F447644

General Info

Members Datasets Scaffolds Average Seq Length
455 159 910 355

Family's Representative Sequence

Representative Sequence 3300046492|Ga0495585_0000277|Ga0495585_0000277_24071_25264
Length 397
Sequence LAPQALERALTDKAFRPLAAALRGAVECLSFQSQVPPMSEYVLTRVANGTGVITLDRPKALNSLSLDMVRSLTGVLLSWRDDPSVAAVVITSTSEKALCAGGDIRFFHEAGHAAPTGGSALLEDFFTEEYALNHLIHFYPKPYIALMDGVVMGGGMGIAQGGPGCGLRIVTDRTKMAMPEVNIGLFPDVGGSHFLSHAPGRLGDYLGLTGLTIGAADALYVGLADVFVPGAQLPALKALFDTTPGAQLAQAIRDFGAQFTGQVGASELQAQRALVDRHFGAGSVDAVMQSLGGDASAFAQKALAAMRQRSPLMMCVTREMLVRGASLDVADCLRMERSLVRRNFEHGEVLEGVRALVIDKDNAPKWNPPAIEQVTPDMVARFFEPVWPAWAHPLRHL

Samples

Sample ID Description Type Environment
1 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
8 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
9 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
10 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
21 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
22 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
23 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
24 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
25 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
26 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
27 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
28 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
29 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
30 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
31 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
32 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
33 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
34 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
35 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
36 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
38 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
39 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
40 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
44 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
45 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
46 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
49 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
50 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
51 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
52 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
53 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
54 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
55 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
56 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
57 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
58 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
59 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
60 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
61 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
62 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
63 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
64 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
65 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
66 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
67 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
68 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
69 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
70 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
71 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
72 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
73 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
74 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
75 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
76 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
77 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
78 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
79 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
80 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
81 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
82 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
83 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
84 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
85 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
86 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
87 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
88 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
89 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
90 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
91 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
92 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
93 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
94 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
95 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
96 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
97 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
98 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
99 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
100 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
101 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
102 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
103 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
104 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
105 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
106 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
107 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
108 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
109 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
110 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
111 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
112 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
113 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
114 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
115 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
116 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
117 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
118 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
119 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
120 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
121 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
122 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
123 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
124 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
125 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
126 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
127 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
128 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
129 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
130 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
131 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
132 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
133 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
134 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
135 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
136 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
137 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
138 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
139 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
140 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
141 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
142 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
143 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
144 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
145 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
147 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
148 2643221556 Massilia sp. Root1485 Isolate Unclassified
149 2643221638 Duganella sp. Root336D2 Isolate Unclassified
150 2643221645 Massilia sp. Root351 Isolate Unclassified
151 2643221664 Massilia sp. Root418 Isolate Unclassified
152 2643221684 Massilia sp. Root133 Isolate Unclassified
153 2738541280 Massilia sp. GV090 Isolate Unclassified
154 2738541300 Massilia sp. GV016 Isolate Unclassified
155 2738543018 Massilia sp. GV045 Isolate Unclassified
156 2738543030 Massilia sp. GV097 Isolate Unclassified
157 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
158 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
159 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.14
Metatranscriptomes 0
Isolates 2.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.07
Nodule 0.44
Rhizoplane 2.42
Rhizosphere 78.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495585_0000277 3300046492 Bacteria 51354
2 JGI25158J39367_1001693 3300002739 Bacteria 3780
3 JGI25152J39213_1000641 3300002773 Bacteria 18513
4 JGI25150J39212_1003457 3300002774 Bacteria 3692
5 JGI25159J45721_1002616 3300002987 Bacteria 6736
6 JGI25159J45721_1002963 3300002987 Bacteria 6177
7 JGI25161J50226_1001549 3300003374 Bacteria 6744
8 Ga0055526_1004432 3300003771 Bacteria 8438
9 Ga0055526_1011899 3300003771 Bacteria 3859
10 Ga0055526_1023229 3300003771 Bacteria 2076
11 Ga0055537_1000038 3300003773 Bacteria 92762
12 Ga0055537_1005582 3300003773 Bacteria 3348
13 Ga0055524_1000024 3300003775 Bacteria 217953
14 Ga0055524_1007172 3300003775 Bacteria 4769
15 Ga0055524_1008299 3300003775 Bacteria 4325
16 Ga0055524_1011583 3300003775 Bacteria 3440
17 Ga0055534_1000893 3300003784 Bacteria 13525
18 Ga0055528_1000252 3300003790 Bacteria 45454
19 Ga0055528_1002464 3300003790 Bacteria 9901
20 Ga0055530_10003976 3300003791 Bacteria 7980
21 Ga0055530_10007657 3300003791 Bacteria 4500
22 Ga0055530_10008022 3300003791 Bacteria 4309
23 Ga0058692_1011371 3300003856 Bacteria 2156
24 Ga0055543_1001901 3300004625 Bacteria 7531
25 Ga0055543_1002088 3300004625 Bacteria 6956
26 Ga0065165_1000379 3300005262 Bacteria 72513
27 Ga0065165_1000936 3300005262 Bacteria 37330
28 Ga0065165_1005606 3300005262 Bacteria 6956
29 Ga0070658_10093776 3300005327 Bacteria 2476
30 Ga0070660_100080492 3300005339 Bacteria 2556
31 Ga0070659_100088112 3300005366 Bacteria 2485
32 Ga0068855_100034686 3300005563 Bacteria 6014
33 Ga0099826_10000010 3300006948 Bacteria 314346
34 Ga0105241_10030573 3300009174 Bacteria 4027
35 Ga0157373_10059000 3300013100 Bacteria 2719
36 Ga0157373_10068338 3300013100 Bacteria 2511
37 Ga0157371_10076662 3300013102 Bacteria 2367
38 Ga0157372_10309450 3300013307 Bacteria 1838
39 Ga0182006_1013381 3300015261 Bacteria 3562
40 Ga0209436_101767 3300025208 Bacteria 7092
41 Ga0209436_108396 3300025208 Bacteria 2061
42 Ga0207425_1000021 3300025245 Bacteria 367537
43 Ga0207425_1000610 3300025245 Bacteria 20639
44 Ga0209148_1001902 3300025254 Bacteria 8554
45 Ga0209129_1000020 3300025258 Bacteria 457053
46 Ga0209129_1002800 3300025258 Bacteria 8109
47 Ga0209565_1000123 3300025263 Bacteria 111069
48 Ga0209565_1001251 3300025263 Bacteria 11862
49 Ga0209565_1004009 3300025263 Bacteria 4594
50 Ga0209565_1007178 3300025263 Bacteria 3032
51 Ga0209673_1000040 3300025273 Bacteria 312633
52 Ga0209673_1004967 3300025273 Bacteria 6900
53 Ga0209130_1000589 3300025284 Bacteria 35424
54 Ga0209130_1001191 3300025284 Bacteria 18532
55 Ga0209130_1002435 3300025284 Bacteria 9332
56 Ga0209130_1003248 3300025284 Bacteria 7128
57 Ga0209675_1000117 3300025291 Bacteria 111087
58 Ga0209675_1002849 3300025291 Bacteria 8597
59 Ga0209675_1022099 3300025291 Bacteria 1679
60 Ga0209564_1000063 3300025295 Bacteria 318515
61 Ga0209564_1000121 3300025295 Bacteria 204081
62 Ga0209564_1009604 3300025295 Bacteria 4579
63 Ga0209564_1026837 3300025295 Bacteria 1890
64 Ga0209564_1028809 3300025295 Bacteria 1764
65 Ga0209758_1000077 3300025297 Bacteria 268195
66 Ga0209050_1000050 3300025298 Bacteria 362578
67 Ga0209050_1005628 3300025298 Bacteria 7771
68 Ga0209050_1006410 3300025298 Bacteria 6974
69 Ga0209256_1000054 3300025299 Bacteria 298431
70 Ga0209256_1000288 3300025299 Bacteria 88470
71 Ga0209256_1001035 3300025299 Bacteria 32598
72 Ga0209256_1001215 3300025299 Bacteria 28711
73 Ga0209256_1001444 3300025299 Bacteria 24546
74 Ga0209256_1001903 3300025299 Bacteria 19094
75 Ga0207426_1003614 3300025302 Bacteria 8201
76 Ga0209257_1000075 3300025304 Bacteria 324855
77 Ga0209257_1005792 3300025304 Bacteria 8410
78 Ga0207654_10004037 3300025911 Bacteria 7389
79 Ga0207657_10043844 3300025919 Bacteria 3937
80 Ga0207674_10053744 3300026116 Bacteria 4104
81 Ga0209282_1000009 3300027666 Bacteria 233366
82 Ga0316177_1201609 3300030731 Bacteria 1418
83 Ga0316180_1042733 3300030736 Bacteria 2544
84 Ga0316182_1051692 3300030745 Bacteria 3087
85 Ga0307408_100005252 3300031548 Bacteria 8681
86 Ga0307408_100005442 3300031548 Bacteria 8524
87 Ga0307408_100008917 3300031548 Bacteria 6627
88 Ga0307408_100009798 3300031548 Bacteria 6315
89 Ga0307408_100053182 3300031548 Bacteria 2923
90 Ga0307518_10109853 3300031838 Bacteria 1965
91 Ga0307416_100027729 3300032002 Bacteria 4199
92 Ga0395899_0000386 3300037312 Bacteria 52584
93 Ga0395899_0024756 3300037312 Bacteria 4536
94 Ga0395899_0112862 3300037312 Bacteria 1952
95 Ga0395900_0020957 3300037418 Bacteria 6680
96 Ga0395900_0176101 3300037418 Bacteria 2175
97 Ga0395898_0153961 3300037466 Bacteria 2199
98 Ga0395898_0429993 3300037466 Bacteria 1258
99 Ga0395901_0000187 3300038443 Bacteria 79696
100 Ga0395901_0248089 3300038443 Bacteria 1855
101 Ga0450904_000164 3300042139 Bacteria 14610
102 Ga0466972_0002853 3300044658 Bacteria 8556
103 Ga0466966_0013549 3300044684 Bacteria 5396
104 Ga0466961_0027461 3300044693 Bacteria 3660
105 Ga0466961_0133032 3300044693 Bacteria 1558
106 Ga0466964_0001019 3300044706 Bacteria 9316
107 Ga0466964_0004353 3300044706 Bacteria 5219
108 Ga0466968_0001262 3300044735 Bacteria 9004
109 Ga0466957_0032760 3300044842 Bacteria 3113
110 Ga0466959_0016924 3300045049 Bacteria 5336
111 Ga0466959_0021567 3300045049 Bacteria 4753
112 Ga0466958_0050469 3300045836 Bacteria 2518
113 Ga0466958_0069612 3300045836 Bacteria 2152
114 Ga0466967_0041803 3300045976 Bacteria 3956
115 Ga0495617_000027 3300046452 Bacteria 157385
116 Ga0495617_000520 3300046452 Bacteria 19994
117 Ga0495617_004774 3300046452 Bacteria 4892
118 Ga0495627_000277 3300046453 Bacteria 51556
119 Ga0495627_012341 3300046453 Bacteria 3036
120 Ga0495603_0057102 3300046455 Bacteria 2309
121 Ga0495590_0000053 3300046457 Bacteria 103329
122 Ga0495590_0003691 3300046457 Bacteria 6227
123 Ga0495591_005142 3300046458 Bacteria 6133
124 Ga0495638_0001941 3300046460 Bacteria 17738
125 Ga0495638_0003356 3300046460 Bacteria 12629
126 Ga0495638_0050384 3300046460 Bacteria 2600
127 Ga0495638_0191061 3300046460 Bacteria 1162
128 Ga0495653_0071491 3300046463 Bacteria 2593
129 Ga0495650_0000582 3300046471 Bacteria 51082
130 Ga0495650_0001065 3300046471 Bacteria 30418
131 Ga0495580_0117793 3300046472 Bacteria 1844
132 Ga0495582_0003170 3300046473 Bacteria 9235
133 Ga0495605_0000135 3300046474 Bacteria 95104
134 Ga0495605_0000287 3300046474 Bacteria 55659
135 Ga0495605_0000641 3300046474 Bacteria 26838
136 Ga0495605_0005533 3300046474 Bacteria 7351
137 Ga0495605_0024823 3300046474 Bacteria 3131
138 Ga0495605_0035558 3300046474 Bacteria 2517
139 Ga0495605_0054566 3300046474 Bacteria 1935
140 Ga0495605_0058529 3300046474 Bacteria 1852
141 Ga0495584_0000005 3300046491 Bacteria 306957
142 Ga0495584_0000713 3300046491 Bacteria 21919
143 Ga0495584_0001109 3300046491 Bacteria 16710
144 Ga0495584_0001404 3300046491 Bacteria 14491
145 Ga0495584_0002149 3300046491 Bacteria 11257
146 Ga0495584_0018502 3300046491 Bacteria 3541
147 Ga0495584_0039278 3300046491 Bacteria 2391
148 Ga0495585_0000238 3300046492 Bacteria 57003
149 Ga0495585_0000466 3300046492 Bacteria 38653
150 Ga0495585_0003000 3300046492 Bacteria 11653
151 Ga0495585_0006816 3300046492 Bacteria 7048
152 Ga0495585_0016793 3300046492 Bacteria 4240
153 Ga0495585_0016898 3300046492 Bacteria 4226
154 Ga0495585_0020798 3300046492 Bacteria 3771
155 Ga0495585_0026650 3300046492 Bacteria 3301
156 Ga0495585_0031507 3300046492 Bacteria 3009
157 Ga0495585_0043400 3300046492 Bacteria 2515
158 Ga0495585_0092212 3300046492 Bacteria 1630
159 Ga0495585_0093578 3300046492 Bacteria 1616
160 Ga0495594_0023879 3300046499 Bacteria 3279
161 Ga0495594_0075051 3300046499 Bacteria 1884
162 Ga0495594_0115018 3300046499 Bacteria 1518
163 Ga0495596_0005840 3300046500 Bacteria 5758
164 Ga0495596_0006438 3300046500 Bacteria 5402
165 Ga0495596_0006730 3300046500 Bacteria 5256
166 Ga0495596_0011976 3300046500 Bacteria 3722
167 Ga0495596_0012988 3300046500 Bacteria 3547
168 Ga0495596_0019850 3300046500 Bacteria 2756
169 Ga0495596_0022231 3300046500 Bacteria 2582
170 Ga0495607_0002410 3300046501 Bacteria 15261
171 Ga0495607_0008196 3300046501 Bacteria 7156
172 Ga0495607_0022758 3300046501 Bacteria 3931
173 Ga0495607_0032987 3300046501 Bacteria 3154
174 Ga0495607_0044572 3300046501 Bacteria 2614
175 Ga0495607_0128506 3300046501 Bacteria 1321
176 Ga0495583_0000158 3300046506 Bacteria 113645
177 Ga0495583_0000947 3300046506 Bacteria 33746
178 Ga0495583_0001239 3300046506 Bacteria 27114
179 Ga0495583_0002767 3300046506 Bacteria 14470
180 Ga0495583_0002934 3300046506 Bacteria 13746
181 Ga0495583_0008019 3300046506 Bacteria 6518
182 Ga0495583_0065863 3300046506 Bacteria 1604
183 Ga0495583_0072883 3300046506 Bacteria 1506
184 Ga0495606_0018673 3300046507 Bacteria 5189
185 Ga0495606_0034246 3300046507 Bacteria 3488
186 Ga0495606_0035287 3300046507 Bacteria 3420
187 Ga0495606_0053930 3300046507 Bacteria 2606
188 Ga0495606_0062031 3300046507 Bacteria 2388
189 Ga0495606_0130509 3300046507 Bacteria 1494
190 Ga0495606_0145921 3300046507 Bacteria 1393
191 Ga0495610_0046779 3300046512 Bacteria 2133
192 Ga0495616_0000570 3300046513 Bacteria 27850
193 Ga0495616_0002996 3300046513 Bacteria 10961
194 Ga0495616_0004027 3300046513 Bacteria 9336
195 Ga0495616_0004627 3300046513 Bacteria 8635
196 Ga0495616_0011210 3300046513 Bacteria 5146
197 Ga0495616_0014542 3300046513 Bacteria 4402
198 Ga0495616_0025166 3300046513 Bacteria 3184
199 Ga0495616_0037886 3300046513 Bacteria 2477
200 Ga0495616_0046004 3300046513 Bacteria 2205
201 Ga0495616_0046360 3300046513 Bacteria 2194
202 Ga0495631_0004324 3300046518 Bacteria 7576
203 Ga0495631_0005565 3300046518 Bacteria 6585
204 Ga0495631_0018196 3300046518 Bacteria 3311
205 Ga0495631_0040682 3300046518 Bacteria 2059
206 Ga0495631_0048387 3300046518 Bacteria 1864
207 Ga0495631_0057854 3300046518 Bacteria 1686
208 Ga0495631_0059792 3300046518 Bacteria 1654
209 Ga0495632_0000177 3300046519 Bacteria 65209
210 Ga0495632_0001980 3300046519 Bacteria 16262
211 Ga0495632_0012833 3300046519 Bacteria 4808
212 Ga0495632_0024887 3300046519 Bacteria 3173
213 Ga0495632_0035840 3300046519 Bacteria 2527
214 Ga0495632_0067244 3300046519 Bacteria 1728
215 Ga0495637_0000053 3300046520 Bacteria 99739
216 Ga0495637_0013000 3300046520 Bacteria 3965
217 Ga0495643_0000455 3300046522 Bacteria 52002
218 Ga0495643_0003928 3300046522 Bacteria 10651
219 Ga0495643_0047261 3300046522 Bacteria 2331
220 Ga0495643_0048487 3300046522 Bacteria 2295
221 Ga0495644_0001533 3300046523 Bacteria 9433
222 Ga0495644_0003815 3300046523 Bacteria 5927
223 Ga0495644_0004370 3300046523 Bacteria 5551
224 Ga0495644_0004996 3300046523 Bacteria 5194
225 Ga0495644_0011868 3300046523 Bacteria 3351
226 Ga0495644_0059921 3300046523 Bacteria 1431
227 Ga0495648_0000183 3300046524 Bacteria 72118
228 Ga0495648_0005653 3300046524 Bacteria 10349
229 Ga0495648_0010486 3300046524 Bacteria 7055
230 Ga0495648_0026746 3300046524 Bacteria 3877
231 Ga0495648_0031199 3300046524 Bacteria 3512
232 Ga0495648_0048376 3300046524 Bacteria 2618
233 Ga0495666_0003885 3300046526 Bacteria 7556
234 Ga0495642_0000137 3300046528 Bacteria 42614
235 Ga0495642_0001360 3300046528 Bacteria 10926
236 Ga0495642_0007504 3300046528 Bacteria 4176
237 Ga0495642_0010279 3300046528 Bacteria 3584
238 Ga0495642_0010955 3300046528 Bacteria 3475
239 Ga0495642_0013241 3300046528 Bacteria 3187
240 Ga0495642_0037164 3300046528 Bacteria 1969
241 Ga0495652_0005568 3300046529 Bacteria 11846
242 Ga0495654_0049968 3300046530 Bacteria 2045
243 Ga0495665_0002132 3300046531 Bacteria 10704
244 Ga0495587_0027307 3300046536 Bacteria 3476
245 Ga0495609_0000007 3300046538 Bacteria 398812
246 Ga0495609_0000314 3300046538 Bacteria 43536
247 Ga0495609_0001446 3300046538 Bacteria 15772
248 Ga0495609_0001612 3300046538 Bacteria 14740
249 Ga0495609_0017230 3300046538 Bacteria 3356
250 Ga0495609_0020007 3300046538 Bacteria 3094
251 Ga0495609_0029983 3300046538 Bacteria 2475
252 Ga0495609_0036459 3300046538 Bacteria 2220
253 Ga0495597_0000348 3300046542 Bacteria 41331
254 Ga0495597_0001926 3300046542 Bacteria 14027
255 Ga0495597_0003123 3300046542 Bacteria 9943
256 Ga0495597_0008174 3300046542 Bacteria 5261
257 Ga0495597_0010744 3300046542 Bacteria 4462
258 Ga0495597_0027043 3300046542 Bacteria 2632
259 Ga0495645_0155793 3300046543 Bacteria 1583
260 Ga0495622_0007554 3300046557 Bacteria 5047
261 Ga0495622_0010646 3300046557 Bacteria 4243
262 Ga0495622_0073385 3300046557 Bacteria 1578
263 Ga0495633_0002729 3300046558 Bacteria 12238
264 Ga0495633_0013399 3300046558 Bacteria 4323
265 Ga0495633_0015359 3300046558 Bacteria 3973
266 Ga0495633_0016967 3300046558 Bacteria 3735
267 Ga0495633_0051892 3300046558 Bacteria 1932
268 Ga0495633_0075561 3300046558 Bacteria 1569
269 Ga0495656_0002616 3300046615 Bacteria 6008
270 Ga0495668_0000343 3300046616 Bacteria 61962
271 Ga0495668_0001879 3300046616 Bacteria 18822
272 Ga0495668_0004966 3300046616 Bacteria 9215
273 Ga0495668_0007683 3300046616 Bacteria 6854
274 Ga0495668_0013849 3300046616 Bacteria 4742
275 Ga0495668_0030978 3300046616 Bacteria 3015
276 Ga0495668_0039385 3300046616 Bacteria 2638
277 Ga0495668_0039806 3300046616 Bacteria 2624
278 Ga0495611_0000672 3300046648 Bacteria 19487
279 Ga0495611_0001589 3300046648 Bacteria 11097
280 Ga0495611_0002765 3300046648 Bacteria 7868
281 Ga0495611_0050619 3300046648 Bacteria 1871
282 Ga0495611_0113587 3300046648 Bacteria 1261
283 Ga0495625_0005443 3300046660 Bacteria 11608
284 Ga0495625_0031580 3300046660 Bacteria 3936
285 Ga0495625_0032894 3300046660 Bacteria 3839
286 Ga0495625_0038476 3300046660 Bacteria 3501
287 Ga0495625_0118824 3300046660 Bacteria 1801
288 Ga0495659_0000884 3300046664 Bacteria 10658
289 Ga0495659_0005704 3300046664 Bacteria 3923
290 Ga0495661_0000776 3300046665 Bacteria 30561
291 Ga0495661_0001219 3300046665 Bacteria 22320
292 Ga0495661_0003931 3300046665 Bacteria 10852
293 Ga0495661_0008282 3300046665 Bacteria 7203
294 Ga0495661_0009782 3300046665 Bacteria 6562
295 Ga0495661_0013782 3300046665 Bacteria 5424
296 Ga0495661_0037270 3300046665 Bacteria 3036
297 Ga0495661_0063076 3300046665 Bacteria 2192
298 Ga0495588_0006779 3300046674 Bacteria 5180
299 Ga0495588_0037028 3300046674 Bacteria 2477
300 Ga0495588_0095420 3300046674 Bacteria 1559
301 Ga0495588_0109252 3300046674 Bacteria 1456
302 Ga0495623_0004426 3300046679 Bacteria 9232
303 Ga0495623_0017214 3300046679 Bacteria 4668
304 Ga0495669_0000791 3300046684 Bacteria 13518
305 Ga0495669_0006772 3300046684 Bacteria 4794
306 Ga0495669_0009699 3300046684 Bacteria 4063
307 Ga0495669_0013540 3300046684 Bacteria 3477
308 Ga0495669_0018036 3300046684 Bacteria 3032
309 Ga0495669_0052652 3300046684 Bacteria 1829
310 Ga0495670_0001736 3300046691 Bacteria 10729
311 Ga0495670_0026159 3300046691 Bacteria 2888
312 Ga0495670_0043690 3300046691 Bacteria 2236
313 Ga0495670_0058978 3300046691 Bacteria 1926
314 Ga0495671_0000266 3300046692 Bacteria 44137
315 Ga0495671_0005577 3300046692 Bacteria 7351
316 Ga0495671_0006429 3300046692 Bacteria 6783
317 Ga0495671_0014791 3300046692 Bacteria 4192
318 Ga0495671_0018176 3300046692 Bacteria 3733
319 Ga0495671_0063461 3300046692 Bacteria 1819
320 Ga0495671_0097638 3300046692 Bacteria 1436
321 Ga0495649_0000291 3300046694 Bacteria 44106
322 Ga0495649_0005902 3300046694 Bacteria 7682
323 Ga0495649_0013486 3300046694 Bacteria 4714
324 Ga0495649_0024334 3300046694 Bacteria 3377
325 Ga0495589_0000081 3300046794 Bacteria 88067
326 Ga0495589_0000563 3300046794 Bacteria 25676
327 Ga0495589_0002907 3300046794 Bacteria 9460
328 Ga0495589_0004246 3300046794 Bacteria 7661
329 Ga0495589_0018943 3300046794 Bacteria 3530
330 Ga0495589_0025590 3300046794 Bacteria 2994
331 Ga0495589_0041872 3300046794 Bacteria 2284
332 Ga0495589_0071610 3300046794 Bacteria 1693
333 Ga0495660_0000101 3300046810 Bacteria 91466
334 Ga0495660_0001122 3300046810 Bacteria 19111
335 Ga0495660_0003901 3300046810 Bacteria 9114
336 Ga0495660_0011928 3300046810 Bacteria 5041
337 Ga0495660_0012779 3300046810 Bacteria 4871
338 Ga0495660_0033149 3300046810 Bacteria 2898
339 Ga0495660_0039672 3300046810 Bacteria 2614
340 Ga0495660_0040828 3300046810 Bacteria 2570
341 Ga0495660_0069143 3300046810 Bacteria 1877
342 Ga0495581_0014218 3300047315 Bacteria 4614
343 Ga0495604_0088211 3300047317 Bacteria 2308
344 Ga0495636_0012251 3300047318 Bacteria 3395
345 Ga0495672_0000135 3300047320 Bacteria 110114
346 Ga0495672_0000297 3300047320 Bacteria 68017
347 Ga0495672_0000340 3300047320 Bacteria 59814
348 Ga0495672_0000348 3300047320 Bacteria 59143
349 Ga0495672_0001282 3300047320 Bacteria 25048
350 Ga0495672_0025879 3300047320 Bacteria 3751
351 Ga0495672_0048989 3300047320 Bacteria 2503
352 Ga0495676_0026273 3300047321 Bacteria 5015
353 Ga0495676_0035926 3300047321 Bacteria 4142
354 Ga0495680_0011600 3300047322 Bacteria 7790
355 Ga0495683_0001107 3300047323 Bacteria 18628
356 Ga0495683_0001476 3300047323 Bacteria 15354
357 Ga0495683_0002376 3300047323 Bacteria 11407
358 Ga0495683_0010353 3300047323 Bacteria 4931
359 Ga0495683_0010875 3300047323 Bacteria 4798
360 Ga0495683_0039365 3300047323 Bacteria 2389
361 Ga0495683_0073531 3300047323 Bacteria 1676
362 Ga0495683_0091305 3300047323 Bacteria 1475
363 Ga0495683_0093446 3300047323 Bacteria 1454
364 Ga0495687_000030 3300047443 Bacteria 279992
365 Ga0495687_000120 3300047443 Bacteria 120987
366 Ga0495687_000374 3300047443 Bacteria 55800
367 Ga0495687_000814 3300047443 Bacteria 33460
368 Ga0495687_000938 3300047443 Bacteria 30149
369 Ga0495687_002025 3300047443 Bacteria 17139
370 Ga0495687_014646 3300047443 Bacteria 4023
371 Ga0495687_077357 3300047443 Bacteria 1314
372 Ga0495677_0000045 3300047445 Bacteria 73995
373 Ga0495677_0001774 3300047445 Bacteria 8640
374 Ga0495677_0007829 3300047445 Bacteria 3979
375 Ga0495677_0014132 3300047445 Bacteria 2907
376 Ga0495677_0028047 3300047445 Bacteria 2043
377 Ga0495679_004750 3300047446 Bacteria 6161
378 Ga0495679_008420 3300047446 Bacteria 4193
379 Ga0495685_000125 3300047447 Bacteria 26465
380 Ga0495673_0003046 3300047469 Bacteria 11278
381 Ga0495673_0013400 3300047469 Bacteria 4308
382 Ga0495681_0001259 3300047470 Bacteria 19226
383 Ga0495681_0004464 3300047470 Bacteria 9542
384 Ga0495681_0035239 3300047470 Bacteria 2486
385 Ga0495681_0073101 3300047470 Bacteria 1549
386 Ga0495681_0088441 3300047470 Bacteria 1371
387 Ga0495681_0129651 3300047470 Bacteria 1074
388 Ga0495686_0000793 3300047472 Bacteria 41237
389 Ga0495686_0000802 3300047472 Bacteria 40756
390 Ga0495686_0002181 3300047472 Bacteria 19042
391 Ga0495686_0010020 3300047472 Bacteria 6770
392 Ga0495602_0006123 3300048088 Bacteria 12613
393 Ga0495626_0000105 3300048091 Bacteria 109725
394 Ga0495626_0000347 3300048091 Bacteria 48706
395 Ga0495626_0001251 3300048091 Bacteria 20847
396 Ga0495626_0001781 3300048091 Bacteria 16311
397 Ga0495626_0002285 3300048091 Bacteria 13626
398 Ga0495626_0004184 3300048091 Bacteria 8952
399 Ga0495626_0006236 3300048091 Bacteria 6810
400 Ga0495626_0008043 3300048091 Bacteria 5822
401 Ga0495626_0008092 3300048091 Bacteria 5800
402 Ga0495626_0015723 3300048091 Bacteria 3866
403 Ga0495626_0016839 3300048091 Bacteria 3704
404 Ga0495626_0026544 3300048091 Bacteria 2822
405 Ga0495626_0032588 3300048091 Bacteria 2501
406 Ga0495626_0035537 3300048091 Bacteria 2378
407 Ga0495626_0046603 3300048091 Bacteria 2019
408 Ga0495626_0055804 3300048091 Bacteria 1809
409 Ga0495626_0103605 3300048091 Bacteria 1238
410 Ga0496102_0002668 3300048905 Bacteria 15171
411 Ga0496102_0018788 3300048905 Bacteria 6080
412 Ga0496104_0079965 3300048907 Bacteria 3116
413 Ga0496107_0145223 3300048910 Bacteria 1754
414 Ga0496107_0187732 3300048910 Bacteria 1535
415 Ga0496108_0297034 3300048911 Bacteria 1407
416 Ga0496109_0425717 3300048912 Bacteria 1254
417 Ga0496110_0000462 3300048913 Bacteria 27650
418 Ga0496110_0085648 3300048913 Bacteria 2813
419 Ga0496111_0111261 3300048914 Bacteria 2017
420 Ga0496115_0014353 3300048918 Bacteria 5996
421 Ga0496122_0016581 3300048925 Bacteria 6956
422 Ga0496123_0011288 3300048926 Bacteria 7763
423 Ga0496123_0077799 3300048926 Bacteria 2035
424 Ga0496124_0010663 3300048927 Bacteria 9272
425 Ga0496124_0027073 3300048927 Bacteria 5157
426 Ga0496124_0048276 3300048927 Bacteria 3639
427 Ga0496124_0104422 3300048927 Bacteria 2291
428 Ga0496124_0211692 3300048927 Bacteria 1466
429 Ga0495678_000190 3300049459 Bacteria 71878
430 Ga0495678_004786 3300049459 Bacteria 7704
431 Ga0495678_005984 3300049459 Bacteria 6564
432 Ga0495678_012815 3300049459 Bacteria 3959
433 Ga0495678_018113 3300049459 Bacteria 3174
434 Ga0495678_018557 3300049459 Bacteria 3124
435 Ga0495682_0000937 3300049460 Bacteria 17697
436 Ga0495682_0012511 3300049460 Bacteria 3250
437 Ga0495682_0020760 3300049460 Bacteria 2464
438 Ga0495682_0049928 3300049460 Bacteria 1524
439 Ga0501227_016521 3300049665 Bacteria 1659
440 Ga0501279_000692 3300049775 Bacteria 4416
441 Ga0501035_0007157 3300049822 Bacteria 10438
442 Ga0501044_0066127 3300049823 Bacteria 3687
443 2643792001 2643221554 Bacteria 6603920
444 2643799515 2643221556 Bacteria 7251154
445 2644216519 2643221638 Bacteria 6579467
446 2644254738 2643221645 Bacteria 7207331
447 2644360292 2643221664 Bacteria 7272945
448 2644471605 2643221684 Bacteria 7145183
449 2738738047 2738541280 Bacteria 6630198
450 2738843163 2738541300 Bacteria 6675882
451 2739273914 2738543018 Bacteria 6718814
452 2739342958 2738543030 Bacteria 6719714
453 2809145778 2808606418 Bacteria 6724496
454 3007253718 3007252601 Bacteria 4559114
455 8047675990 8047673197 Bacteria 7395230
456 Ga0495585_0000277
457 JGI25158J39367_1001693
458 JGI25152J39213_1000641
459 JGI25150J39212_1003457
460 JGI25159J45721_1002616
461 JGI25159J45721_1002963
462 JGI25161J50226_1001549
463 Ga0055526_1004432
464 Ga0055526_1011899
465 Ga0055526_1023229
466 Ga0055537_1000038
467 Ga0055537_1005582
468 Ga0055524_1000024
469 Ga0055524_1007172
470 Ga0055524_1008299
471 Ga0055524_1011583
472 Ga0055534_1000893
473 Ga0055528_1000252
474 Ga0055528_1002464
475 Ga0055530_10003976
476 Ga0055530_10007657
477 Ga0055530_10008022
478 Ga0058692_1011371
479 Ga0055543_1001901
480 Ga0055543_1002088
481 Ga0065165_1000379
482 Ga0065165_1000936
483 Ga0065165_1005606
484 Ga0070658_10093776
485 Ga0070660_100080492
486 Ga0070659_100088112
487 Ga0068855_100034686
488 Ga0099826_10000010
489 Ga0105241_10030573
490 Ga0157373_10059000
491 Ga0157373_10068338
492 Ga0157371_10076662
493 Ga0157372_10309450
494 Ga0182006_1013381
495 Ga0209436_101767
496 Ga0209436_108396
497 Ga0207425_1000021
498 Ga0207425_1000610
499 Ga0209148_1001902
500 Ga0209129_1000020
501 Ga0209129_1002800
502 Ga0209565_1000123
503 Ga0209565_1001251
504 Ga0209565_1004009
505 Ga0209565_1007178
506 Ga0209673_1000040
507 Ga0209673_1004967
508 Ga0209130_1000589
509 Ga0209130_1001191
510 Ga0209130_1002435
511 Ga0209130_1003248
512 Ga0209675_1000117
513 Ga0209675_1002849
514 Ga0209675_1022099
515 Ga0209564_1000063
516 Ga0209564_1000121
517 Ga0209564_1009604
518 Ga0209564_1026837
519 Ga0209564_1028809
520 Ga0209758_1000077
521 Ga0209050_1000050
522 Ga0209050_1005628
523 Ga0209050_1006410
524 Ga0209256_1000054
525 Ga0209256_1000288
526 Ga0209256_1001035
527 Ga0209256_1001215
528 Ga0209256_1001444
529 Ga0209256_1001903
530 Ga0207426_1003614
531 Ga0209257_1000075
532 Ga0209257_1005792
533 Ga0207654_10004037
534 Ga0207657_10043844
535 Ga0207674_10053744
536 Ga0209282_1000009
537 Ga0316177_1201609
538 Ga0316180_1042733
539 Ga0316182_1051692
540 Ga0307408_100005252
541 Ga0307408_100005442
542 Ga0307408_100008917
543 Ga0307408_100009798
544 Ga0307408_100053182
545 Ga0307518_10109853
546 Ga0307416_100027729
547 Ga0395899_0000386
548 Ga0395899_0024756
549 Ga0395899_0112862
550 Ga0395900_0020957
551 Ga0395900_0176101
552 Ga0395898_0153961
553 Ga0395898_0429993
554 Ga0395901_0000187
555 Ga0395901_0248089
556 Ga0450904_000164
557 Ga0466972_0002853
558 Ga0466966_0013549
559 Ga0466961_0027461
560 Ga0466961_0133032
561 Ga0466964_0001019
562 Ga0466964_0004353
563 Ga0466968_0001262
564 Ga0466957_0032760
565 Ga0466959_0016924
566 Ga0466959_0021567
567 Ga0466958_0050469
568 Ga0466958_0069612
569 Ga0466967_0041803
570 Ga0495617_000027
571 Ga0495617_000520
572 Ga0495617_004774
573 Ga0495627_000277
574 Ga0495627_012341
575 Ga0495603_0057102
576 Ga0495590_0000053
577 Ga0495590_0003691
578 Ga0495591_005142
579 Ga0495638_0001941
580 Ga0495638_0003356
581 Ga0495638_0050384
582 Ga0495638_0191061
583 Ga0495653_0071491
584 Ga0495650_0000582
585 Ga0495650_0001065
586 Ga0495580_0117793
587 Ga0495582_0003170
588 Ga0495605_0000135
589 Ga0495605_0000287
590 Ga0495605_0000641
591 Ga0495605_0005533
592 Ga0495605_0024823
593 Ga0495605_0035558
594 Ga0495605_0054566
595 Ga0495605_0058529
596 Ga0495584_0000005
597 Ga0495584_0000713
598 Ga0495584_0001109
599 Ga0495584_0001404
600 Ga0495584_0002149
601 Ga0495584_0018502
602 Ga0495584_0039278
603 Ga0495585_0000238
604 Ga0495585_0000466
605 Ga0495585_0003000
606 Ga0495585_0006816
607 Ga0495585_0016793
608 Ga0495585_0016898
609 Ga0495585_0020798
610 Ga0495585_0026650
611 Ga0495585_0031507
612 Ga0495585_0043400
613 Ga0495585_0092212
614 Ga0495585_0093578
615 Ga0495594_0023879
616 Ga0495594_0075051
617 Ga0495594_0115018
618 Ga0495596_0005840
619 Ga0495596_0006438
620 Ga0495596_0006730
621 Ga0495596_0011976
622 Ga0495596_0012988
623 Ga0495596_0019850
624 Ga0495596_0022231
625 Ga0495607_0002410
626 Ga0495607_0008196
627 Ga0495607_0022758
628 Ga0495607_0032987
629 Ga0495607_0044572
630 Ga0495607_0128506
631 Ga0495583_0000158
632 Ga0495583_0000947
633 Ga0495583_0001239
634 Ga0495583_0002767
635 Ga0495583_0002934
636 Ga0495583_0008019
637 Ga0495583_0065863
638 Ga0495583_0072883
639 Ga0495606_0018673
640 Ga0495606_0034246
641 Ga0495606_0035287
642 Ga0495606_0053930
643 Ga0495606_0062031
644 Ga0495606_0130509
645 Ga0495606_0145921
646 Ga0495610_0046779
647 Ga0495616_0000570
648 Ga0495616_0002996
649 Ga0495616_0004027
650 Ga0495616_0004627
651 Ga0495616_0011210
652 Ga0495616_0014542
653 Ga0495616_0025166
654 Ga0495616_0037886
655 Ga0495616_0046004
656 Ga0495616_0046360
657 Ga0495631_0004324
658 Ga0495631_0005565
659 Ga0495631_0018196
660 Ga0495631_0040682
661 Ga0495631_0048387
662 Ga0495631_0057854
663 Ga0495631_0059792
664 Ga0495632_0000177
665 Ga0495632_0001980
666 Ga0495632_0012833
667 Ga0495632_0024887
668 Ga0495632_0035840
669 Ga0495632_0067244
670 Ga0495637_0000053
671 Ga0495637_0013000
672 Ga0495643_0000455
673 Ga0495643_0003928
674 Ga0495643_0047261
675 Ga0495643_0048487
676 Ga0495644_0001533
677 Ga0495644_0003815
678 Ga0495644_0004370
679 Ga0495644_0004996
680 Ga0495644_0011868
681 Ga0495644_0059921
682 Ga0495648_0000183
683 Ga0495648_0005653
684 Ga0495648_0010486
685 Ga0495648_0026746
686 Ga0495648_0031199
687 Ga0495648_0048376
688 Ga0495666_0003885
689 Ga0495642_0000137
690 Ga0495642_0001360
691 Ga0495642_0007504
692 Ga0495642_0010279
693 Ga0495642_0010955
694 Ga0495642_0013241
695 Ga0495642_0037164
696 Ga0495652_0005568
697 Ga0495654_0049968
698 Ga0495665_0002132
699 Ga0495587_0027307
700 Ga0495609_0000007
701 Ga0495609_0000314
702 Ga0495609_0001446
703 Ga0495609_0001612
704 Ga0495609_0017230
705 Ga0495609_0020007
706 Ga0495609_0029983
707 Ga0495609_0036459
708 Ga0495597_0000348
709 Ga0495597_0001926
710 Ga0495597_0003123
711 Ga0495597_0008174
712 Ga0495597_0010744
713 Ga0495597_0027043
714 Ga0495645_0155793
715 Ga0495622_0007554
716 Ga0495622_0010646
717 Ga0495622_0073385
718 Ga0495633_0002729
719 Ga0495633_0013399
720 Ga0495633_0015359
721 Ga0495633_0016967
722 Ga0495633_0051892
723 Ga0495633_0075561
724 Ga0495656_0002616
725 Ga0495668_0000343
726 Ga0495668_0001879
727 Ga0495668_0004966
728 Ga0495668_0007683
729 Ga0495668_0013849
730 Ga0495668_0030978
731 Ga0495668_0039385
732 Ga0495668_0039806
733 Ga0495611_0000672
734 Ga0495611_0001589
735 Ga0495611_0002765
736 Ga0495611_0050619
737 Ga0495611_0113587
738 Ga0495625_0005443
739 Ga0495625_0031580
740 Ga0495625_0032894
741 Ga0495625_0038476
742 Ga0495625_0118824
743 Ga0495659_0000884
744 Ga0495659_0005704
745 Ga0495661_0000776
746 Ga0495661_0001219
747 Ga0495661_0003931
748 Ga0495661_0008282
749 Ga0495661_0009782
750 Ga0495661_0013782
751 Ga0495661_0037270
752 Ga0495661_0063076
753 Ga0495588_0006779
754 Ga0495588_0037028
755 Ga0495588_0095420
756 Ga0495588_0109252
757 Ga0495623_0004426
758 Ga0495623_0017214
759 Ga0495669_0000791
760 Ga0495669_0006772
761 Ga0495669_0009699
762 Ga0495669_0013540
763 Ga0495669_0018036
764 Ga0495669_0052652
765 Ga0495670_0001736
766 Ga0495670_0026159
767 Ga0495670_0043690
768 Ga0495670_0058978
769 Ga0495671_0000266
770 Ga0495671_0005577
771 Ga0495671_0006429
772 Ga0495671_0014791
773 Ga0495671_0018176
774 Ga0495671_0063461
775 Ga0495671_0097638
776 Ga0495649_0000291
777 Ga0495649_0005902
778 Ga0495649_0013486
779 Ga0495649_0024334
780 Ga0495589_0000081
781 Ga0495589_0000563
782 Ga0495589_0002907
783 Ga0495589_0004246
784 Ga0495589_0018943
785 Ga0495589_0025590
786 Ga0495589_0041872
787 Ga0495589_0071610
788 Ga0495660_0000101
789 Ga0495660_0001122
790 Ga0495660_0003901
791 Ga0495660_0011928
792 Ga0495660_0012779
793 Ga0495660_0033149
794 Ga0495660_0039672
795 Ga0495660_0040828
796 Ga0495660_0069143
797 Ga0495581_0014218
798 Ga0495604_0088211
799 Ga0495636_0012251
800 Ga0495672_0000135
801 Ga0495672_0000297
802 Ga0495672_0000340
803 Ga0495672_0000348
804 Ga0495672_0001282
805 Ga0495672_0025879
806 Ga0495672_0048989
807 Ga0495676_0026273
808 Ga0495676_0035926
809 Ga0495680_0011600
810 Ga0495683_0001107
811 Ga0495683_0001476
812 Ga0495683_0002376
813 Ga0495683_0010353
814 Ga0495683_0010875
815 Ga0495683_0039365
816 Ga0495683_0073531
817 Ga0495683_0091305
818 Ga0495683_0093446
819 Ga0495687_000030
820 Ga0495687_000120
821 Ga0495687_000374
822 Ga0495687_000814
823 Ga0495687_000938
824 Ga0495687_002025
825 Ga0495687_014646
826 Ga0495687_077357
827 Ga0495677_0000045
828 Ga0495677_0001774
829 Ga0495677_0007829
830 Ga0495677_0014132
831 Ga0495677_0028047
832 Ga0495679_004750
833 Ga0495679_008420
834 Ga0495685_000125
835 Ga0495673_0003046
836 Ga0495673_0013400
837 Ga0495681_0001259
838 Ga0495681_0004464
839 Ga0495681_0035239
840 Ga0495681_0073101
841 Ga0495681_0088441
842 Ga0495681_0129651
843 Ga0495686_0000793
844 Ga0495686_0000802
845 Ga0495686_0002181
846 Ga0495686_0010020
847 Ga0495602_0006123
848 Ga0495626_0000105
849 Ga0495626_0000347
850 Ga0495626_0001251
851 Ga0495626_0001781
852 Ga0495626_0002285
853 Ga0495626_0004184
854 Ga0495626_0006236
855 Ga0495626_0008043
856 Ga0495626_0008092
857 Ga0495626_0015723
858 Ga0495626_0016839
859 Ga0495626_0026544
860 Ga0495626_0032588
861 Ga0495626_0035537
862 Ga0495626_0046603
863 Ga0495626_0055804
864 Ga0495626_0103605
865 Ga0496102_0002668
866 Ga0496102_0018788
867 Ga0496104_0079965
868 Ga0496107_0145223
869 Ga0496107_0187732
870 Ga0496108_0297034
871 Ga0496109_0425717
872 Ga0496110_0000462
873 Ga0496110_0085648
874 Ga0496111_0111261
875 Ga0496115_0014353
876 Ga0496122_0016581
877 Ga0496123_0011288
878 Ga0496123_0077799
879 Ga0496124_0010663
880 Ga0496124_0027073
881 Ga0496124_0048276
882 Ga0496124_0104422
883 Ga0496124_0211692
884 Ga0495678_000190
885 Ga0495678_004786
886 Ga0495678_005984
887 Ga0495678_012815
888 Ga0495678_018113
889 Ga0495678_018557
890 Ga0495682_0000937
891 Ga0495682_0012511
892 Ga0495682_0020760
893 Ga0495682_0049928
894 Ga0501227_016521
895 Ga0501279_000692
896 Ga0501035_0007157
897 Ga0501044_0066127
898 2643792001
899 2643799515
900 2644216519
901 2644254738
902 2644360292
903 2644471605
904 2738738047
905 2738843163
906 2739273914
907 2739342958
908 2809145778
909 3007253718
910 8047675990

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

50

383

0.95

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

45

292

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4hdt-assembly1.cif.gz_A crystal structure of a carnitinyl-coa dehydratase from mycobacterium thermoresistibile 0.963 3 351
4hdt-assembly1.cif.gz_A crystal structure of a carnitinyl-coa dehydratase from mycobacterium thermoresistibile 0.938 3 351
3bpt-assembly1.cif.gz_A crystal structure of human beta-hydroxyisobutyryl-coa hydrolase in complex with quercetin 0.9348 1 349
4j2u-assembly2.cif.gz_B crystal structure of an enoyl-coa hydratase from rhodobacter sphaeroides 2.4.1 0.9245 4 349
6ywe-assembly1.cif.gz_88 the structure of the mitoribosome from neurospora crassa in the p/e trna bound state 0.9096 1 351
ID Description Score Start End Superfamily
af_O53419_1_345_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9619 2 348 3.90.226.10
af_Q5XIE6_31_385_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9396 4 349 3.90.226.10
af_Q19278_30_386_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.935 4 348 3.90.226.10
af_O53419_1_345_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9293 2 348 3.90.226.10
af_I1KQ42_38_407_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9265 6 351 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A6I1HMA1-F1-model_v4 Enoyl-CoA hydratase/isomerase family protein 0.9908 1 361 GO:0003860
GO:0006574
GO:0016853
AF-A0A350CSM3-F1-model_v4 3-hydroxyisobutyryl-CoA hydrolase 0.9766 1 225 GO:0003860
GO:0006574
AF-A0A344U971-F1-model_v4 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) 0.9671 3 348 GO:0003860
GO:0005829
GO:0006574
GO:0016853
AF-A0A6P1HRU7-F1-model_v4 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) 0.965 4 349 GO:0003860
GO:0005829
GO:0006574
AF-A0A0C5XM56-F1-model_v4 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) 0.964 1 351 GO:0003860
GO:0006574

Map