F447664

General Info

Members Datasets Scaffolds Average Seq Length
455 213 910 307

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0003782|Ga0496126_0003782_8255_9361
Length 368
Sequence VQTTELSATQSLAWHTGQTSRSSSLNDFVNSTIASMLSQRERVNTMRPGHDTINADMTNQPHVLDGVAIASEIKAEVGREVTALSAKGITPGLAVILVGNVAASEIYVRSKVKTCGELGIFSEMLTPPESITTEEMLELVAKLNARDDIDGILIQLPLPKHVDTKRLLEAVSPDKDVDGFHPVNAGRLQSGQPGLAPCTPAGIIEILKRSKLPIAGQNAVVLGRSDIVGKPAALMLLNESATVTVCHSKTRDLPAVTRNADILVAAIGRPGYVTPEMVRPGAVLIDVGINRLTDAADVERFFAGDAVRAATFAKRGSVIVGDVHPAAFAISSAYTPVPGGVGALTIAMLMHNTVKAAKLRRGIPVERV

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
32 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
33 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
36 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
58 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
59 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
108 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
111 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
112 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
113 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
114 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
115 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
116 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
117 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
121 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
122 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
123 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
124 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
125 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
128 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
129 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
135 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
136 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
137 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
146 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
147 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
148 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
149 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
150 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
158 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
159 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
163 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
166 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
167 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
168 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
169 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
170 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
171 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
172 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
173 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
181 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
208 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
210 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
211 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
212 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
213 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.88
Nodule 0
Rhizoplane 2.2
Rhizosphere 95.82
Stem 0
Stem Tuber 0
Unclassified 3.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0003782 3300048929 Bacteria 18781
2 Ga0070658_10002730 3300005327 Bacteria 14695
3 Ga0070658_10009570 3300005327 Bacteria 7779
4 Ga0070658_10031055 3300005327 Bacteria 4289
5 Ga0070658_10031101 3300005327 Bacteria 4286
6 Ga0070658_10134480 3300005327 Bacteria 2062
7 Ga0070683_100000210 3300005329 Bacteria 39660
8 Ga0070683_100014043 3300005329 Bacteria 6995
9 Ga0070683_100078140 3300005329 Bacteria 3095
10 Ga0070683_100138734 3300005329 Bacteria 2303
11 Ga0068869_100014715 3300005334 Bacteria 5232
12 Ga0068868_100000046 3300005338 Bacteria 68441
13 Ga0070660_100013531 3300005339 Bacteria 5855
14 Ga0070660_100045365 3300005339 Bacteria 3364
15 Ga0070689_100253371 3300005340 Bacteria 1453
16 Ga0070661_100056322 3300005344 Bacteria 2880
17 Ga0070661_100228531 3300005344 Bacteria 1429
18 Ga0070669_100261218 3300005353 Unclassified 1382
19 Ga0070671_100003795 3300005355 Bacteria 11855
20 Ga0070671_100011009 3300005355 Bacteria 7259
21 Ga0070671_100067313 3300005355 Bacteria 2986
22 Ga0070659_100034743 3300005366 Bacteria 3922
23 Ga0070667_100001013 3300005367 Bacteria 25735
24 Ga0070714_100037725 3300005435 Bacteria 4062
25 Ga0070714_100146821 3300005435 Bacteria 2122
26 Ga0070714_100589364 3300005435 Bacteria 1067
27 Ga0070713_100003373 3300005436 Bacteria 10547
28 Ga0070713_100006568 3300005436 Bacteria 8079
29 Ga0070713_100006684 3300005436 Bacteria 8027
30 Ga0070713_100310003 3300005436 Bacteria 1455
31 Ga0070710_10008907 3300005437 Bacteria 4898
32 Ga0070710_10036338 3300005437 Bacteria 2693
33 Ga0070711_100002484 3300005439 Bacteria 10529
34 Ga0070681_10001472 3300005458 Bacteria 20780
35 Ga0070681_10145586 3300005458 Bacteria 2298
36 Ga0070698_100009571 3300005471 Bacteria 10371
37 Ga0070699_100136828 3300005518 Bacteria 2161
38 Ga0070679_100000871 3300005530 Bacteria 26220
39 Ga0070684_100003273 3300005535 Bacteria 12129
40 Ga0070684_100011614 3300005535 Bacteria 7020
41 Ga0070684_100040318 3300005535 Bacteria 4020
42 Ga0070684_100052512 3300005535 Bacteria 3545
43 Ga0070684_100112555 3300005535 Bacteria 2442
44 Ga0068853_100008309 3300005539 Bacteria 8336
45 Ga0068853_100010282 3300005539 Bacteria 7571
46 Ga0068853_100196854 3300005539 Unclassified 1833
47 Ga0070665_100011130 3300005548 Bacteria 9091
48 Ga0070665_100153255 3300005548 Bacteria 2307
49 Ga0070665_100318820 3300005548 Bacteria 1558
50 Ga0068855_100000368 3300005563 Bacteria 55842
51 Ga0068855_100005193 3300005563 Bacteria 15885
52 Ga0068855_100021426 3300005563 Bacteria 7750
53 Ga0068855_100029777 3300005563 Bacteria 6528
54 Ga0068855_100035349 3300005563 Bacteria 5952
55 Ga0068855_100071987 3300005563 Bacteria 4018
56 Ga0068855_100194711 3300005563 Bacteria 2284
57 Ga0070664_100028399 3300005564 Bacteria 4653
58 Ga0068857_100000726 3300005577 Bacteria 24578
59 Ga0068857_100004261 3300005577 Bacteria 12056
60 Ga0068857_100014619 3300005577 Bacteria 6845
61 Ga0068857_100137080 3300005577 Bacteria 2210
62 Ga0068854_100015583 3300005578 Bacteria 5040
63 Ga0068854_100080145 3300005578 Bacteria 2409
64 Ga0068856_100000660 3300005614 Bacteria 37333
65 Ga0068856_100004343 3300005614 Bacteria 14126
66 Ga0068856_100008939 3300005614 Bacteria 9743
67 Ga0068856_100053092 3300005614 Bacteria 3997
68 Ga0068856_100104923 3300005614 Bacteria 2820
69 Ga0068856_100223843 3300005614 Bacteria 1897
70 Ga0068852_100000063 3300005616 Bacteria 72990
71 Ga0068852_100003275 3300005616 Bacteria 11304
72 Ga0068852_100011022 3300005616 Bacteria 6785
73 Ga0068852_100020337 3300005616 Bacteria 5278
74 Ga0068852_100055485 3300005616 Bacteria 3420
75 Ga0068852_100081576 3300005616 Bacteria 2871
76 Ga0068852_100083646 3300005616 Unclassified 2838
77 Ga0068852_100554987 3300005616 Unclassified 1149
78 Ga0068859_100044781 3300005617 Bacteria 4446
79 Ga0068864_100000782 3300005618 Bacteria 26736
80 Ga0068851_10005484 3300005834 Bacteria 5753
81 Ga0068851_10031475 3300005834 Bacteria 2635
82 Ga0068863_100000689 3300005841 Bacteria 33976
83 Ga0068863_100016491 3300005841 Bacteria 7086
84 Ga0068858_100000792 3300005842 Bacteria 33008
85 Ga0068858_100008850 3300005842 Bacteria 9655
86 Ga0068860_100000486 3300005843 Bacteria 48996
87 Ga0070717_10000675 3300006028 Bacteria 21977
88 Ga0070717_10016123 3300006028 Bacteria 5787
89 Ga0070715_10141988 3300006163 Bacteria 1167
90 Ga0070712_100047633 3300006175 Bacteria 2968
91 Ga0070712_100085071 3300006175 Bacteria 2301
92 Ga0070712_100328402 3300006175 Bacteria 1246
93 Ga0097621_100027465 3300006237 Bacteria 4476
94 Ga0068871_100000318 3300006358 Bacteria 33510
95 Ga0097620_100044777 3300006931 Bacteria 4446
96 Ga0105240_10000187 3300009093 Bacteria 126042
97 Ga0105240_10000498 3300009093 Bacteria 72329
98 Ga0105240_10000663 3300009093 Bacteria 63262
99 Ga0105240_10003591 3300009093 Bacteria 24042
100 Ga0105240_10010389 3300009093 Bacteria 13085
101 Ga0105240_10019453 3300009093 Bacteria 9070
102 Ga0105240_10030947 3300009093 Bacteria 6949
103 Ga0105240_10103841 3300009093 Bacteria 3452
104 Ga0105240_10130044 3300009093 Bacteria 3021
105 Ga0105240_10640735 3300009093 Bacteria 1166
106 Ga0105245_10029141 3300009098 Bacteria 4874
107 Ga0105245_10242918 3300009098 Bacteria 1746
108 Ga0105247_10020854 3300009101 Bacteria 3941
109 Ga0105243_10037709 3300009148 Bacteria 3759
110 Ga0105243_10374786 3300009148 Bacteria 1314
111 Ga0105241_10000190 3300009174 Bacteria 46161
112 Ga0105241_10001787 3300009174 Bacteria 16332
113 Ga0105241_10024512 3300009174 Bacteria 4479
114 Ga0105241_10024725 3300009174 Bacteria 4461
115 Ga0105241_10037780 3300009174 Unclassified 3638
116 Ga0105241_10134391 3300009174 Bacteria 2006
117 Ga0105242_10076073 3300009176 Bacteria 2797
118 Ga0105248_10000049 3300009177 Bacteria 153741
119 Ga0105248_10007643 3300009177 Bacteria 11878
120 Ga0105248_10017142 3300009177 Bacteria 7980
121 Ga0105237_10008461 3300009545 Bacteria 11134
122 Ga0105237_10056650 3300009545 Bacteria 3923
123 Ga0105237_10110609 3300009545 Bacteria 2739
124 Ga0105238_10000445 3300009551 Bacteria 43401
125 Ga0105238_10002357 3300009551 Bacteria 18991
126 Ga0105238_10005713 3300009551 Bacteria 12294
127 Ga0105238_10006055 3300009551 Bacteria 11998
128 Ga0105238_10023691 3300009551 Bacteria 6256
129 Ga0105238_10169586 3300009551 Bacteria 2158
130 Ga0105238_10176888 3300009551 Bacteria 2111
131 Ga0105238_10254960 3300009551 Bacteria 1733
132 Ga0099796_10070131 3300010159 Bacteria 1263
133 Ga0105239_10006364 3300010375 Bacteria 13720
134 Ga0105239_10059949 3300010375 Bacteria 4176
135 Ga0105239_10101852 3300010375 Bacteria 3177
136 Ga0105239_10544937 3300010375 Bacteria 1321
137 Ga0105246_10015497 3300011119 Bacteria 4818
138 Ga0157371_10029523 3300013102 Bacteria 3963
139 Ga0157371_10100237 3300013102 Bacteria 2054
140 Ga0157371_10309009 3300013102 Bacteria 1145
141 Ga0157370_10000066 3300013104 Bacteria 113884
142 Ga0157370_10016554 3300013104 Bacteria 7459
143 Ga0157370_10024810 3300013104 Bacteria 5936
144 Ga0157370_10032013 3300013104 Bacteria 5139
145 Ga0157370_10089759 3300013104 Unclassified 2887
146 Ga0157369_10000188 3300013105 Bacteria 85789
147 Ga0157369_10010473 3300013105 Bacteria 10561
148 Ga0157369_10012172 3300013105 Bacteria 9765
149 Ga0157369_10015595 3300013105 Bacteria 8564
150 Ga0157369_10026293 3300013105 Bacteria 6457
151 Ga0157369_10048820 3300013105 Bacteria 4591
152 Ga0157369_10110948 3300013105 Bacteria 2916
153 Ga0157374_10002505 3300013296 Bacteria 15507
154 Ga0157374_10014679 3300013296 Bacteria 6857
155 Ga0157374_10021668 3300013296 Bacteria 5722
156 Ga0157374_10048261 3300013296 Bacteria 3950
157 Ga0157374_10148791 3300013296 Bacteria 2276
158 Ga0157374_10190856 3300013296 Bacteria 2004
159 Ga0157374_10492078 3300013296 Bacteria 1230
160 Ga0157378_10017980 3300013297 Bacteria 6206
161 Ga0157378_10039289 3300013297 Bacteria 4197
162 Ga0157378_10119489 3300013297 Bacteria 2427
163 Ga0163162_10048185 3300013306 Bacteria 4269
164 Ga0163162_10071698 3300013306 Bacteria 3518
165 Ga0157372_10000114 3300013307 Bacteria 85156
166 Ga0157372_10011045 3300013307 Bacteria 9610
167 Ga0157372_10022400 3300013307 Bacteria 6836
168 Ga0157372_10023245 3300013307 Bacteria 6718
169 Ga0157372_10138810 3300013307 Bacteria 2800
170 Ga0157372_10156527 3300013307 Bacteria 2632
171 Ga0157372_10158358 3300013307 Bacteria 2616
172 Ga0157372_10180626 3300013307 Bacteria 2443
173 Ga0157375_10075230 3300013308 Bacteria 3401
174 Ga0157375_10619682 3300013308 Bacteria 1240
175 Ga0163163_10000351 3300014325 Bacteria 44325
176 Ga0163163_10015596 3300014325 Bacteria 7029
177 Ga0157379_10006606 3300014968 Bacteria 10006
178 Ga0157379_10117392 3300014968 Bacteria 2393
179 Ga0157379_10265075 3300014968 Bacteria 1562
180 Ga0157376_10017756 3300014969 Bacteria 5437
181 Ga0157376_10042282 3300014969 Bacteria 3735
182 Ga0163161_10044039 3300017792 Bacteria 3214
183 Ga0213874_10088265 3300021377 Bacteria 1015
184 Ga0213875_10000132 3300021388 Bacteria 82929
185 Ga0207656_10105600 3300025321 Bacteria 1296
186 Ga0207647_10032262 3300025904 Bacteria 3368
187 Ga0207705_10020382 3300025909 Bacteria 4739
188 Ga0207705_10044884 3300025909 Unclassified 3176
189 Ga0207705_10164856 3300025909 Bacteria 1666
190 Ga0207705_10203369 3300025909 Bacteria 1501
191 Ga0207654_10001701 3300025911 Bacteria 11493
192 Ga0207654_10002664 3300025911 Bacteria 9066
193 Ga0207654_10037291 3300025911 Unclassified 2720
194 Ga0207654_10100360 3300025911 Bacteria 1782
195 Ga0207707_10002291 3300025912 Bacteria 17266
196 Ga0207695_10000052 3300025913 Bacteria 398089
197 Ga0207695_10000106 3300025913 Bacteria 253001
198 Ga0207695_10000108 3300025913 Bacteria 252306
199 Ga0207695_10000253 3300025913 Bacteria 139044
200 Ga0207695_10002288 3300025913 Bacteria 28621
201 Ga0207695_10011700 3300025913 Bacteria 10602
202 Ga0207695_10090024 3300025913 Bacteria 3084
203 Ga0207671_10000081 3300025914 Bacteria 148476
204 Ga0207671_10003498 3300025914 Bacteria 15608
205 Ga0207671_10025557 3300025914 Bacteria 4435
206 Ga0207693_10001564 3300025915 Bacteria 20202
207 Ga0207693_10017330 3300025915 Bacteria 5744
208 Ga0207693_10088895 3300025915 Bacteria 2421
209 Ga0207693_10104992 3300025915 Bacteria 2215
210 Ga0207663_10069478 3300025916 Bacteria 2266
211 Ga0207657_10018479 3300025919 Bacteria 6653
212 Ga0207657_10038398 3300025919 Bacteria 4262
213 Ga0207649_10020120 3300025920 Unclassified 3823
214 Ga0207652_10011328 3300025921 Bacteria 7186
215 Ga0207694_10000108 3300025924 Bacteria 87457
216 Ga0207694_10003205 3300025924 Bacteria 13051
217 Ga0207694_10003511 3300025924 Bacteria 12445
218 Ga0207694_10017875 3300025924 Bacteria 5359
219 Ga0207694_10058070 3300025924 Bacteria 3010
220 Ga0207694_10374730 3300025924 Bacteria 1181
221 Ga0207650_10001335 3300025925 Bacteria 17846
222 Ga0207687_10000440 3300025927 Bacteria 28259
223 Ga0207687_10003837 3300025927 Bacteria 10093
224 Ga0207700_10002098 3300025928 Bacteria 11381
225 Ga0207700_10208178 3300025928 Bacteria 1652
226 Ga0207664_10013534 3300025929 Bacteria 5860
227 Ga0207664_10022918 3300025929 Bacteria 4671
228 Ga0207644_10007102 3300025931 Bacteria 7301
229 Ga0207644_10022857 3300025931 Bacteria 4275
230 Ga0207644_10416274 3300025931 Bacteria 1100
231 Ga0207691_10036632 3300025940 Bacteria 4545
232 Ga0207711_10000033 3300025941 Bacteria 193513
233 Ga0207711_10030369 3300025941 Bacteria 4558
234 Ga0207711_10038982 3300025941 Bacteria 4040
235 Ga0207711_10066170 3300025941 Bacteria 3125
236 Ga0207711_10155661 3300025941 Bacteria 2065
237 Ga0207689_10001260 3300025942 Bacteria 24401
238 Ga0207661_10002024 3300025944 Bacteria 13979
239 Ga0207661_10011894 3300025944 Bacteria 6320
240 Ga0207661_10112566 3300025944 Bacteria 2304
241 Ga0207661_10608156 3300025944 Bacteria 1003
242 Ga0207679_10126267 3300025945 Bacteria 2045
243 Ga0207667_10000934 3300025949 Bacteria 37249
244 Ga0207667_10003667 3300025949 Bacteria 18932
245 Ga0207667_10004868 3300025949 Bacteria 16399
246 Ga0207667_10014555 3300025949 Bacteria 8961
247 Ga0207667_10026360 3300025949 Bacteria 6352
248 Ga0207667_10040548 3300025949 Bacteria 4958
249 Ga0207667_10100750 3300025949 Bacteria 2980
250 Ga0207667_10184572 3300025949 Bacteria 2141
251 Ga0207667_10346804 3300025949 Bacteria 1514
252 Ga0207640_10094912 3300025981 Bacteria 2075
253 Ga0207640_10104991 3300025981 Bacteria 1990
254 Ga0207658_10000416 3300025986 Bacteria 40419
255 Ga0207677_10000025 3300026023 Bacteria 127400
256 Ga0207703_10000963 3300026035 Bacteria 27829
257 Ga0207703_10324466 3300026035 Bacteria 1411
258 Ga0207639_10000417 3300026041 Bacteria 29519
259 Ga0207639_10006021 3300026041 Bacteria 8226
260 Ga0207639_10044164 3300026041 Bacteria 3350
261 Ga0207639_10123651 3300026041 Bacteria 2130
262 Ga0207639_10125432 3300026041 Bacteria 2117
263 Ga0207639_10151687 3300026041 Bacteria 1942
264 Ga0207678_10034418 3300026067 Bacteria 4412
265 Ga0207678_10215342 3300026067 Bacteria 1643
266 Ga0207702_10003543 3300026078 Bacteria 14210
267 Ga0207702_10030556 3300026078 Bacteria 4489
268 Ga0207702_10155437 3300026078 Bacteria 2085
269 Ga0207702_10166930 3300026078 Bacteria 2015
270 Ga0207702_10436519 3300026078 Unclassified 1268
271 Ga0207641_10006655 3300026088 Bacteria 9703
272 Ga0207641_10028425 3300026088 Bacteria 4621
273 Ga0207676_10000514 3300026095 Bacteria 32542
274 Ga0207676_10012392 3300026095 Bacteria 6109
275 Ga0207674_10000459 3300026116 Bacteria 53315
276 Ga0207674_10001149 3300026116 Bacteria 34310
277 Ga0207674_10018340 3300026116 Bacteria 7609
278 Ga0207674_10028419 3300026116 Bacteria 5903
279 Ga0207674_10158020 3300026116 Bacteria 2222
280 Ga0207674_10201062 3300026116 Bacteria 1942
281 Ga0207683_10003208 3300026121 Bacteria 14272
282 Ga0207683_10046762 3300026121 Bacteria 3789
283 Ga0207698_10000007 3300026142 Bacteria 289457
284 Ga0207698_10001699 3300026142 Bacteria 12830
285 Ga0207698_10006424 3300026142 Bacteria 7335
286 Ga0207698_10028286 3300026142 Bacteria 3994
287 Ga0207698_10060402 3300026142 Unclassified 2948
288 Ga0207698_10640596 3300026142 Unclassified 1052
289 Ga0268266_10012860 3300028379 Bacteria 7227
290 Ga0268266_10035026 3300028379 Bacteria 4270
291 Ga0268266_10084576 3300028379 Bacteria 2770
292 Ga0268265_10064204 3300028380 Bacteria 2828
293 Ga0268264_10006372 3300028381 Bacteria 9946
294 Ga0265318_10014439 3300028577 Bacteria 3315
295 Ga0265336_10000806 3300028666 Bacteria 16518
296 Ga0265336_10004363 3300028666 Bacteria 5360
297 Ga0265338_10009018 3300028800 Bacteria 11999
298 Ga0265338_10023642 3300028800 Bacteria 6308
299 Ga0265338_10023834 3300028800 Bacteria 6275
300 Ga0265330_10000852 3300031235 Bacteria 19100
301 Ga0265332_10010593 3300031238 Bacteria 4104
302 Ga0265328_10003655 3300031239 Bacteria 6777
303 Ga0265320_10029101 3300031240 Bacteria 2861
304 Ga0265325_10002033 3300031241 Bacteria 13905
305 Ga0265325_10022599 3300031241 Bacteria 3443
306 Ga0265325_10057472 3300031241 Bacteria 1984
307 Ga0265329_10016883 3300031242 Bacteria 2523
308 Ga0265340_10010451 3300031247 Bacteria 4963
309 Ga0265339_10000029 3300031249 Bacteria 139089
310 Ga0265339_10021467 3300031249 Bacteria 3756
311 Ga0265339_10029659 3300031249 Bacteria 3102
312 Ga0265339_10082381 3300031249 Bacteria 1698
313 Ga0265331_10053628 3300031250 Bacteria 1922
314 Ga0265331_10091159 3300031250 Bacteria 1408
315 Ga0265316_10002998 3300031344 Bacteria 17267
316 Ga0265316_10128561 3300031344 Bacteria 1909
317 Ga0265313_10001614 3300031595 Bacteria 20940
318 Ga0265313_10018670 3300031595 Bacteria 3886
319 Ga0265313_10065519 3300031595 Bacteria 1686
320 Ga0265314_10000139 3300031711 Bacteria 108861
321 Ga0265314_10158198 3300031711 Bacteria 1381
322 Ga0265342_10001906 3300031712 Bacteria 18762
323 Ga0265342_10002378 3300031712 Bacteria 16291
324 Ga0265342_10023354 3300031712 Bacteria 3916
325 Ga0265342_10024936 3300031712 Bacteria 3768
326 Ga0265342_10085920 3300031712 Bacteria 1809
327 Ga0265342_10120770 3300031712 Bacteria 1476
328 Ga0307510_10016280 3300033180 Bacteria 8779
329 Ga0373955_0135009 3300035172 Bacteria 1443
330 Ga0373933_0025712 3300035724 Bacteria 3378
331 Ga0373937_0002195 3300036401 Bacteria 16312
332 Ga0373937_0349359 3300036401 Bacteria 1401
333 Ga0436364_0717863 3300037853 Bacteria 145182
334 Ga0436360_0789444 3300039438 Bacteria 3640
335 Ga0436362_1069305 3300039453 Bacteria 2680
336 Ga0439448_0004925 3300042005 Bacteria 3791
337 Ga0466966_0130917 3300044684 Bacteria 1536
338 Ga0466967_0000205 3300045976 Bacteria 24844
339 Ga0495603_0039776 3300046455 Bacteria 2816
340 Ga0495629_0002846 3300046459 Bacteria 13224
341 Ga0495629_0021663 3300046459 Bacteria 4586
342 Ga0495651_0017085 3300046462 Bacteria 5622
343 Ga0495653_0118243 3300046463 Bacteria 1893
344 Ga0495650_0000037 3300046471 Bacteria 390090
345 Ga0495650_0003867 3300046471 Bacteria 10613
346 Ga0495580_0016489 3300046472 Bacteria 5542
347 Ga0495582_0003426 3300046473 Bacteria 8931
348 Ga0495582_0195162 3300046473 Bacteria 1156
349 Ga0495639_0003040 3300046475 Bacteria 7304
350 Ga0495639_0043264 3300046475 Bacteria 2034
351 Ga0495662_0019719 3300046476 Bacteria 3262
352 Ga0495664_0016467 3300046477 Bacteria 4212
353 Ga0495664_0071166 3300046477 Bacteria 2077
354 Ga0495585_0005419 3300046492 Bacteria 8048
355 Ga0495594_0000757 3300046499 Bacteria 16578
356 Ga0495594_0000857 3300046499 Bacteria 15656
357 Ga0495596_0024519 3300046500 Bacteria 2441
358 Ga0495608_0085525 3300046511 Bacteria 2044
359 Ga0495631_0036663 3300046518 Bacteria 2189
360 Ga0495631_0107708 3300046518 Bacteria 1198
361 Ga0495644_0000004 3300046523 Bacteria 158166
362 Ga0495648_0052460 3300046524 Bacteria 2477
363 Ga0495666_0096753 3300046526 Bacteria 1391
364 Ga0495642_0009760 3300046528 Bacteria 3676
365 Ga0495652_0030804 3300046529 Bacteria 4701
366 Ga0495665_0013659 3300046531 Bacteria 4387
367 Ga0495665_0037540 3300046531 Bacteria 2585
368 Ga0495640_0186559 3300046533 Bacteria 1319
369 Ga0495640_0227203 3300046533 Bacteria 1175
370 Ga0495586_0002255 3300046535 Bacteria 10494
371 Ga0495586_0102719 3300046535 Bacteria 1587
372 Ga0495587_0004453 3300046536 Bacteria 9230
373 Ga0495609_0007829 3300046538 Bacteria 5288
374 Ga0495645_0001171 3300046543 Bacteria 17849
375 Ga0495633_0008114 3300046558 Bacteria 5955
376 Ga0495667_0054230 3300046559 Bacteria 2638
377 Ga0495668_0013828 3300046616 Bacteria 4747
378 Ga0495668_0114949 3300046616 Bacteria 1472
379 Ga0495634_0009647 3300046642 Bacteria 7110
380 Ga0495611_0036149 3300046648 Bacteria 2190
381 Ga0495625_0004435 3300046660 Bacteria 13281
382 Ga0495625_0005078 3300046660 Bacteria 12177
383 Ga0495625_0011670 3300046660 Bacteria 7147
384 Ga0495625_0013991 3300046660 Bacteria 6426
385 Ga0495635_0057928 3300046663 Bacteria 2665
386 Ga0495635_0108117 3300046663 Bacteria 1900
387 Ga0495661_0026663 3300046665 Bacteria 3720
388 Ga0495588_0037486 3300046674 Bacteria 2463
389 Ga0495599_0061508 3300046678 Bacteria 2346
390 Ga0495623_0013814 3300046679 Bacteria 5234
391 Ga0495623_0037323 3300046679 Unclassified 3110
392 Ga0495646_0073393 3300046680 Bacteria 2010
393 Ga0495669_0028204 3300046684 Bacteria 2457
394 Ga0495613_0003370 3300046689 Bacteria 11940
395 Ga0495613_0005996 3300046689 Bacteria 9096
396 Ga0495613_0025076 3300046689 Bacteria 4444
397 Ga0495613_0031867 3300046689 Bacteria 3915
398 Ga0495624_0018645 3300046690 Bacteria 4640
399 Ga0495649_0031529 3300046694 Bacteria 2922
400 Ga0495649_0044136 3300046694 Bacteria 2434
401 Ga0495600_0022161 3300046809 Bacteria 4076
402 Ga0495600_0232392 3300046809 Bacteria 1177
403 Ga0495600_0248733 3300046809 Bacteria 1131
404 Ga0495581_0041532 3300047315 Bacteria 2662
405 Ga0495581_0050562 3300047315 Bacteria 2400
406 Ga0495604_0041787 3300047317 Bacteria 3595
407 Ga0495604_0071616 3300047317 Bacteria 2621
408 Ga0495672_0006175 3300047320 Bacteria 9343
409 Ga0495676_0041749 3300047321 Bacteria 3772
410 Ga0495676_0144561 3300047321 Bacteria 1700
411 Ga0495680_0072889 3300047322 Bacteria 2611
412 Ga0495683_0029751 3300047323 Bacteria 2790
413 Ga0495675_0015819 3300047444 Bacteria 4772
414 Ga0495684_0016800 3300047471 Bacteria 5639
415 Ga0495684_0073471 3300047471 Bacteria 2598
416 Ga0495684_0197615 3300047471 Bacteria 1484
417 Ga0495686_0000382 3300047472 Bacteria 70847
418 Ga0495686_0017994 3300047472 Bacteria 4751
419 Ga0495686_0031257 3300047472 Bacteria 3454
420 Ga0495602_0053125 3300048088 Bacteria 3591
421 Ga0496100_0128699 3300048903 Bacteria 1780
422 Ga0496104_0098936 3300048907 Bacteria 2792
423 Ga0496105_0008684 3300048908 Bacteria 7904
424 Ga0496106_0216362 3300048909 Unclassified 1527
425 Ga0496110_0072544 3300048913 Bacteria 3055
426 Ga0496110_0248807 3300048913 Bacteria 1618
427 Ga0496112_0036100 3300048915 Bacteria 4820
428 Ga0496114_0012496 3300048917 Bacteria 6799
429 Ga0496114_0051110 3300048917 Bacteria 3441
430 Ga0496115_0012658 3300048918 Bacteria 6357
431 Ga0495682_0015562 3300049460 Bacteria 2882
432 Ga0501031_0037943 3300049568 Bacteria 3145
433 Ga0501032_0002119 3300049569 Bacteria 15644
434 Ga0501032_0180133 3300049569 Bacteria 1384
435 Ga0501033_0009365 3300049570 Bacteria 7539
436 Ga0501034_0036921 3300049571 Bacteria 4947
437 Ga0501036_0001980 3300049572 Bacteria 15885
438 Ga0501037_0053081 3300049573 Bacteria 2964
439 Ga0501038_0008810 3300049574 Bacteria 9256
440 Ga0501039_0099189 3300049575 Bacteria 2273
441 Ga0501043_0000430 3300049579 Bacteria 37723
442 Ga0501046_0000371 3300049580 Bacteria 45434
443 Ga0501047_0006342 3300049581 Bacteria 11122
444 Ga0501047_0034547 3300049581 Bacteria 4882
445 Ga0501073_0008142 3300049589 Bacteria 7777
446 Ga0501073_0034835 3300049589 Bacteria 3581
447 Ga0501080_0100175 3300049742 Bacteria 2688
448 Ga0501035_0002370 3300049822 Bacteria 18512
449 Ga0501044_0068873 3300049823 Bacteria 3603
450 Ga0501044_0350260 3300049823 Bacteria 1396
451 Ga0500651_0000061 3300053093 Bacteria 71477
452 Ga0500595_000423 3300053119 Bacteria 26615
453 Ga0500595_012007 3300053119 Bacteria 3362
454 Ga0500661_003646 3300055283 Bacteria 2892
455 2884218956 2884215851 Bacteria 4554841
456 Ga0496126_0003782
457 Ga0070658_10002730
458 Ga0070658_10009570
459 Ga0070658_10031055
460 Ga0070658_10031101
461 Ga0070658_10134480
462 Ga0070683_100000210
463 Ga0070683_100014043
464 Ga0070683_100078140
465 Ga0070683_100138734
466 Ga0068869_100014715
467 Ga0068868_100000046
468 Ga0070660_100013531
469 Ga0070660_100045365
470 Ga0070689_100253371
471 Ga0070661_100056322
472 Ga0070661_100228531
473 Ga0070669_100261218
474 Ga0070671_100003795
475 Ga0070671_100011009
476 Ga0070671_100067313
477 Ga0070659_100034743
478 Ga0070667_100001013
479 Ga0070714_100037725
480 Ga0070714_100146821
481 Ga0070714_100589364
482 Ga0070713_100003373
483 Ga0070713_100006568
484 Ga0070713_100006684
485 Ga0070713_100310003
486 Ga0070710_10008907
487 Ga0070710_10036338
488 Ga0070711_100002484
489 Ga0070681_10001472
490 Ga0070681_10145586
491 Ga0070698_100009571
492 Ga0070699_100136828
493 Ga0070679_100000871
494 Ga0070684_100003273
495 Ga0070684_100011614
496 Ga0070684_100040318
497 Ga0070684_100052512
498 Ga0070684_100112555
499 Ga0068853_100008309
500 Ga0068853_100010282
501 Ga0068853_100196854
502 Ga0070665_100011130
503 Ga0070665_100153255
504 Ga0070665_100318820
505 Ga0068855_100000368
506 Ga0068855_100005193
507 Ga0068855_100021426
508 Ga0068855_100029777
509 Ga0068855_100035349
510 Ga0068855_100071987
511 Ga0068855_100194711
512 Ga0070664_100028399
513 Ga0068857_100000726
514 Ga0068857_100004261
515 Ga0068857_100014619
516 Ga0068857_100137080
517 Ga0068854_100015583
518 Ga0068854_100080145
519 Ga0068856_100000660
520 Ga0068856_100004343
521 Ga0068856_100008939
522 Ga0068856_100053092
523 Ga0068856_100104923
524 Ga0068856_100223843
525 Ga0068852_100000063
526 Ga0068852_100003275
527 Ga0068852_100011022
528 Ga0068852_100020337
529 Ga0068852_100055485
530 Ga0068852_100081576
531 Ga0068852_100083646
532 Ga0068852_100554987
533 Ga0068859_100044781
534 Ga0068864_100000782
535 Ga0068851_10005484
536 Ga0068851_10031475
537 Ga0068863_100000689
538 Ga0068863_100016491
539 Ga0068858_100000792
540 Ga0068858_100008850
541 Ga0068860_100000486
542 Ga0070717_10000675
543 Ga0070717_10016123
544 Ga0070715_10141988
545 Ga0070712_100047633
546 Ga0070712_100085071
547 Ga0070712_100328402
548 Ga0097621_100027465
549 Ga0068871_100000318
550 Ga0097620_100044777
551 Ga0105240_10000187
552 Ga0105240_10000498
553 Ga0105240_10000663
554 Ga0105240_10003591
555 Ga0105240_10010389
556 Ga0105240_10019453
557 Ga0105240_10030947
558 Ga0105240_10103841
559 Ga0105240_10130044
560 Ga0105240_10640735
561 Ga0105245_10029141
562 Ga0105245_10242918
563 Ga0105247_10020854
564 Ga0105243_10037709
565 Ga0105243_10374786
566 Ga0105241_10000190
567 Ga0105241_10001787
568 Ga0105241_10024512
569 Ga0105241_10024725
570 Ga0105241_10037780
571 Ga0105241_10134391
572 Ga0105242_10076073
573 Ga0105248_10000049
574 Ga0105248_10007643
575 Ga0105248_10017142
576 Ga0105237_10008461
577 Ga0105237_10056650
578 Ga0105237_10110609
579 Ga0105238_10000445
580 Ga0105238_10002357
581 Ga0105238_10005713
582 Ga0105238_10006055
583 Ga0105238_10023691
584 Ga0105238_10169586
585 Ga0105238_10176888
586 Ga0105238_10254960
587 Ga0099796_10070131
588 Ga0105239_10006364
589 Ga0105239_10059949
590 Ga0105239_10101852
591 Ga0105239_10544937
592 Ga0105246_10015497
593 Ga0157371_10029523
594 Ga0157371_10100237
595 Ga0157371_10309009
596 Ga0157370_10000066
597 Ga0157370_10016554
598 Ga0157370_10024810
599 Ga0157370_10032013
600 Ga0157370_10089759
601 Ga0157369_10000188
602 Ga0157369_10010473
603 Ga0157369_10012172
604 Ga0157369_10015595
605 Ga0157369_10026293
606 Ga0157369_10048820
607 Ga0157369_10110948
608 Ga0157374_10002505
609 Ga0157374_10014679
610 Ga0157374_10021668
611 Ga0157374_10048261
612 Ga0157374_10148791
613 Ga0157374_10190856
614 Ga0157374_10492078
615 Ga0157378_10017980
616 Ga0157378_10039289
617 Ga0157378_10119489
618 Ga0163162_10048185
619 Ga0163162_10071698
620 Ga0157372_10000114
621 Ga0157372_10011045
622 Ga0157372_10022400
623 Ga0157372_10023245
624 Ga0157372_10138810
625 Ga0157372_10156527
626 Ga0157372_10158358
627 Ga0157372_10180626
628 Ga0157375_10075230
629 Ga0157375_10619682
630 Ga0163163_10000351
631 Ga0163163_10015596
632 Ga0157379_10006606
633 Ga0157379_10117392
634 Ga0157379_10265075
635 Ga0157376_10017756
636 Ga0157376_10042282
637 Ga0163161_10044039
638 Ga0213874_10088265
639 Ga0213875_10000132
640 Ga0207656_10105600
641 Ga0207647_10032262
642 Ga0207705_10020382
643 Ga0207705_10044884
644 Ga0207705_10164856
645 Ga0207705_10203369
646 Ga0207654_10001701
647 Ga0207654_10002664
648 Ga0207654_10037291
649 Ga0207654_10100360
650 Ga0207707_10002291
651 Ga0207695_10000052
652 Ga0207695_10000106
653 Ga0207695_10000108
654 Ga0207695_10000253
655 Ga0207695_10002288
656 Ga0207695_10011700
657 Ga0207695_10090024
658 Ga0207671_10000081
659 Ga0207671_10003498
660 Ga0207671_10025557
661 Ga0207693_10001564
662 Ga0207693_10017330
663 Ga0207693_10088895
664 Ga0207693_10104992
665 Ga0207663_10069478
666 Ga0207657_10018479
667 Ga0207657_10038398
668 Ga0207649_10020120
669 Ga0207652_10011328
670 Ga0207694_10000108
671 Ga0207694_10003205
672 Ga0207694_10003511
673 Ga0207694_10017875
674 Ga0207694_10058070
675 Ga0207694_10374730
676 Ga0207650_10001335
677 Ga0207687_10000440
678 Ga0207687_10003837
679 Ga0207700_10002098
680 Ga0207700_10208178
681 Ga0207664_10013534
682 Ga0207664_10022918
683 Ga0207644_10007102
684 Ga0207644_10022857
685 Ga0207644_10416274
686 Ga0207691_10036632
687 Ga0207711_10000033
688 Ga0207711_10030369
689 Ga0207711_10038982
690 Ga0207711_10066170
691 Ga0207711_10155661
692 Ga0207689_10001260
693 Ga0207661_10002024
694 Ga0207661_10011894
695 Ga0207661_10112566
696 Ga0207661_10608156
697 Ga0207679_10126267
698 Ga0207667_10000934
699 Ga0207667_10003667
700 Ga0207667_10004868
701 Ga0207667_10014555
702 Ga0207667_10026360
703 Ga0207667_10040548
704 Ga0207667_10100750
705 Ga0207667_10184572
706 Ga0207667_10346804
707 Ga0207640_10094912
708 Ga0207640_10104991
709 Ga0207658_10000416
710 Ga0207677_10000025
711 Ga0207703_10000963
712 Ga0207703_10324466
713 Ga0207639_10000417
714 Ga0207639_10006021
715 Ga0207639_10044164
716 Ga0207639_10123651
717 Ga0207639_10125432
718 Ga0207639_10151687
719 Ga0207678_10034418
720 Ga0207678_10215342
721 Ga0207702_10003543
722 Ga0207702_10030556
723 Ga0207702_10155437
724 Ga0207702_10166930
725 Ga0207702_10436519
726 Ga0207641_10006655
727 Ga0207641_10028425
728 Ga0207676_10000514
729 Ga0207676_10012392
730 Ga0207674_10000459
731 Ga0207674_10001149
732 Ga0207674_10018340
733 Ga0207674_10028419
734 Ga0207674_10158020
735 Ga0207674_10201062
736 Ga0207683_10003208
737 Ga0207683_10046762
738 Ga0207698_10000007
739 Ga0207698_10001699
740 Ga0207698_10006424
741 Ga0207698_10028286
742 Ga0207698_10060402
743 Ga0207698_10640596
744 Ga0268266_10012860
745 Ga0268266_10035026
746 Ga0268266_10084576
747 Ga0268265_10064204
748 Ga0268264_10006372
749 Ga0265318_10014439
750 Ga0265336_10000806
751 Ga0265336_10004363
752 Ga0265338_10009018
753 Ga0265338_10023642
754 Ga0265338_10023834
755 Ga0265330_10000852
756 Ga0265332_10010593
757 Ga0265328_10003655
758 Ga0265320_10029101
759 Ga0265325_10002033
760 Ga0265325_10022599
761 Ga0265325_10057472
762 Ga0265329_10016883
763 Ga0265340_10010451
764 Ga0265339_10000029
765 Ga0265339_10021467
766 Ga0265339_10029659
767 Ga0265339_10082381
768 Ga0265331_10053628
769 Ga0265331_10091159
770 Ga0265316_10002998
771 Ga0265316_10128561
772 Ga0265313_10001614
773 Ga0265313_10018670
774 Ga0265313_10065519
775 Ga0265314_10000139
776 Ga0265314_10158198
777 Ga0265342_10001906
778 Ga0265342_10002378
779 Ga0265342_10023354
780 Ga0265342_10024936
781 Ga0265342_10085920
782 Ga0265342_10120770
783 Ga0307510_10016280
784 Ga0373955_0135009
785 Ga0373933_0025712
786 Ga0373937_0002195
787 Ga0373937_0349359
788 Ga0436364_0717863
789 Ga0436360_0789444
790 Ga0436362_1069305
791 Ga0439448_0004925
792 Ga0466966_0130917
793 Ga0466967_0000205
794 Ga0495603_0039776
795 Ga0495629_0002846
796 Ga0495629_0021663
797 Ga0495651_0017085
798 Ga0495653_0118243
799 Ga0495650_0000037
800 Ga0495650_0003867
801 Ga0495580_0016489
802 Ga0495582_0003426
803 Ga0495582_0195162
804 Ga0495639_0003040
805 Ga0495639_0043264
806 Ga0495662_0019719
807 Ga0495664_0016467
808 Ga0495664_0071166
809 Ga0495585_0005419
810 Ga0495594_0000757
811 Ga0495594_0000857
812 Ga0495596_0024519
813 Ga0495608_0085525
814 Ga0495631_0036663
815 Ga0495631_0107708
816 Ga0495644_0000004
817 Ga0495648_0052460
818 Ga0495666_0096753
819 Ga0495642_0009760
820 Ga0495652_0030804
821 Ga0495665_0013659
822 Ga0495665_0037540
823 Ga0495640_0186559
824 Ga0495640_0227203
825 Ga0495586_0002255
826 Ga0495586_0102719
827 Ga0495587_0004453
828 Ga0495609_0007829
829 Ga0495645_0001171
830 Ga0495633_0008114
831 Ga0495667_0054230
832 Ga0495668_0013828
833 Ga0495668_0114949
834 Ga0495634_0009647
835 Ga0495611_0036149
836 Ga0495625_0004435
837 Ga0495625_0005078
838 Ga0495625_0011670
839 Ga0495625_0013991
840 Ga0495635_0057928
841 Ga0495635_0108117
842 Ga0495661_0026663
843 Ga0495588_0037486
844 Ga0495599_0061508
845 Ga0495623_0013814
846 Ga0495623_0037323
847 Ga0495646_0073393
848 Ga0495669_0028204
849 Ga0495613_0003370
850 Ga0495613_0005996
851 Ga0495613_0025076
852 Ga0495613_0031867
853 Ga0495624_0018645
854 Ga0495649_0031529
855 Ga0495649_0044136
856 Ga0495600_0022161
857 Ga0495600_0232392
858 Ga0495600_0248733
859 Ga0495581_0041532
860 Ga0495581_0050562
861 Ga0495604_0041787
862 Ga0495604_0071616
863 Ga0495672_0006175
864 Ga0495676_0041749
865 Ga0495676_0144561
866 Ga0495680_0072889
867 Ga0495683_0029751
868 Ga0495675_0015819
869 Ga0495684_0016800
870 Ga0495684_0073471
871 Ga0495684_0197615
872 Ga0495686_0000382
873 Ga0495686_0017994
874 Ga0495686_0031257
875 Ga0495602_0053125
876 Ga0496100_0128699
877 Ga0496104_0098936
878 Ga0496105_0008684
879 Ga0496106_0216362
880 Ga0496110_0072544
881 Ga0496110_0248807
882 Ga0496112_0036100
883 Ga0496114_0012496
884 Ga0496114_0051110
885 Ga0496115_0012658
886 Ga0495682_0015562
887 Ga0501031_0037943
888 Ga0501032_0002119
889 Ga0501032_0180133
890 Ga0501033_0009365
891 Ga0501034_0036921
892 Ga0501036_0001980
893 Ga0501037_0053081
894 Ga0501038_0008810
895 Ga0501039_0099189
896 Ga0501043_0000430
897 Ga0501046_0000371
898 Ga0501047_0006342
899 Ga0501047_0034547
900 Ga0501073_0008142
901 Ga0501073_0034835
902 Ga0501080_0100175
903 Ga0501035_0002370
904 Ga0501044_0068873
905 Ga0501044_0350260
906 Ga0500651_0000061
907 Ga0500595_000423
908 Ga0500595_012007
909 Ga0500661_003646
910 2884218956

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00763

THF_DHG_CYH

Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain

64

178

0.99

PF02882

THF_DHG_CYH_C

Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain

181

361

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6de8-assembly1.cif.gz_A crystal structure of bifunctional enzyme fold-methylenetetrahydrofolate dehydrogenase/cyclohydrolase from campylobacter jejuni 0.9538 5 299
6v6y-assembly1.cif.gz_A-2 crystal structure of t. thermophilus methylenetetrahydrofolate dehydrogenase (mthfd) 0.9484 4 300
6ape-assembly1.cif.gz_A crystal structure of bifunctional protein fold from helicobacter pylori 0.9474 5 302
6de8-assembly1.cif.gz_A crystal structure of bifunctional enzyme fold-methylenetetrahydrofolate dehydrogenase/cyclohydrolase from campylobacter jejuni 0.9438 5 299
4a5o-assembly2.cif.gz_D crystal structure of pseudomonas aeruginosa n5, n10- methylenetetrahydrofolate dehydrogenase-cyclohydrolase (fold) 0.943 5 297
ID Description Score Start End Superfamily
af_K7KDB4_41_138_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9678 136 231 3.40.50.720
af_P9WG81_104_273_3.40.50.10860 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9634 101 290 3.40.50.10860
af_Q54RI8_148_271_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9603 137 280 3.40.50.720
4a5oB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9601 33 110 3.40.50.10860
3l07A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Leucine Dehydrogenase, chain A, domain 1 0.9573 33 111 3.40.50.10860
ID Description Score Start End GO Terms
AF-A0A378W428-F1-model_v4 Bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase (EC 3.5.4.9) 0.9914 79 205 GO:0000105
GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999
AF-X1JX42-F1-model_v4 methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) 0.9897 112 218 GO:0004477
GO:0004488
GO:0005829
GO:0035999
AF-Q71IF6-F1-model_v4 methenyltetrahydrofolate cyclohydrolase (EC 3.5.4.9) 0.989 146 232 GO:0004477
GO:0004488
GO:0005829
GO:0035999
AF-A0A833NLB1-F1-model_v4 deleted 0.988 92 229
AF-A0A2E6S7S0-F1-model_v4 Bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/5,10-methylene-tetrahydrofolate cyclohydrolase 0.9861 8 176 GO:0004477
GO:0004488
GO:0005829
GO:0006164
GO:0009086
GO:0035999

Map