F447653

General Info

Members Datasets Scaffolds Average Seq Length
455 252 910 233

Family's Representative Sequence

Representative Sequence 3300046615|Ga0495656_0000031|Ga0495656_0000031_67724_68533
Length 269
Sequence MKNSSRRFFLWGFATLAVSCLVKGLNLAVAKSEKGGVMLTVRKSGERGVGAHGWLNSQHSFSFANYYDPKHMGFRSLRVINEDRIEGGTGFGAHPHNDMEIISYVVSGALEHSDSMGTKAVIRPGEVQRMSAASGVVHSEYNKLPEEQAHFFQIWIQPNKIGGAPGYGQKSFEEALNKDKLVLVVSENGRDGSIDIKQDADIYISRLKAGENVDFKLRPQRGAWVQVVKGNLSVNGTDVNTGDAVSVTEEALLTFKAKDQSEFILFDLA

Samples

Sample ID Description Type Environment
1 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
7 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
8 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
12 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
100 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
101 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
102 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
103 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
107 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
115 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
117 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
169 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
170 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
173 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
174 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
175 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
181 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
182 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
184 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
185 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
186 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
187 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
188 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
189 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
190 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
191 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
194 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
207 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
227 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
234 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
237 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
247 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
248 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
251 2818991436 Collimonas arenae 515 Isolate Unclassified
252 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.44
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.59
Nodule 0
Rhizoplane 0.44
Rhizosphere 91.87
Stem 0
Stem Tuber 0
Unclassified 5.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495656_0000031 3300046615 Bacteria 78405
2 JGI24746J21847_1002519 3300001977 Bacteria 2914
3 JGI25162J39368_1000268 3300002737 Bacteria 50187
4 JGI25164J39214_1012064 3300002772 Bacteria 821
5 JGI25165J46597_1000270 3300003214 Bacteria 66952
6 Ga0055538_1000105 3300003751 Bacteria 66952
7 Ga0055539_1000153 3300003752 Bacteria 66948
8 Ga0055533_1000155 3300003756 Bacteria 66952
9 Ga0055525_1000208 3300003759 Bacteria 66952
10 Ga0055536_1021126 3300003781 Bacteria 1986
11 Ga0055541_1000102 3300003841 Bacteria 66952
12 Ga0058861_10034114 3300004800 Bacteria 1251
13 Ga0070676_10027032 3300005328 Bacteria 3252
14 Ga0070683_100046971 3300005329 Unclassified 3989
15 Ga0070690_100003343 3300005330 Bacteria 8747
16 Ga0070690_100055473 3300005330 Bacteria 2538
17 Ga0070670_100000551 3300005331 Bacteria 29820
18 Ga0070677_10002125 3300005333 Bacteria 6326
19 Ga0070677_10022321 3300005333 Bacteria 2330
20 Ga0068869_100008973 3300005334 Bacteria 6473
21 Ga0068869_100099463 3300005334 Bacteria 2198
22 Ga0070666_10163536 3300005335 Bacteria 1556
23 Ga0070666_10406911 3300005335 Bacteria 979
24 Ga0068868_100212820 3300005338 Bacteria 1616
25 Ga0070687_100005942 3300005343 Bacteria 4965
26 Ga0070661_100344678 3300005344 Bacteria 1168
27 Ga0070692_10046875 3300005345 Bacteria 2235
28 Ga0070692_10331743 3300005345 Bacteria 939
29 Ga0070668_100043592 3300005347 Bacteria 3441
30 Ga0070669_100083900 3300005353 Bacteria 2376
31 Ga0070669_100212430 3300005353 Bacteria 1527
32 Ga0070675_100007500 3300005354 Bacteria 8431
33 Ga0070675_100007964 3300005354 Bacteria 8213
34 Ga0070675_100008296 3300005354 Bacteria 8061
35 Ga0070675_100010636 3300005354 Bacteria 7192
36 Ga0070674_100027447 3300005356 Bacteria 3731
37 Ga0070674_100077424 3300005356 Bacteria 2368
38 Ga0070674_100433213 3300005356 Bacteria 1082
39 Ga0070673_100018793 3300005364 Bacteria 4949
40 Ga0070673_100048042 3300005364 Bacteria 3324
41 Ga0070688_100006404 3300005365 Bacteria 6292
42 Ga0070667_100081741 3300005367 Bacteria 2765
43 Ga0070713_100000019 3300005436 Bacteria 110100
44 Ga0070701_10003666 3300005438 Bacteria 6121
45 Ga0070705_100730432 3300005440 Bacteria 781
46 Ga0070700_100005943 3300005441 Bacteria 6485
47 Ga0070708_100005508 3300005445 Bacteria 10036
48 Ga0070708_100675802 3300005445 Bacteria 972
49 Ga0070663_100012763 3300005455 Bacteria 5327
50 Ga0070663_100272818 3300005455 Bacteria 1345
51 Ga0070678_100045740 3300005456 Bacteria 3133
52 Ga0070678_100156577 3300005456 Bacteria 1841
53 Ga0070678_100278129 3300005456 Bacteria 1414
54 Ga0070662_100218913 3300005457 Bacteria 1518
55 Ga0070662_100221778 3300005457 Bacteria 1509
56 Ga0070662_100308200 3300005457 Bacteria 1288
57 Ga0068867_100000886 3300005459 Bacteria 20261
58 Ga0068867_100008279 3300005459 Bacteria 7343
59 Ga0068867_100051089 3300005459 Bacteria 3048
60 Ga0070685_10046004 3300005466 Bacteria 2504
61 Ga0070706_100009938 3300005467 Bacteria 8835
62 Ga0070706_100260611 3300005467 Bacteria 1618
63 Ga0070707_100059396 3300005468 Bacteria 3668
64 Ga0070707_100525032 3300005468 Bacteria 1146
65 Ga0070698_100681333 3300005471 Bacteria 970
66 Ga0070684_100708320 3300005535 Bacteria 939
67 Ga0070697_100673795 3300005536 Bacteria 912
68 Ga0070697_100683819 3300005536 Bacteria 905
69 Ga0070672_100040883 3300005543 Bacteria 3561
70 Ga0070672_100144388 3300005543 Bacteria 1965
71 Ga0070672_100180321 3300005543 Bacteria 1760
72 Ga0070686_100019172 3300005544 Bacteria 4027
73 Ga0070686_100028541 3300005544 Bacteria 3385
74 Ga0070695_100119767 3300005545 Bacteria 1799
75 Ga0070695_100128764 3300005545 Bacteria 1742
76 Ga0070665_101041508 3300005548 Bacteria 830
77 Ga0070704_100222367 3300005549 Bacteria 1536
78 Ga0068855_100002319 3300005563 Bacteria 23529
79 Ga0068855_100127888 3300005563 Bacteria 2904
80 Ga0070664_100003421 3300005564 Bacteria 12818
81 Ga0070664_100159201 3300005564 Bacteria 1997
82 Ga0068857_100072146 3300005577 Bacteria 3077
83 Ga0068854_100136833 3300005578 Bacteria 1876
84 Ga0068854_100676337 3300005578 Bacteria 889
85 Ga0068856_100008888 3300005614 Bacteria 9776
86 Ga0068856_100260338 3300005614 Bacteria 1750
87 Ga0070702_100023707 3300005615 Bacteria 3264
88 Ga0070702_100085474 3300005615 Bacteria 1900
89 Ga0070702_100184881 3300005615 Unclassified 1367
90 Ga0068859_100119395 3300005617 Bacteria 2703
91 Ga0068859_100124881 3300005617 Bacteria 2642
92 Ga0068859_100684771 3300005617 Bacteria 1116
93 Ga0068859_100769934 3300005617 Bacteria 1051
94 Ga0068859_100906710 3300005617 Bacteria 966
95 Ga0068864_100815614 3300005618 Bacteria 918
96 Ga0068866_10037163 3300005718 Bacteria 2390
97 Ga0068866_10214713 3300005718 Bacteria 1157
98 Ga0068861_100014066 3300005719 Bacteria 5612
99 Ga0068861_100019596 3300005719 Bacteria 4832
100 Ga0068851_10050787 3300005834 Bacteria 2106
101 Ga0068870_10024911 3300005840 Bacteria 2965
102 Ga0068870_10028245 3300005840 Bacteria 2815
103 Ga0068863_100060203 3300005841 Bacteria 3591
104 Ga0068863_100069426 3300005841 Bacteria 3332
105 Ga0068863_100396367 3300005841 Bacteria 1349
106 Ga0068858_100020769 3300005842 Bacteria 6136
107 Ga0068858_100026414 3300005842 Bacteria 5395
108 Ga0068858_100663247 3300005842 Bacteria 1014
109 Ga0068860_100365139 3300005843 Bacteria 1423
110 Ga0068862_100014945 3300005844 Bacteria 6448
111 Ga0068862_100082484 3300005844 Bacteria 2790
112 Ga0068862_100098769 3300005844 Bacteria 2551
113 Ga0081539_10248262 3300005985 Bacteria 792
114 Ga0075365_10033611 3300006038 Bacteria 3306
115 Ga0075368_10004257 3300006042 Bacteria 4833
116 Ga0070712_100056929 3300006175 Bacteria 2744
117 Ga0070712_100225402 3300006175 Unclassified 1486
118 Ga0075366_10007413 3300006195 Bacteria 6059
119 Ga0097621_100022692 3300006237 Bacteria 4875
120 Ga0097621_100064581 3300006237 Bacteria 3011
121 Ga0097621_100155963 3300006237 Bacteria 1960
122 Ga0097621_100201509 3300006237 Bacteria 1728
123 Ga0097621_100314584 3300006237 Bacteria 1386
124 Ga0068871_100155319 3300006358 Bacteria 1954
125 Ga0068871_100465993 3300006358 Unclassified 1134
126 Ga0075428_100003491 3300006844 Bacteria 17218
127 Ga0075428_100016706 3300006844 Bacteria 8102
128 Ga0075428_100058651 3300006844 Bacteria 4214
129 Ga0075428_100106715 3300006844 Bacteria 3053
130 Ga0075428_100157886 3300006844 Bacteria 2462
131 Ga0075430_100006999 3300006846 Bacteria 9507
132 Ga0075430_100031941 3300006846 Bacteria 4469
133 Ga0075430_100068380 3300006846 Bacteria 2980
134 Ga0075430_100090568 3300006846 Bacteria 2558
135 Ga0075431_100001257 3300006847 Bacteria 23081
136 Ga0075431_100015457 3300006847 Bacteria 7734
137 Ga0075431_100046646 3300006847 Bacteria 4468
138 Ga0075431_100240231 3300006847 Bacteria 1843
139 Ga0075433_10044483 3300006852 Bacteria 3858
140 Ga0075433_10049169 3300006852 Bacteria 3669
141 Ga0075433_10409284 3300006852 Bacteria 1197
142 Ga0075434_100095070 3300006871 Bacteria 2985
143 Ga0075434_100310760 3300006871 Bacteria 1596
144 Ga0075434_100502117 3300006871 Bacteria 1234
145 Ga0075434_100638670 3300006871 Bacteria 1083
146 Ga0075429_100019915 3300006880 Bacteria 5818
147 Ga0075429_100026174 3300006880 Bacteria 5063
148 Ga0075429_100042154 3300006880 Bacteria 3973
149 Ga0075429_100102956 3300006880 Bacteria 2493
150 Ga0075429_100482085 3300006880 Bacteria 1087
151 Ga0068865_100006000 3300006881 Bacteria 7399
152 Ga0068865_100063988 3300006881 Bacteria 2587
153 Ga0097620_100119392 3300006931 Bacteria 2703
154 Ga0097620_100124880 3300006931 Bacteria 2642
155 Ga0097620_100684760 3300006931 Bacteria 1116
156 Ga0097620_100769685 3300006931 Bacteria 1051
157 Ga0097620_100906817 3300006931 Bacteria 966
158 Ga0075435_100060145 3300007076 Bacteria 3080
159 Ga0075435_100263720 3300007076 Bacteria 1468
160 Ga0099794_10009248 3300007265 Bacteria 4132
161 Ga0105240_10000734 3300009093 Bacteria 59913
162 Ga0111539_10002915 3300009094 Bacteria 22692
163 Ga0111539_10011092 3300009094 Bacteria 11338
164 Ga0111539_10031756 3300009094 Bacteria 6416
165 Ga0111539_10080840 3300009094 Bacteria 3823
166 Ga0111539_11004256 3300009094 Bacteria 970
167 Ga0105245_10194145 3300009098 Bacteria 1946
168 Ga0105247_10140653 3300009101 Bacteria 1581
169 Ga0114129_10004906 3300009147 Bacteria 18881
170 Ga0114129_10029113 3300009147 Bacteria 7824
171 Ga0114129_10045106 3300009147 Bacteria 6198
172 Ga0114129_10068262 3300009147 Bacteria 4957
173 Ga0114129_10083102 3300009147 Bacteria 4449
174 Ga0114129_10117463 3300009147 Bacteria 3665
175 Ga0114129_10394476 3300009147 Bacteria 1825
176 Ga0114129_10580653 3300009147 Bacteria 1454
177 Ga0114129_11244147 3300009147 Bacteria 925
178 Ga0105243_10007132 3300009148 Bacteria 8593
179 Ga0105243_10048290 3300009148 Bacteria 3355
180 Ga0105241_10018009 3300009174 Bacteria 5193
181 Ga0105241_10020571 3300009174 Bacteria 4877
182 Ga0105241_10058268 3300009174 Bacteria 2966
183 Ga0105242_10014810 3300009176 Bacteria 6040
184 Ga0105242_10019855 3300009176 Bacteria 5264
185 Ga0105248_10087734 3300009177 Bacteria 3501
186 Ga0105248_10540600 3300009177 Bacteria 1314
187 Ga0105238_10002765 3300009551 Bacteria 17510
188 Ga0105238_10175263 3300009551 Bacteria 2121
189 Ga0105238_10927270 3300009551 Unclassified 890
190 Ga0105249_10028100 3300009553 Bacteria 5077
191 Ga0105249_10166743 3300009553 Bacteria 2133
192 Ga0105249_10513162 3300009553 Bacteria 1245
193 Ga0105239_10053152 3300010375 Bacteria 4444
194 Ga0105239_10562445 3300010375 Bacteria 1299
195 Ga0105246_10085081 3300011119 Bacteria 2264
196 Ga0157370_10000734 3300013104 Bacteria 41162
197 Ga0157372_10289214 3300013307 Unclassified 1906
198 Ga0157375_10172163 3300013308 Bacteria 2313
199 Ga0157375_10963925 3300013308 Bacteria 994
200 Ga0163163_10006918 3300014325 Bacteria 9957
201 Ga0163163_10075503 3300014325 Bacteria 3364
202 Ga0163163_10141536 3300014325 Bacteria 2448
203 Ga0157380_10005110 3300014326 Bacteria 9169
204 Ga0157380_10017884 3300014326 Bacteria 5255
205 Ga0157380_10023764 3300014326 Bacteria 4628
206 Ga0157380_10091046 3300014326 Bacteria 2517
207 Ga0157380_10095837 3300014326 Bacteria 2459
208 Ga0157380_10321757 3300014326 Bacteria 1434
209 Ga0157377_10024065 3300014745 Bacteria 3234
210 Ga0157379_10072637 3300014968 Bacteria 3078
211 Ga0182006_1010859 3300015261 Bacteria 4030
212 Ga0182007_10007428 3300015262 Bacteria 4596
213 Ga0182005_1000549 3300015265 Bacteria 18864
214 Ga0209760_101786 3300025207 Bacteria 2146
215 Ga0209784_100027 3300025224 Bacteria 363933
216 Ga0209566_100027 3300025225 Bacteria 363933
217 Ga0209674_100044 3300025226 Bacteria 363933
218 Ga0209563_100048 3300025230 Bacteria 363933
219 Ga0207427_100975 3300025231 Bacteria 12124
220 Ga0209437_100055 3300025233 Bacteria 363933
221 Ga0209026_1003458 3300025250 Bacteria 5163
222 Ga0209677_100028 3300025253 Bacteria 363933
223 Ga0209233_1000070 3300025261 Bacteria 363933
224 Ga0209676_1000296 3300025292 Bacteria 100635
225 Ga0209050_1009567 3300025298 Bacteria 4938
226 Ga0207656_10075970 3300025321 Bacteria 1502
227 Ga0207682_10001859 3300025893 Bacteria 9609
228 Ga0207642_10037145 3300025899 Bacteria 2096
229 Ga0207642_10173099 3300025899 Bacteria 1170
230 Ga0207680_10366045 3300025903 Bacteria 1014
231 Ga0207680_10596849 3300025903 Bacteria 790
232 Ga0207645_10012549 3300025907 Bacteria 5747
233 Ga0207643_10004696 3300025908 Bacteria 7329
234 Ga0207643_10014030 3300025908 Bacteria 4348
235 Ga0207643_10140073 3300025908 Bacteria 1444
236 Ga0207643_10162359 3300025908 Bacteria 1345
237 Ga0207684_10045767 3300025910 Bacteria 3711
238 Ga0207654_10009395 3300025911 Bacteria 4966
239 Ga0207654_10016074 3300025911 Bacteria 3892
240 Ga0207654_10388116 3300025911 Bacteria 968
241 Ga0207695_10174635 3300025913 Bacteria 2072
242 Ga0207695_10491915 3300025913 Bacteria 1109
243 Ga0207693_10077128 3300025915 Bacteria 2610
244 Ga0207660_10212566 3300025917 Bacteria 1515
245 Ga0207662_10010360 3300025918 Bacteria 5146
246 Ga0207646_10089768 3300025922 Bacteria 2751
247 Ga0207646_10135458 3300025922 Bacteria 2217
248 Ga0207646_10675255 3300025922 Bacteria 925
249 Ga0207681_10051353 3300025923 Bacteria 2793
250 Ga0207694_10005002 3300025924 Bacteria 10255
251 Ga0207694_10018516 3300025924 Bacteria 5262
252 Ga0207650_10024634 3300025925 Bacteria 4280
253 Ga0207659_10007712 3300025926 Bacteria 6643
254 Ga0207659_10008090 3300025926 Bacteria 6508
255 Ga0207659_10023359 3300025926 Bacteria 4125
256 Ga0207659_10072426 3300025926 Unclassified 2519
257 Ga0207659_10200209 3300025926 Bacteria 1594
258 Ga0207687_10008548 3300025927 Bacteria 6695
259 Ga0207687_10066611 3300025927 Bacteria 2560
260 Ga0207700_10000035 3300025928 Bacteria 119648
261 Ga0207644_10067979 3300025931 Unclassified 2598
262 Ga0207686_10014657 3300025934 Bacteria 4369
263 Ga0207709_10028327 3300025935 Bacteria 3238
264 Ga0207669_10016569 3300025937 Bacteria 3749
265 Ga0207669_10056859 3300025937 Bacteria 2378
266 Ga0207704_10003096 3300025938 Bacteria 7516
267 Ga0207704_10051431 3300025938 Bacteria 2491
268 Ga0207691_10002147 3300025940 Bacteria 19309
269 Ga0207691_10017156 3300025940 Bacteria 6868
270 Ga0207691_10038732 3300025940 Bacteria 4411
271 Ga0207691_10054221 3300025940 Bacteria 3658
272 Ga0207711_11079699 3300025941 Bacteria 743
273 Ga0207689_10003653 3300025942 Bacteria 14033
274 Ga0207689_10111166 3300025942 Bacteria 2252
275 Ga0207679_10178456 3300025945 Bacteria 1755
276 Ga0207667_10049736 3300025949 Bacteria 4425
277 Ga0207667_10296878 3300025949 Bacteria 1651
278 Ga0207667_10394783 3300025949 Bacteria 1409
279 Ga0207651_10003459 3300025960 Bacteria 7760
280 Ga0207651_10142970 3300025960 Bacteria 1851
281 Ga0207712_10046930 3300025961 Bacteria 2997
282 Ga0207640_10172498 3300025981 Bacteria 1613
283 Ga0207640_10408565 3300025981 Bacteria 1108
284 Ga0207658_10524542 3300025986 Bacteria 1057
285 Ga0207703_10044455 3300026035 Bacteria 3570
286 Ga0207703_10102538 3300026035 Bacteria 2428
287 Ga0207703_10170981 3300026035 Bacteria 1911
288 Ga0207703_10385380 3300026035 Bacteria 1297
289 Ga0207678_10007160 3300026067 Bacteria 9890
290 Ga0207678_10187809 3300026067 Bacteria 1765
291 Ga0207708_10003065 3300026075 Bacteria 12311
292 Ga0207708_10077228 3300026075 Bacteria 2555
293 Ga0207702_10056432 3300026078 Bacteria 3335
294 Ga0207702_10292935 3300026078 Bacteria 1542
295 Ga0207641_10060409 3300026088 Bacteria 3231
296 Ga0207648_10002276 3300026089 Bacteria 20746
297 Ga0207648_10012934 3300026089 Bacteria 7794
298 Ga0207648_10023911 3300026089 Bacteria 5462
299 Ga0207676_10413643 3300026095 Bacteria 1263
300 Ga0207674_10079754 3300026116 Bacteria 3277
301 Ga0207674_10781771 3300026116 Bacteria 921
302 Ga0207675_100014637 3300026118 Bacteria 7314
303 Ga0207675_100015705 3300026118 Bacteria 7062
304 Ga0207675_100130021 3300026118 Bacteria 2387
305 Ga0207675_100564853 3300026118 Bacteria 1138
306 Ga0207683_10115450 3300026121 Bacteria 2407
307 Ga0209588_1007034 3300027671 Bacteria 3299
308 Ga0209813_10003620 3300027866 Bacteria 3631
309 Ga0207428_10000492 3300027907 Bacteria 47217
310 Ga0207428_10005028 3300027907 Bacteria 12434
311 Ga0207428_10101069 3300027907 Bacteria 2228
312 Ga0268266_10853634 3300028379 Bacteria 880
313 Ga0268265_10031787 3300028380 Bacteria 3815
314 Ga0268265_10031922 3300028380 Bacteria 3809
315 Ga0268265_10061660 3300028380 Bacteria 2878
316 Ga0268265_10080625 3300028380 Bacteria 2567
317 Ga0268264_10148322 3300028381 Bacteria 2100
318 Ga0268264_10323088 3300028381 Bacteria 1460
319 Ga0265327_10003716 3300031251 Bacteria 14213
320 Ga0316575_10107092 3300031665 Bacteria 1139
321 Ga0316579_10000345 3300031691 Bacteria 14533
322 Ga0265314_10000345 3300031711 Bacteria 64760
323 Ga0316576_10002241 3300031727 Bacteria 10938
324 Ga0316576_10002791 3300031727 Bacteria 10041
325 Ga0316578_10021105 3300031728 Bacteria 3612
326 Ga0316578_10083054 3300031728 Bacteria 1907
327 Ga0316577_10000690 3300031733 Bacteria 14231
328 Ga0316577_10001565 3300031733 Bacteria 10879
329 Ga0307413_10192570 3300031824 Bacteria 1465
330 Ga0307406_10192606 3300031901 Bacteria 1494
331 Ga0307416_100846733 3300032002 Bacteria 1012
332 Ga0307414_10000544 3300032004 Bacteria 19666
333 Ga0307414_10010641 3300032004 Bacteria 5350
334 Ga0307414_10163422 3300032004 Bacteria 1771
335 Ga0307411_10064246 3300032005 Bacteria 2457
336 Ga0316585_10000407 3300032137 Bacteria 9971
337 Ga0316580_10000046 3300032139 Bacteria 18876
338 Ga0316596_1007459 3300033541 Bacteria 2584
339 Ga0373929_0039395 3300035085 Bacteria 1044
340 Ga0316574_0001835 3300035398 Bacteria 10351
341 Ga0316574_0055025 3300035398 Bacteria 2486
342 Ga0316574_0143836 3300035398 Bacteria 1537
343 Ga0316574_0181821 3300035398 Bacteria 1353
344 Ga0316582_0000610 3300036647 Bacteria 13886
345 Ga0316582_0001780 3300036647 Bacteria 9723
346 Ga0316584_0001039 3300036712 Bacteria 16112
347 Ga0316584_0040488 3300036712 Bacteria 3471
348 Ga0400483_036984 3300039062 Bacteria 2214
349 Ga0400483_147682 3300039062 Bacteria 2008
350 Ga0451853_1986860 3300041512 Bacteria 1683
351 Ga0495592_0017951 3300046454 Bacteria 5376
352 Ga0495651_0043366 3300046462 Bacteria 3490
353 Ga0495651_0074939 3300046462 Bacteria 2566
354 Ga0495653_0076876 3300046463 Bacteria 2480
355 Ga0495582_0258059 3300046473 Bacteria 1000
356 Ga0495582_0358520 3300046473 Unclassified 840
357 Ga0495608_0024144 3300046511 Bacteria 4159
358 Ga0495628_0002898 3300046516 Bacteria 15361
359 Ga0495652_0094281 3300046529 Bacteria 2441
360 Ga0495645_0033143 3300046543 Bacteria 3768
361 Ga0495659_0001634 3300046664 Bacteria 7520
362 Ga0495659_0018133 3300046664 Bacteria 2341
363 Ga0495657_0047093 3300046675 Bacteria 2917
364 Ga0495599_0001451 3300046678 Bacteria 13605
365 Ga0495623_0164326 3300046679 Bacteria 1302
366 Ga0495658_0201946 3300046683 Bacteria 1239
367 Ga0495658_0450790 3300046683 Bacteria 822
368 Ga0495624_0065174 3300046690 Bacteria 2276
369 Ga0495600_0000415 3300046809 Bacteria 22050
370 Ga0495676_0132523 3300047321 Bacteria 1797
371 Ga0495684_0287535 3300047471 Unclassified 1184
372 Ga0496110_0003191 3300048913 Bacteria 12482
373 Ga0496110_0525700 3300048913 Bacteria 1076
374 Ga0501292_010335 3300049515 Bacteria 1396
375 Ga0501033_0008374 3300049570 Bacteria 8008
376 Ga0501034_0294889 3300049571 Bacteria 1559
377 Ga0501036_0020609 3300049572 Bacteria 5538
378 Ga0501036_0074227 3300049572 Unclassified 2876
379 Ga0501038_0029034 3300049574 Unclassified 4906
380 Ga0501039_0045839 3300049575 Unclassified 3378
381 Ga0501040_0003785 3300049576 Bacteria 9810
382 Ga0501041_0039777 3300049577 Unclassified 2853
383 Ga0501042_0013001 3300049578 Bacteria 5655
384 Ga0501042_0042504 3300049578 Bacteria 3235
385 Ga0501042_0077251 3300049578 Bacteria 2384
386 Ga0501042_0580763 3300049578 Bacteria 815
387 Ga0501043_0116428 3300049579 Unclassified 2097
388 Ga0501046_0048367 3300049580 Bacteria 3368
389 Ga0501046_0074953 3300049580 Unclassified 2624
390 Ga0501048_0259534 3300049582 Unclassified 1234
391 Ga0501048_0260649 3300049582 Bacteria 1232
392 Ga0501068_0033670 3300049584 Unclassified 3052
393 Ga0501068_0303201 3300049584 Bacteria 1023
394 Ga0501068_0309784 3300049584 Bacteria 1011
395 Ga0501071_0010035 3300049587 Bacteria 6329
396 Ga0501071_0016092 3300049587 Bacteria 5142
397 Ga0501072_0024273 3300049588 Unclassified 4715
398 Ga0501073_0035801 3300049589 Bacteria 3527
399 Ga0501074_0041994 3300049590 Unclassified 3310
400 Ga0501075_0002870 3300049591 Bacteria 11558
401 Ga0501076_0000561 3300049592 Bacteria 23678
402 Ga0501076_0074268 3300049592 Bacteria 2723
403 Ga0501077_0003692 3300049593 Bacteria 9204
404 Ga0501256_010765 3300049685 Bacteria 876
405 Ga0501079_0013602 3300049741 Bacteria 6207
406 Ga0501079_0134503 3300049741 Bacteria 1925
407 Ga0501080_0103402 3300049742 Unclassified 2641
408 Ga0501080_0176547 3300049742 Bacteria 1967
409 Ga0501081_0011086 3300049743 Bacteria 5895
410 Ga0501035_0252152 3300049822 Unclassified 1498
411 Ga0501045_0004067 3300049824 Archaea 10093
412 Ga0501045_0265630 3300049824 Bacteria 1278
413 Ga0501045_0426142 3300049824 Bacteria 987
414 nmdc:mga03683_127305_c1 3300050489 Bacteria 1137
415 nmdc:mga00v17_47119_c1 3300050491 Bacteria 2610
416 nmdc:mga0k408_1239_c1 3300050493 Bacteria 13968
417 nmdc:mga04h51_2196_c1 3300050495 Bacteria 4585
418 nmdc:mga05p37_184833_c1 3300050507 Bacteria 1361
419 nmdc:mga05p37_217476_c1 3300050507 Bacteria 2307
420 nmdc:mga05p37_35196_c1 3300050507 Bacteria 6139
421 nmdc:mga05p37_39274_c1 3300050507 Bacteria 5810
422 nmdc:mga05p37_7469_c1 3300050507 Bacteria 12888
423 nmdc:mga09592_113910_c1 3300050508 Bacteria 2321
424 nmdc:mga09592_39337_c1 3300050508 Bacteria 3972
425 nmdc:mga09592_569124_c1 3300050508 Bacteria 972
426 nmdc:mga09592_917352_c1 3300050508 Unclassified 736
427 nmdc:mga0qj67_28047_c1 3300050509 Bacteria 4368
428 nmdc:mga0qj67_44542_c1 3300050509 Bacteria 3498
429 nmdc:mga0qj67_61550_c1 3300050509 Bacteria 2980
430 nmdc:mga06r32_197313_c1 3300050510 Bacteria 2000
431 nmdc:mga06r32_224643_c1 3300050510 Bacteria 1866
432 nmdc:mga06r32_563239_c1 3300050510 Unclassified 1113
433 nmdc:mga06r32_73514_c1 3300050510 Bacteria 3312
434 nmdc:mga06r32_8374_c1 3300050510 Bacteria 9314
435 nmdc:mga08y16_10248_c1 3300050511 Bacteria 9836
436 nmdc:mga08y16_13304_c1 3300050511 Bacteria 8654
437 nmdc:mga08y16_39359_c1 3300050511 Bacteria 4961
438 nmdc:mga0n895_121155_c1 3300050512 Bacteria 2637
439 nmdc:mga0n895_63085_c1 3300050512 Bacteria 3664
440 nmdc:mga0n895_722950_c1 3300050512 Bacteria 990
441 nmdc:mga0n895_86838_c1 3300050512 Bacteria 3125
442 nmdc:mga0rr50_251457_c1 3300050513 Bacteria 1468
443 nmdc:mga0rr50_43572_c1 3300050513 Bacteria 3285
444 nmdc:mga0a205_27907_c1 3300050515 Bacteria 5393
445 Ga0495601_0006685 3300053077 Bacteria 6749
446 Ga0500595_000971 3300053119 Bacteria 16107
447 Ga0500619_000213 3300053154 Bacteria 13276
448 Ga0501084_0003335 3300054114 Bacteria 12999
449 Ga0501082_0001414 3300060353 Bacteria 21093
450 Ga0501082_0163579 3300060353 Bacteria 1934
451 Ga0501082_0335318 3300060353 Bacteria 1318
452 Ga0530510_0030368 3300061734 Bacteria 3882
453 Ga0530510_0285485 3300061734 Unclassified 1233
454 2819544419 2818991436 Bacteria 5376622
455 2852657218 2852653556 Bacteria 4050083
456 Ga0495656_0000031
457 JGI24746J21847_1002519
458 JGI25162J39368_1000268
459 JGI25164J39214_1012064
460 JGI25165J46597_1000270
461 Ga0055538_1000105
462 Ga0055539_1000153
463 Ga0055533_1000155
464 Ga0055525_1000208
465 Ga0055536_1021126
466 Ga0055541_1000102
467 Ga0058861_10034114
468 Ga0070676_10027032
469 Ga0070683_100046971
470 Ga0070690_100003343
471 Ga0070690_100055473
472 Ga0070670_100000551
473 Ga0070677_10002125
474 Ga0070677_10022321
475 Ga0068869_100008973
476 Ga0068869_100099463
477 Ga0070666_10163536
478 Ga0070666_10406911
479 Ga0068868_100212820
480 Ga0070687_100005942
481 Ga0070661_100344678
482 Ga0070692_10046875
483 Ga0070692_10331743
484 Ga0070668_100043592
485 Ga0070669_100083900
486 Ga0070669_100212430
487 Ga0070675_100007500
488 Ga0070675_100007964
489 Ga0070675_100008296
490 Ga0070675_100010636
491 Ga0070674_100027447
492 Ga0070674_100077424
493 Ga0070674_100433213
494 Ga0070673_100018793
495 Ga0070673_100048042
496 Ga0070688_100006404
497 Ga0070667_100081741
498 Ga0070713_100000019
499 Ga0070701_10003666
500 Ga0070705_100730432
501 Ga0070700_100005943
502 Ga0070708_100005508
503 Ga0070708_100675802
504 Ga0070663_100012763
505 Ga0070663_100272818
506 Ga0070678_100045740
507 Ga0070678_100156577
508 Ga0070678_100278129
509 Ga0070662_100218913
510 Ga0070662_100221778
511 Ga0070662_100308200
512 Ga0068867_100000886
513 Ga0068867_100008279
514 Ga0068867_100051089
515 Ga0070685_10046004
516 Ga0070706_100009938
517 Ga0070706_100260611
518 Ga0070707_100059396
519 Ga0070707_100525032
520 Ga0070698_100681333
521 Ga0070684_100708320
522 Ga0070697_100673795
523 Ga0070697_100683819
524 Ga0070672_100040883
525 Ga0070672_100144388
526 Ga0070672_100180321
527 Ga0070686_100019172
528 Ga0070686_100028541
529 Ga0070695_100119767
530 Ga0070695_100128764
531 Ga0070665_101041508
532 Ga0070704_100222367
533 Ga0068855_100002319
534 Ga0068855_100127888
535 Ga0070664_100003421
536 Ga0070664_100159201
537 Ga0068857_100072146
538 Ga0068854_100136833
539 Ga0068854_100676337
540 Ga0068856_100008888
541 Ga0068856_100260338
542 Ga0070702_100023707
543 Ga0070702_100085474
544 Ga0070702_100184881
545 Ga0068859_100119395
546 Ga0068859_100124881
547 Ga0068859_100684771
548 Ga0068859_100769934
549 Ga0068859_100906710
550 Ga0068864_100815614
551 Ga0068866_10037163
552 Ga0068866_10214713
553 Ga0068861_100014066
554 Ga0068861_100019596
555 Ga0068851_10050787
556 Ga0068870_10024911
557 Ga0068870_10028245
558 Ga0068863_100060203
559 Ga0068863_100069426
560 Ga0068863_100396367
561 Ga0068858_100020769
562 Ga0068858_100026414
563 Ga0068858_100663247
564 Ga0068860_100365139
565 Ga0068862_100014945
566 Ga0068862_100082484
567 Ga0068862_100098769
568 Ga0081539_10248262
569 Ga0075365_10033611
570 Ga0075368_10004257
571 Ga0070712_100056929
572 Ga0070712_100225402
573 Ga0075366_10007413
574 Ga0097621_100022692
575 Ga0097621_100064581
576 Ga0097621_100155963
577 Ga0097621_100201509
578 Ga0097621_100314584
579 Ga0068871_100155319
580 Ga0068871_100465993
581 Ga0075428_100003491
582 Ga0075428_100016706
583 Ga0075428_100058651
584 Ga0075428_100106715
585 Ga0075428_100157886
586 Ga0075430_100006999
587 Ga0075430_100031941
588 Ga0075430_100068380
589 Ga0075430_100090568
590 Ga0075431_100001257
591 Ga0075431_100015457
592 Ga0075431_100046646
593 Ga0075431_100240231
594 Ga0075433_10044483
595 Ga0075433_10049169
596 Ga0075433_10409284
597 Ga0075434_100095070
598 Ga0075434_100310760
599 Ga0075434_100502117
600 Ga0075434_100638670
601 Ga0075429_100019915
602 Ga0075429_100026174
603 Ga0075429_100042154
604 Ga0075429_100102956
605 Ga0075429_100482085
606 Ga0068865_100006000
607 Ga0068865_100063988
608 Ga0097620_100119392
609 Ga0097620_100124880
610 Ga0097620_100684760
611 Ga0097620_100769685
612 Ga0097620_100906817
613 Ga0075435_100060145
614 Ga0075435_100263720
615 Ga0099794_10009248
616 Ga0105240_10000734
617 Ga0111539_10002915
618 Ga0111539_10011092
619 Ga0111539_10031756
620 Ga0111539_10080840
621 Ga0111539_11004256
622 Ga0105245_10194145
623 Ga0105247_10140653
624 Ga0114129_10004906
625 Ga0114129_10029113
626 Ga0114129_10045106
627 Ga0114129_10068262
628 Ga0114129_10083102
629 Ga0114129_10117463
630 Ga0114129_10394476
631 Ga0114129_10580653
632 Ga0114129_11244147
633 Ga0105243_10007132
634 Ga0105243_10048290
635 Ga0105241_10018009
636 Ga0105241_10020571
637 Ga0105241_10058268
638 Ga0105242_10014810
639 Ga0105242_10019855
640 Ga0105248_10087734
641 Ga0105248_10540600
642 Ga0105238_10002765
643 Ga0105238_10175263
644 Ga0105238_10927270
645 Ga0105249_10028100
646 Ga0105249_10166743
647 Ga0105249_10513162
648 Ga0105239_10053152
649 Ga0105239_10562445
650 Ga0105246_10085081
651 Ga0157370_10000734
652 Ga0157372_10289214
653 Ga0157375_10172163
654 Ga0157375_10963925
655 Ga0163163_10006918
656 Ga0163163_10075503
657 Ga0163163_10141536
658 Ga0157380_10005110
659 Ga0157380_10017884
660 Ga0157380_10023764
661 Ga0157380_10091046
662 Ga0157380_10095837
663 Ga0157380_10321757
664 Ga0157377_10024065
665 Ga0157379_10072637
666 Ga0182006_1010859
667 Ga0182007_10007428
668 Ga0182005_1000549
669 Ga0209760_101786
670 Ga0209784_100027
671 Ga0209566_100027
672 Ga0209674_100044
673 Ga0209563_100048
674 Ga0207427_100975
675 Ga0209437_100055
676 Ga0209026_1003458
677 Ga0209677_100028
678 Ga0209233_1000070
679 Ga0209676_1000296
680 Ga0209050_1009567
681 Ga0207656_10075970
682 Ga0207682_10001859
683 Ga0207642_10037145
684 Ga0207642_10173099
685 Ga0207680_10366045
686 Ga0207680_10596849
687 Ga0207645_10012549
688 Ga0207643_10004696
689 Ga0207643_10014030
690 Ga0207643_10140073
691 Ga0207643_10162359
692 Ga0207684_10045767
693 Ga0207654_10009395
694 Ga0207654_10016074
695 Ga0207654_10388116
696 Ga0207695_10174635
697 Ga0207695_10491915
698 Ga0207693_10077128
699 Ga0207660_10212566
700 Ga0207662_10010360
701 Ga0207646_10089768
702 Ga0207646_10135458
703 Ga0207646_10675255
704 Ga0207681_10051353
705 Ga0207694_10005002
706 Ga0207694_10018516
707 Ga0207650_10024634
708 Ga0207659_10007712
709 Ga0207659_10008090
710 Ga0207659_10023359
711 Ga0207659_10072426
712 Ga0207659_10200209
713 Ga0207687_10008548
714 Ga0207687_10066611
715 Ga0207700_10000035
716 Ga0207644_10067979
717 Ga0207686_10014657
718 Ga0207709_10028327
719 Ga0207669_10016569
720 Ga0207669_10056859
721 Ga0207704_10003096
722 Ga0207704_10051431
723 Ga0207691_10002147
724 Ga0207691_10017156
725 Ga0207691_10038732
726 Ga0207691_10054221
727 Ga0207711_11079699
728 Ga0207689_10003653
729 Ga0207689_10111166
730 Ga0207679_10178456
731 Ga0207667_10049736
732 Ga0207667_10296878
733 Ga0207667_10394783
734 Ga0207651_10003459
735 Ga0207651_10142970
736 Ga0207712_10046930
737 Ga0207640_10172498
738 Ga0207640_10408565
739 Ga0207658_10524542
740 Ga0207703_10044455
741 Ga0207703_10102538
742 Ga0207703_10170981
743 Ga0207703_10385380
744 Ga0207678_10007160
745 Ga0207678_10187809
746 Ga0207708_10003065
747 Ga0207708_10077228
748 Ga0207702_10056432
749 Ga0207702_10292935
750 Ga0207641_10060409
751 Ga0207648_10002276
752 Ga0207648_10012934
753 Ga0207648_10023911
754 Ga0207676_10413643
755 Ga0207674_10079754
756 Ga0207674_10781771
757 Ga0207675_100014637
758 Ga0207675_100015705
759 Ga0207675_100130021
760 Ga0207675_100564853
761 Ga0207683_10115450
762 Ga0209588_1007034
763 Ga0209813_10003620
764 Ga0207428_10000492
765 Ga0207428_10005028
766 Ga0207428_10101069
767 Ga0268266_10853634
768 Ga0268265_10031787
769 Ga0268265_10031922
770 Ga0268265_10061660
771 Ga0268265_10080625
772 Ga0268264_10148322
773 Ga0268264_10323088
774 Ga0265327_10003716
775 Ga0316575_10107092
776 Ga0316579_10000345
777 Ga0265314_10000345
778 Ga0316576_10002241
779 Ga0316576_10002791
780 Ga0316578_10021105
781 Ga0316578_10083054
782 Ga0316577_10000690
783 Ga0316577_10001565
784 Ga0307413_10192570
785 Ga0307406_10192606
786 Ga0307416_100846733
787 Ga0307414_10000544
788 Ga0307414_10010641
789 Ga0307414_10163422
790 Ga0307411_10064246
791 Ga0316585_10000407
792 Ga0316580_10000046
793 Ga0316596_1007459
794 Ga0373929_0039395
795 Ga0316574_0001835
796 Ga0316574_0055025
797 Ga0316574_0143836
798 Ga0316574_0181821
799 Ga0316582_0000610
800 Ga0316582_0001780
801 Ga0316584_0001039
802 Ga0316584_0040488
803 Ga0400483_036984
804 Ga0400483_147682
805 Ga0451853_1986860
806 Ga0495592_0017951
807 Ga0495651_0043366
808 Ga0495651_0074939
809 Ga0495653_0076876
810 Ga0495582_0258059
811 Ga0495582_0358520
812 Ga0495608_0024144
813 Ga0495628_0002898
814 Ga0495652_0094281
815 Ga0495645_0033143
816 Ga0495659_0001634
817 Ga0495659_0018133
818 Ga0495657_0047093
819 Ga0495599_0001451
820 Ga0495623_0164326
821 Ga0495658_0201946
822 Ga0495658_0450790
823 Ga0495624_0065174
824 Ga0495600_0000415
825 Ga0495676_0132523
826 Ga0495684_0287535
827 Ga0496110_0003191
828 Ga0496110_0525700
829 Ga0501292_010335
830 Ga0501033_0008374
831 Ga0501034_0294889
832 Ga0501036_0020609
833 Ga0501036_0074227
834 Ga0501038_0029034
835 Ga0501039_0045839
836 Ga0501040_0003785
837 Ga0501041_0039777
838 Ga0501042_0013001
839 Ga0501042_0042504
840 Ga0501042_0077251
841 Ga0501042_0580763
842 Ga0501043_0116428
843 Ga0501046_0048367
844 Ga0501046_0074953
845 Ga0501048_0259534
846 Ga0501048_0260649
847 Ga0501068_0033670
848 Ga0501068_0303201
849 Ga0501068_0309784
850 Ga0501071_0010035
851 Ga0501071_0016092
852 Ga0501072_0024273
853 Ga0501073_0035801
854 Ga0501074_0041994
855 Ga0501075_0002870
856 Ga0501076_0000561
857 Ga0501076_0074268
858 Ga0501077_0003692
859 Ga0501256_010765
860 Ga0501079_0013602
861 Ga0501079_0134503
862 Ga0501080_0103402
863 Ga0501080_0176547
864 Ga0501081_0011086
865 Ga0501035_0252152
866 Ga0501045_0004067
867 Ga0501045_0265630
868 Ga0501045_0426142
869 nmdc:mga03683_127305_c1
870 nmdc:mga00v17_47119_c1
871 nmdc:mga0k408_1239_c1
872 nmdc:mga04h51_2196_c1
873 nmdc:mga05p37_184833_c1
874 nmdc:mga05p37_217476_c1
875 nmdc:mga05p37_35196_c1
876 nmdc:mga05p37_39274_c1
877 nmdc:mga05p37_7469_c1
878 nmdc:mga09592_113910_c1
879 nmdc:mga09592_39337_c1
880 nmdc:mga09592_569124_c1
881 nmdc:mga09592_917352_c1
882 nmdc:mga0qj67_28047_c1
883 nmdc:mga0qj67_44542_c1
884 nmdc:mga0qj67_61550_c1
885 nmdc:mga06r32_197313_c1
886 nmdc:mga06r32_224643_c1
887 nmdc:mga06r32_563239_c1
888 nmdc:mga06r32_73514_c1
889 nmdc:mga06r32_8374_c1
890 nmdc:mga08y16_10248_c1
891 nmdc:mga08y16_13304_c1
892 nmdc:mga08y16_39359_c1
893 nmdc:mga0n895_121155_c1
894 nmdc:mga0n895_63085_c1
895 nmdc:mga0n895_722950_c1
896 nmdc:mga0n895_86838_c1
897 nmdc:mga0rr50_251457_c1
898 nmdc:mga0rr50_43572_c1
899 nmdc:mga0a205_27907_c1
900 Ga0495601_0006685
901 Ga0500595_000971
902 Ga0500619_000213
903 Ga0501084_0003335
904 Ga0501082_0001414
905 Ga0501082_0163579
906 Ga0501082_0335318
907 Ga0530510_0030368
908 Ga0530510_0285485
909 2819544419
910 2852657218

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17954

Pirin_C_2

Quercetinase C-terminal cupin domain

183

268

0.99

PF02678

Pirin

Pirin

40

156

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9673 1 236
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9655 1 235
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9491 1 235
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9431 1 236
2b8m-assembly1.cif.gz_A-2 crystal structure of a rmlc-like cupin family protein with a double-stranded beta-helix fold (mj0764) from methanocaldococcus jannaschii at 1.70 a resolution 0.8711 36 120
ID Description Score Start End Superfamily
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9928 13 131 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.987 11 135 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9789 11 135 2.60.120.10
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9765 13 131 2.60.120.10
af_F1QLW3_37_119_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9683 40 120 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A3B0T399-F1-model_v4 Pirin 1.001 5 134
AF-A0A4Q2XN04-F1-model_v4 Pirin family protein 1 3 129
AF-A0A7Z0V0A2-F1-model_v4 Putative Pirin family protein 0.9995 5 134 GO:0046872
AF-A0A2N2S4N4-F1-model_v4 Quercetin 2,3-dioxygenase 0.9977 5 139 GO:0051213
AF-A0A354XYT3-F1-model_v4 Pirin N-terminal domain-containing protein 0.9967 5 136

Map