
870 Ga0500566_0007836
871 Ga0500640_000992
872 Ga0500554_000417
873 Ga0500572_008539
874 Ga0500595_000964
875 Ga0500597_079295
876 Ga0500614_000185
877 Ga0500618_000167
878 Ga0500559_0002619
879 Ga0500586_002112
880 2511252310
881 2511278633
882 2511292551
883 2511370078
884 2512032796
885 2738829072
886 2739152868
887 2739194788
888 2739321264
889 2739339505
890 2819594196
891 2819617842
892 2821134302
893 2821450009
894 2857563230
895 2884813270
896 2884839526
897 2884856664
898 2896158010
899 2902409394
900 2904443485
901 2904532466
902 2904584936
903 2904591458
904 2904605480
905 2919081253
906 3003671728
907 3007617593
908 3007723333
909 8047676766
910 8056175562

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03466

LysR_substrate

LysR substrate binding domain

127

333

0.98

PF00126

HTH_1

Bacterial regulatory helix-turn-helix protein, lysR family

44

103

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ihs-assembly1.cif.gz_B crystal structure of benm_dbd/catb site 1 dna complex 0.9696 3 84
4iht-assembly2.cif.gz_C crystal structure of benm_dbd/bena site 1 dna complex 0.9545 3 87
4ihs-assembly1.cif.gz_A crystal structure of benm_dbd/catb site 1 dna complex 0.9481 3 90
4ihs-assembly3.cif.gz_C crystal structure of benm_dbd/catb site 1 dna complex 0.9447 3 90
5xxp-assembly1.cif.gz_B crystal structure of cbnr_dbd-dna complex 0.9432 3 86
ID Description Score Start End Superfamily
af_P45463_8_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9883 5 85 1.10.10.10
af_P30864_1_87_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9797 4 85 1.10.10.10
af_Q57748_4_88_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9763 3 86 1.10.10.10
af_P77171_5_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.976 3 82 1.10.10.10
3fzvC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9751 4 74 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A258CPL3-F1-model_v4 LysR family transcriptional regulator 0.9865 1 83 GO:0003700
GO:0006351
GO:0043565
AF-A0A833KNX1-F1-model_v4 deleted 0.9725 3 74
AF-A0A553ZST6-F1-model_v4 LysR family transcriptional regulator 0.9715 1 80 GO:0003700
GO:0006351
GO:0043565
AF-A0A658JMP9-F1-model_v4 deleted 0.9665 1 80
AF-A0A6I5XAC4-F1-model_v4 LysR family transcriptional regulator 0.9652 1 85 GO:0000976
GO:0003700

Map