F447673

General Info

Members Datasets Scaffolds Average Seq Length
455 275 455 217

Family's Representative Sequence

Representative Sequence 3300049824|Ga0501045_0153426|Ga0501045_0153426_616_1284
Length 213
Sequence MHLVGLPSARRVWIFDLDNTLHDAHARIFPSMHEQINAYLRRRFDLDEAGANEMRHGFWQRYGTTMDPREFLAATHQFPELGDMVVHEAAVRHALARLPGRKLVFSNAPRHYVEGVLRALGVGRFFDGVYTIENARFRGKPAFDGFRVLLREHDLDPRRCALIDDIAANLRTAKRLGMATVWVSRERRKPAFVDLRVTSVTRLPGLVFRYSRQ

Samples

Sample ID Description Type Environment
1 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
132 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
137 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
138 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
139 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
140 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
145 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
146 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
148 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
153 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
156 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
157 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
158 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
165 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
166 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
169 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
170 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
176 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
182 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
183 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
184 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
185 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
186 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
187 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
188 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
189 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
190 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
191 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
194 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
195 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
199 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
202 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
203 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
204 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
205 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
206 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
207 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
208 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
209 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
210 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
211 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
212 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
217 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
218 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
219 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
220 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
221 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
222 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
223 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
224 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
225 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
228 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
257 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
260 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
261 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
262 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
269 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
270 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
273 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.22
Rhizosphere 99.78
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24034J26672_10015759 3300002239 Bacteria 1159
2 Ga0065707_10153596 3300005295 Bacteria 1632
3 Ga0070676_10087962 3300005328 Bacteria 1897
4 Ga0070683_100479257 3300005329 Bacteria 1188
5 Ga0070690_100000252 3300005330 Bacteria 27754
6 Ga0068869_100000052 3300005334 Bacteria 50285
7 Ga0068869_100129604 3300005334 Bacteria 1937
8 Ga0068869_100241321 3300005334 Bacteria 1440
9 Ga0070680_100001647 3300005336 Bacteria 16321
10 Ga0070680_100112235 3300005336 Bacteria 2270
11 Ga0070682_100017681 3300005337 Bacteria 4159
12 Ga0068868_100001208 3300005338 Bacteria 17737
13 Ga0070689_100000387 3300005340 Bacteria 25784
14 Ga0070689_100044068 3300005340 Bacteria 3431
15 Ga0070689_100248692 3300005340 Bacteria 1466
16 Ga0070691_10000617 3300005341 Bacteria 13697
17 Ga0070687_100000053 3300005343 Bacteria 37278
18 Ga0070687_100125973 3300005343 Bacteria 1472
19 Ga0070692_10001036 3300005345 Bacteria 9589
20 Ga0070703_10003626 3300005406 Bacteria 4386
21 Ga0070701_10000715 3300005438 Bacteria 11745
22 Ga0070701_10354236 3300005438 Bacteria 918
23 Ga0070705_100000253 3300005440 Bacteria 31805
24 Ga0070705_100164552 3300005440 Bacteria 1486
25 Ga0070700_100000447 3300005441 Bacteria 20775
26 Ga0070694_100000058 3300005444 Bacteria 52128
27 Ga0070694_100137664 3300005444 Bacteria 1770
28 Ga0070694_100165713 3300005444 Bacteria 1625
29 Ga0070708_100501472 3300005445 Bacteria 1145
30 Ga0070678_100575308 3300005456 Bacteria 1003
31 Ga0070681_10000135 3300005458 Bacteria 56156
32 Ga0068867_100000138 3300005459 Bacteria 46832
33 Ga0070706_100242767 3300005467 Bacteria 1682
34 Ga0070706_100864657 3300005467 Bacteria 836
35 Ga0070707_100411548 3300005468 Bacteria 1313
36 Ga0070699_100013835 3300005518 Bacteria 6941
37 Ga0070679_100025518 3300005530 Bacteria 5800
38 Ga0070684_100026833 3300005535 Bacteria 4855
39 Ga0070697_100004494 3300005536 Bacteria 10724
40 Ga0070697_100341191 3300005536 Bacteria 1293
41 Ga0070686_100000132 3300005544 Bacteria 52774
42 Ga0070686_100387975 3300005544 Bacteria 1059
43 Ga0070686_100589449 3300005544 Bacteria 875
44 Ga0070695_100000434 3300005545 Bacteria 21679
45 Ga0070695_100011156 3300005545 Bacteria 5373
46 Ga0070695_100041893 3300005545 Bacteria 2904
47 Ga0070696_100000008 3300005546 Bacteria 101365
48 Ga0070696_100002386 3300005546 Bacteria 12422
49 Ga0070696_100071538 3300005546 Bacteria 2441
50 Ga0070696_100325810 3300005546 Bacteria 1183
51 Ga0070696_100702179 3300005546 Bacteria 825
52 Ga0070693_100000008 3300005547 Bacteria 80726
53 Ga0070693_100097225 3300005547 Bacteria 1787
54 Ga0070693_100347144 3300005547 Bacteria 1015
55 Ga0070704_100000044 3300005549 Bacteria 41217
56 Ga0070704_100236185 3300005549 Bacteria 1494
57 Ga0070704_100523199 3300005549 Bacteria 1033
58 Ga0068855_100000880 3300005563 Bacteria 37235
59 Ga0068854_100002322 3300005578 Bacteria 11728
60 Ga0068856_100242674 3300005614 Bacteria 1817
61 Ga0070702_100002197 3300005615 Bacteria 8312
62 Ga0070702_100276079 3300005615 Bacteria 1152
63 Ga0070702_100344727 3300005615 Bacteria 1047
64 Ga0068852_100098085 3300005616 Bacteria 2638
65 Ga0068859_100000906 3300005617 Bacteria 30276
66 Ga0068859_100450873 3300005617 Bacteria 1383
67 Ga0068864_100038245 3300005618 Bacteria 4097
68 Ga0068866_10000862 3300005718 Bacteria 13410
69 Ga0068861_100000076 3300005719 Bacteria 47808
70 Ga0068870_10018761 3300005840 Bacteria 3346
71 Ga0068863_100106964 3300005841 Bacteria 2662
72 Ga0068858_100001268 3300005842 Bacteria 26119
73 Ga0068858_100412054 3300005842 Bacteria 1299
74 Ga0068860_100000634 3300005843 Bacteria 41350
75 Ga0068862_100000663 3300005844 Bacteria 35305
76 Ga0081539_10001863 3300005985 Bacteria 33168
77 Ga0070715_10244414 3300006163 Bacteria 935
78 Ga0070715_10402286 3300006163 Bacteria 761
79 Ga0097621_100001432 3300006237 Bacteria 16367
80 Ga0097621_100016784 3300006237 Bacteria 5547
81 Ga0068871_100001528 3300006358 Bacteria 15507
82 Ga0068871_100006526 3300006358 Bacteria 8262
83 Ga0075428_100005478 3300006844 Bacteria 14107
84 Ga0075428_100071689 3300006844 Bacteria 3786
85 Ga0075430_100066775 3300006846 Bacteria 3020
86 Ga0075431_100073443 3300006847 Bacteria 3528
87 Ga0075433_10039738 3300006852 Bacteria 4070
88 Ga0075433_10076963 3300006852 Bacteria 2938
89 Ga0075433_10129818 3300006852 Bacteria 2239
90 Ga0075434_100000002 3300006871 Bacteria 135661
91 Ga0075434_100002230 3300006871 Bacteria 16925
92 Ga0075434_100470790 3300006871 Bacteria 1278
93 Ga0075429_100003080 3300006880 Bacteria 14140
94 Ga0075429_100060935 3300006880 Bacteria 3286
95 Ga0068865_100000276 3300006881 Bacteria 28251
96 Ga0075436_100002239 3300006914 Bacteria 13356
97 Ga0075436_100009290 3300006914 Bacteria 6727
98 Ga0075436_100015277 3300006914 Bacteria 5258
99 Ga0075436_100058920 3300006914 Bacteria 2652
100 Ga0075436_100105134 3300006914 Bacteria 1968
101 Ga0097620_100000906 3300006931 Bacteria 30276
102 Ga0097620_100450888 3300006931 Bacteria 1383
103 Ga0075435_100000089 3300007076 Bacteria 48555
104 Ga0075435_100006511 3300007076 Bacteria 8263
105 Ga0075435_100019688 3300007076 Bacteria 5159
106 Ga0075435_100143668 3300007076 Bacteria 2003
107 Ga0099794_10025069 3300007265 Bacteria 2743
108 Ga0099794_10058448 3300007265 Bacteria 1869
109 Ga0105250_10082560 3300009092 Bacteria 1303
110 Ga0111539_10017672 3300009094 Bacteria 8829
111 Ga0111539_10024952 3300009094 Bacteria 7328
112 Ga0111539_10183573 3300009094 Bacteria 2443
113 Ga0105245_10000221 3300009098 Bacteria 54253
114 Ga0114129_10003624 3300009147 Bacteria 21726
115 Ga0114129_10176207 3300009147 Bacteria 2912
116 Ga0114129_10564282 3300009147 Bacteria 1479
117 Ga0114129_10997157 3300009147 Bacteria 1055
118 Ga0105243_10000288 3300009148 Bacteria 55680
119 Ga0105241_10060671 3300009174 Bacteria 2910
120 Ga0105242_10007197 3300009176 Bacteria 8582
121 Ga0105248_10244634 3300009177 Bacteria 2019
122 Ga0105248_10421584 3300009177 Bacteria 1503
123 Ga0105249_10005927 3300009553 Bacteria 10589
124 Ga0105249_10732643 3300009553 Bacteria 1050
125 Ga0105239_10769174 3300010375 Bacteria 1103
126 Ga0157369_10447257 3300013105 Bacteria 1338
127 Ga0157378_10003188 3300013297 Bacteria 14572
128 Ga0157375_10964113 3300013308 Bacteria 994
129 Ga0157380_10365277 3300014326 Bacteria 1356
130 Ga0157379_10145324 3300014968 Bacteria 2138
131 Ga0157379_10374759 3300014968 Bacteria 1305
132 Ga0157376_10001746 3300014969 Bacteria 14461
133 Ga0157376_10114409 3300014969 Bacteria 2380
134 Ga0207696_1059279 3300025711 Bacteria 1079
135 Ga0207653_10003920 3300025885 Bacteria 4676
136 Ga0207642_10000648 3300025899 Bacteria 10682
137 Ga0207688_10017562 3300025901 Bacteria 3889
138 Ga0207685_10193850 3300025905 Bacteria 950
139 Ga0207645_10110269 3300025907 Bacteria 1781
140 Ga0207643_10016408 3300025908 Bacteria 4041
141 Ga0207654_10131135 3300025911 Bacteria 1587
142 Ga0207707_10003043 3300025912 Bacteria 14898
143 Ga0207660_10000702 3300025917 Bacteria 22321
144 Ga0207660_10115536 3300025917 Bacteria 2026
145 Ga0207662_10000147 3300025918 Bacteria 33968
146 Ga0207662_10062976 3300025918 Bacteria 2230
147 Ga0207662_10264946 3300025918 Bacteria 1132
148 Ga0207652_10027643 3300025921 Bacteria 4728
149 Ga0207687_10000574 3300025927 Bacteria 24851
150 Ga0207687_10215319 3300025927 Bacteria 1509
151 Ga0207700_10183492 3300025928 Bacteria 1754
152 Ga0207664_10035361 3300025929 Bacteria 3854
153 Ga0207706_10264554 3300025933 Bacteria 1501
154 Ga0207686_10002658 3300025934 Bacteria 9692
155 Ga0207709_10000618 3300025935 Bacteria 29187
156 Ga0207670_10000680 3300025936 Bacteria 17990
157 Ga0207670_10030770 3300025936 Bacteria 3431
158 Ga0207670_10168324 3300025936 Bacteria 1641
159 Ga0207704_10001535 3300025938 Bacteria 10350
160 Ga0207665_10229649 3300025939 Bacteria 1363
161 Ga0207711_10168739 3300025941 Bacteria 1985
162 Ga0207689_10000406 3300025942 Bacteria 40450
163 Ga0207689_10171531 3300025942 Bacteria 1788
164 Ga0207689_10257313 3300025942 Bacteria 1444
165 Ga0207661_10418082 3300025944 Bacteria 1217
166 Ga0207667_10005238 3300025949 Bacteria 15820
167 Ga0207651_10673661 3300025960 Bacteria 909
168 Ga0207640_10036995 3300025981 Bacteria 3068
169 Ga0207677_10002410 3300026023 Bacteria 9804
170 Ga0207703_10003447 3300026035 Bacteria 13249
171 Ga0207639_10038320 3300026041 Bacteria 3565
172 Ga0207708_10043534 3300026075 Bacteria 3421
173 Ga0207708_10291108 3300026075 Bacteria 1326
174 Ga0207708_10423052 3300026075 Bacteria 1105
175 Ga0207702_10048213 3300026078 Bacteria 3592
176 Ga0207641_10064841 3300026088 Bacteria 3123
177 Ga0207641_10586066 3300026088 Bacteria 1090
178 Ga0207641_10736560 3300026088 Bacteria 972
179 Ga0207648_10001117 3300026089 Bacteria 30142
180 Ga0207676_10010321 3300026095 Bacteria 6651
181 Ga0207675_100000880 3300026118 Bacteria 29964
182 Ga0207698_10060202 3300026142 Bacteria 2952
183 Ga0209969_1006766 3300027360 Bacteria 1615
184 Ga0209967_1000670 3300027364 Bacteria 4415
185 Ga0209981_1000849 3300027378 Bacteria 3863
186 Ga0209996_1011707 3300027395 Bacteria 1173
187 Ga0210000_1000420 3300027462 Bacteria 5849
188 Ga0209995_1001939 3300027471 Bacteria 3237
189 Ga0209968_1002252 3300027526 Bacteria 2914
190 Ga0209999_1009166 3300027543 Bacteria 1786
191 Ga0209588_1031491 3300027671 Bacteria 1697
192 Ga0209588_1040674 3300027671 Bacteria 1500
193 Ga0209966_1010715 3300027695 Bacteria 1660
194 Ga0209974_10097186 3300027876 Bacteria 1026
195 Ga0207428_10017018 3300027907 Bacteria 6246
196 Ga0268265_10000457 3300028380 Bacteria 43208
197 Ga0268264_10001149 3300028381 Bacteria 25798
198 Ga0307408_100507949 3300031548 Bacteria 1056
199 Ga0307408_100658473 3300031548 Bacteria 937
200 Ga0316575_10012693 3300031665 Bacteria 3137
201 Ga0316578_10007776 3300031728 Bacteria 5409
202 Ga0307407_10121325 3300031903 Bacteria 1658
203 Ga0307416_100228356 3300032002 Bacteria 1792
204 Ga0307416_100356686 3300032002 Bacteria 1482
205 Ga0307416_100459908 3300032002 Bacteria 1327
206 Ga0307416_100929507 3300032002 Bacteria 971
207 Ga0307411_10108978 3300032005 Bacteria 1977
208 Ga0316583_10011098 3300032133 Bacteria 3244
209 Ga0373959_0095475 3300034820 Bacteria 702
210 Ga0373938_0023064 3300034957 Bacteria 1276
211 Ga0373926_0000464 3300035083 Bacteria 10647
212 Ga0373929_0033029 3300035085 Bacteria 1116
213 Ga0373934_0046850 3300035086 Bacteria 1710
214 Ga0373934_0089437 3300035086 Bacteria 1240
215 Ga0373940_0002594 3300035088 Bacteria 3544
216 Ga0373940_0145723 3300035088 Bacteria 751
217 Ga0373944_0007658 3300035089 Bacteria 2899
218 Ga0373951_0008788 3300035091 Bacteria 2277
219 Ga0373952_0012774 3300035092 Bacteria 1657
220 Ga0373952_0081891 3300035092 Bacteria 825
221 Ga0373923_0060638 3300035111 Bacteria 1606
222 Ga0373923_0162358 3300035111 Bacteria 1020
223 Ga0373932_0007455 3300035112 Bacteria 2604
224 Ga0373936_0015984 3300035113 Bacteria 2880
225 Ga0373936_0176357 3300035113 Bacteria 936
226 Ga0373939_0032530 3300035114 Bacteria 1516
227 Ga0373939_0138926 3300035114 Unclassified 874
228 Ga0373939_0159612 3300035114 Bacteria 827
229 Ga0373941_0048947 3300035115 Bacteria 1336
230 Ga0373941_0090390 3300035115 Bacteria 1049
231 Ga0373941_0103176 3300035115 Bacteria 995
232 Ga0373953_0168563 3300035117 Bacteria 942
233 Ga0373954_0044684 3300035118 Bacteria 2068
234 Ga0373943_0070434 3300035170 Bacteria 1769
235 Ga0373943_0134820 3300035170 Bacteria 1325
236 Ga0373955_0003885 3300035172 Bacteria 6590
237 Ga0373942_0027304 3300035207 Bacteria 1484
238 Ga0373961_0046119 3300035241 Bacteria 1276
239 Ga0373961_0060963 3300035241 Bacteria 1144
240 Ga0373961_0067803 3300035241 Bacteria 1097
241 Ga0373962_0003212 3300035242 Bacteria 3921
242 Ga0316574_0071009 3300035398 Bacteria 2198
243 Ga0373924_0031756 3300035410 Bacteria 2125
244 Ga0373931_0000307 3300035691 Bacteria 20644
245 Ga0373931_0008459 3300035691 Bacteria 4882
246 Ga0373931_0021575 3300035691 Bacteria 3232
247 Ga0373931_0414886 3300035691 Bacteria 855
248 Ga0373935_0009034 3300035692 Bacteria 5962
249 Ga0373935_0076621 3300035692 Bacteria 2166
250 Ga0373927_0024017 3300035695 Bacteria 3988
251 Ga0373927_0165804 3300035695 Bacteria 1448
252 Ga0373933_0009165 3300035724 Bacteria 5401
253 Ga0373933_0010012 3300035724 Bacteria 5191
254 Ga0373933_0145379 3300035724 Bacteria 1499
255 Ga0373947_0017867 3300035725 Bacteria 4080
256 Ga0373937_0003689 3300036401 Bacteria 12935
257 Ga0373937_0008588 3300036401 Bacteria 8872
258 Ga0373937_0264821 3300036401 Bacteria 1621
259 Ga0316582_0004206 3300036647 Bacteria 7222
260 Ga0373925_0052139 3300037068 Bacteria 3056
261 Ga0316581_0003153 3300037588 Bacteria 4069
262 Ga0439431_0085648 3300041997 Bacteria 854
263 Ga0439434_0158929 3300042435 Bacteria 750
264 Ga0451577_0302095 3300042876 Bacteria 1450
265 Ga0453683_0659751 3300044673 Unclassified 684
266 Ga0466963_0346490 3300044694 Bacteria 1046
267 Ga0453684_0144830 3300044712 Bacteria 2832
268 Ga0466957_0277005 3300044842 Bacteria 1122
269 Ga0466960_0124005 3300044901 Bacteria 1356
270 Ga0466960_0155179 3300044901 Bacteria 1226
271 Ga0451576_0019385 3300045051 Bacteria 7426
272 Ga0451576_0196583 3300045051 Bacteria 2106
273 Ga0451576_0410375 3300045051 Bacteria 1420
274 Ga0451576_1213792 3300045051 Bacteria 787
275 Ga0466967_0014306 3300045976 Bacteria 6174
276 Ga0466967_1297218 3300045976 Bacteria 725
277 Ga0495592_0000306 3300046454 Bacteria 41265
278 Ga0495592_0201037 3300046454 Bacteria 1345
279 Ga0495603_0021666 3300046455 Bacteria 3892
280 Ga0495651_0048060 3300046462 Bacteria 3296
281 Ga0495580_0012307 3300046472 Bacteria 6566
282 Ga0495582_0007877 3300046473 Bacteria 5888
283 Ga0495582_0033300 3300046473 Bacteria 2833
284 Ga0495639_0210728 3300046475 Bacteria 953
285 Ga0495662_0001579 3300046476 Bacteria 11325
286 Ga0495662_0032452 3300046476 Bacteria 2522
287 Ga0495664_0213019 3300046477 Bacteria 1170
288 Ga0495584_0220507 3300046491 Bacteria 964
289 Ga0495594_0054049 3300046499 Bacteria 2213
290 Ga0495608_0000439 3300046511 Bacteria 29042
291 Ga0495608_0126403 3300046511 Bacteria 1637
292 Ga0495608_0128731 3300046511 Bacteria 1621
293 Ga0495608_0258700 3300046511 Bacteria 1084
294 Ga0495618_0028832 3300046514 Bacteria 3460
295 Ga0495628_0018055 3300046516 Bacteria 5851
296 Ga0495628_0138427 3300046516 Bacteria 1858
297 Ga0495630_0005926 3300046517 Bacteria 8641
298 Ga0495630_0007301 3300046517 Bacteria 7887
299 Ga0495630_0162504 3300046517 Bacteria 1700
300 Ga0495644_0078151 3300046523 Bacteria 1247
301 Ga0495663_0154828 3300046525 Unclassified 784
302 Ga0495666_0005118 3300046526 Bacteria 6628
303 Ga0495666_0041103 3300046526 Bacteria 2240
304 Ga0495642_0031504 3300046528 Bacteria 2127
305 Ga0495652_0035762 3300046529 Bacteria 4322
306 Ga0495652_0328540 3300046529 Bacteria 1102
307 Ga0495652_0588944 3300046529 Unclassified 760
308 Ga0495640_0000418 3300046533 Bacteria 30693
309 Ga0495640_0233409 3300046533 Bacteria 1156
310 Ga0495586_0000894 3300046535 Bacteria 17010
311 Ga0495586_0001224 3300046535 Bacteria 14424
312 Ga0495586_0255883 3300046535 Bacteria 999
313 Ga0495587_0093203 3300046536 Bacteria 1739
314 Ga0495598_0005537 3300046537 Bacteria 2806
315 Ga0495609_0128398 3300046538 Bacteria 1087
316 Ga0495621_0222521 3300046539 Bacteria 764
317 Ga0495667_0005672 3300046559 Bacteria 8447
318 Ga0495656_0066983 3300046615 Bacteria 1583
319 Ga0495634_0003074 3300046642 Bacteria 13580
320 Ga0495634_0093305 3300046642 Bacteria 1952
321 Ga0495635_0026655 3300046663 Bacteria 4020
322 Ga0495635_0199451 3300046663 Bacteria 1357
323 Ga0495635_0360262 3300046663 Bacteria 969
324 Ga0495659_0018950 3300046664 Bacteria 2298
325 Ga0495659_0030251 3300046664 Bacteria 1884
326 Ga0495588_0008929 3300046674 Bacteria 4615
327 Ga0495657_0050215 3300046675 Bacteria 2805
328 Ga0495599_0037906 3300046678 Bacteria 3028
329 Ga0495599_0224040 3300046678 Bacteria 1150
330 Ga0495646_0110605 3300046680 Bacteria 1565
331 Ga0495647_0001660 3300046681 Bacteria 6892
332 Ga0495658_0001390 3300046683 Bacteria 12703
333 Ga0495658_0002491 3300046683 Bacteria 9263
334 Ga0495669_0018647 3300046684 Bacteria 2985
335 Ga0495669_0273715 3300046684 Bacteria 812
336 Ga0495613_0003181 3300046689 Bacteria 12293
337 Ga0495624_0023371 3300046690 Bacteria 4077
338 Ga0495624_0079382 3300046690 Bacteria 2035
339 Ga0495624_0283801 3300046690 Bacteria 999
340 Ga0495670_0280078 3300046691 Bacteria 892
341 Ga0495600_0058153 3300046809 Bacteria 2525
342 Ga0495581_0051004 3300047315 Bacteria 2390
343 Ga0495604_0001668 3300047317 Bacteria 18261
344 Ga0495604_0243853 3300047317 Bacteria 1227
345 Ga0495636_0001523 3300047318 Bacteria 8797
346 Ga0495636_0284929 3300047318 Bacteria 770
347 Ga0495674_0031602 3300047319 Bacteria 4809
348 Ga0495674_0173995 3300047319 Bacteria 1795
349 Ga0495674_0219791 3300047319 Bacteria 1571
350 Ga0495676_0068243 3300047321 Bacteria 2748
351 Ga0495680_0003157 3300047322 Bacteria 16416
352 Ga0495680_0025132 3300047322 Bacteria 4934
353 Ga0495602_0111301 3300048088 Bacteria 2224
354 Ga0496114_0253794 3300048917 Bacteria 1548
355 Ga0501291_045569 3300049514 Bacteria 784
356 Ga0501031_0019174 3300049568 Bacteria 4454
357 Ga0501031_0096339 3300049568 Bacteria 1931
358 Ga0501032_0023948 3300049569 Bacteria 4217
359 Ga0501033_0006123 3300049570 Bacteria 9439
360 Ga0501033_0482818 3300049570 Bacteria 858
361 Ga0501034_0064201 3300049571 Bacteria 3686
362 Ga0501036_0000974 3300049572 Bacteria 21624
363 Ga0501036_0217905 3300049572 Bacteria 1603
364 Ga0501037_0059190 3300049573 Bacteria 2795
365 Ga0501038_0000189 3300049574 Bacteria 53371
366 Ga0501038_0690751 3300049574 Bacteria 765
367 Ga0501039_0000247 3300049575 Bacteria 39539
368 Ga0501039_0045360 3300049575 Bacteria 3396
369 Ga0501039_0576807 3300049575 Bacteria 882
370 Ga0501039_0958500 3300049575 Bacteria 665
371 Ga0501040_0000229 3300049576 Bacteria 32741
372 Ga0501040_0161416 3300049576 Bacteria 1584
373 Ga0501041_0000032 3300049577 Bacteria 44999
374 Ga0501041_0066674 3300049577 Bacteria 2206
375 Ga0501041_0139565 3300049577 Bacteria 1511
376 Ga0501042_0002212 3300049578 Bacteria 11860
377 Ga0501042_0079302 3300049578 Bacteria 2352
378 Ga0501042_0294021 3300049578 Bacteria 1173
379 Ga0501043_0009483 3300049579 Bacteria 7634
380 Ga0501046_0000156 3300049580 Bacteria 70512
381 Ga0501046_0127899 3300049580 Bacteria 1928
382 Ga0501046_0424629 3300049580 Bacteria 958
383 Ga0501048_0002226 3300049582 Bacteria 14775
384 Ga0501048_0025752 3300049582 Bacteria 4285
385 Ga0501048_0181896 3300049582 Bacteria 1490
386 Ga0501067_0048159 3300049583 Bacteria 2364
387 Ga0501068_0013299 3300049584 Bacteria 4680
388 Ga0501070_0017698 3300049586 Bacteria 5984
389 Ga0501071_0002557 3300049587 Bacteria 11093
390 Ga0501071_0276072 3300049587 Bacteria 1271
391 Ga0501071_0597436 3300049587 Bacteria 848
392 Ga0501072_0002789 3300049588 Bacteria 13112
393 Ga0501072_0059305 3300049588 Bacteria 3017
394 Ga0501072_0218759 3300049588 Bacteria 1518
395 Ga0501073_0083658 3300049589 Bacteria 2220
396 Ga0501074_0021489 3300049590 Bacteria 4685
397 Ga0501074_0189581 3300049590 Bacteria 1466
398 Ga0501074_0604437 3300049590 Bacteria 776
399 Ga0501075_0000053 3300049591 Bacteria 49110
400 Ga0501075_0036724 3300049591 Bacteria 3658
401 Ga0501076_0089350 3300049592 Bacteria 2476
402 Ga0501077_0000086 3300049593 Bacteria 46652
403 Ga0501077_0043923 3300049593 Bacteria 2840
404 Ga0501079_0000208 3300049741 Bacteria 34357
405 Ga0501079_0076555 3300049741 Bacteria 2588
406 Ga0501079_0615138 3300049741 Bacteria 855
407 Ga0501080_0038117 3300049742 Bacteria 4489
408 Ga0501080_0376957 3300049742 Bacteria 1279
409 Ga0501081_0000127 3300049743 Bacteria 33437
410 Ga0501081_0036177 3300049743 Bacteria 3366
411 Ga0501081_0324500 3300049743 Bacteria 1132
412 Ga0501081_0395734 3300049743 Bacteria 1022
413 Ga0501273_024264 3300049770 Bacteria 836
414 Ga0501035_0030034 3300049822 Bacteria 4955
415 Ga0501035_0943801 3300049822 Unclassified 681
416 Ga0501044_0273481 3300049823 Bacteria 1624
417 Ga0501045_0000372 3300049824 Bacteria 26953
418 Ga0501045_0021401 3300049824 Bacteria 4626
419 Ga0501045_0153426 3300049824 Bacteria 1714
420 nmdc:mga05p37_1475_c1 3300050507 Bacteria 27330
421 nmdc:mga05p37_348392_c1 3300050507 Bacteria 1744
422 nmdc:mga05p37_67749_c1 3300050507 Bacteria 4391
423 nmdc:mga09592_1566_c1 3300050508 Bacteria 18396
424 nmdc:mga09592_33293_c1 3300050508 Bacteria 4301
425 nmdc:mga0qj67_73075_c1 3300050509 Bacteria 2739
426 nmdc:mga08y16_117385_c1 3300050511 Bacteria 2770
427 nmdc:mga08y16_14684_c1 3300050511 Bacteria 8234
428 nmdc:mga0n895_134158_c1 3300050512 Bacteria 2502
429 nmdc:mga0n895_1409_c1 3300050512 Bacteria 17946
430 nmdc:mga0n895_3845_c1 3300050512 Bacteria 12188
431 nmdc:mga0rr50_128_c1 3300050513 Bacteria 41482
432 nmdc:mga0rr50_4412_c1 3300050513 Bacteria 8270
433 nmdc:mga0rr50_685455_c1 3300050513 Bacteria 875
434 nmdc:mga0rr50_685487_c1 3300050513 Unclassified 875
435 nmdc:mga08x19_23769_c1 3300050514 Bacteria 3803
436 nmdc:mga08x19_2600_c1 3300050514 Bacteria 10959
437 nmdc:mga08x19_434_c1 3300050514 Bacteria 28646
438 nmdc:mga08x19_45640_c1 3300050514 Bacteria 2800
439 nmdc:mga08x19_58036_c1 3300050514 Bacteria 2503
440 nmdc:mga0a205_120739_c1 3300050515 Bacteria 2520
441 nmdc:mga0a205_146886_c1 3300050515 Bacteria 2258
442 nmdc:mga0a205_160_c1 3300050515 Bacteria 44269
443 nmdc:mga0a205_332924_c1 3300050515 Bacteria 1388
444 nmdc:mga0a205_443656_c1 3300050515 Bacteria 1158
445 Ga0495601_0014742 3300053077 Bacteria 4717
446 Ga0495612_0103942 3300053078 Bacteria 1211
447 Ga0495595_0330639 3300053084 Unclassified 768
448 Ga0495619_0026146 3300053085 Bacteria 3754
449 Ga0495619_0248396 3300053085 Bacteria 1233
450 Ga0501084_0003487 3300054114 Bacteria 12782
451 Ga0501084_0066147 3300054114 Bacteria 3024
452 Ga0501084_0215286 3300054114 Bacteria 1621
453 Ga0590075_071274 3300059424 Bacteria 898
454 Ga0501082_0003275 3300060353 Bacteria 14136
455 Ga0530510_0000115 3300061734 Bacteria 45273

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046529 Ga0495652_0588944 Ga0495652_0588944_16_579 187
2 3300046684 Ga0495669_0273715 Ga0495669_0273715_221_784 187
3 3300047315 Ga0495581_0051004 Ga0495581_0051004_1799_2362 187
4 3300044842 Ga0466957_0277005 Ga0466957_0277005_14_583 189
5 3300049574 Ga0501038_0690751 Ga0501038_0690751_33_602 189
6 3300045976 Ga0466967_1297218 Ga0466967_1297218_108_683 191
7 3300005468 Ga0070707_100411548 Ga0070707_1004115482 207
8 3300009094 Ga0111539_10183573 Ga0111539_101835733 207
9 3300035086 Ga0373934_0046850 Ga0373934_0046850_376_999 207
10 3300035111 Ga0373923_0060638 Ga0373923_0060638_790_1413 207
11 3300035114 Ga0373939_0159612 Ga0373939_0159612_190_813 207
12 3300035118 Ga0373954_0044684 Ga0373954_0044684_160_783 207
13 3300035170 Ga0373943_0134820 Ga0373943_0134820_257_880 207
14 3300035172 Ga0373955_0003885 Ga0373955_0003885_4694_5317 207
15 3300035410 Ga0373924_0031756 Ga0373924_0031756_553_1176 207
16 3300035692 Ga0373935_0076621 Ga0373935_0076621_389_1012 207
17 3300035695 Ga0373927_0165804 Ga0373927_0165804_439_1062 207
18 3300035724 Ga0373933_0009165 Ga0373933_0009165_3828_4451 207
19 3300036401 Ga0373937_0008588 Ga0373937_0008588_5840_6463 207
20 3300041997 Ga0439431_0085648 Ga0439431_0085648_220_843 207
21 3300044673 Ga0453683_0659751 Ga0453683_0659751_37_660 207
22 3300046454 Ga0495592_0000306 Ga0495592_0000306_38538_39161 207
23 3300046476 Ga0495662_0001579 Ga0495662_0001579_7921_8544 207
24 3300046476 Ga0495662_0032452 Ga0495662_0032452_231_854 207
25 3300046477 Ga0495664_0213019 Ga0495664_0213019_215_838 207
26 3300046511 Ga0495608_0000439 Ga0495608_0000439_18515_19138 207
27 3300046511 Ga0495608_0128731 Ga0495608_0128731_766_1389 207
28 3300046514 Ga0495618_0028832 Ga0495618_0028832_2628_3251 207
29 3300046516 Ga0495628_0018055 Ga0495628_0018055_2042_2665 207
30 3300046516 Ga0495628_0138427 Ga0495628_0138427_1196_1819 207
31 3300046517 Ga0495630_0005926 Ga0495630_0005926_7713_8336 207
32 3300046517 Ga0495630_0007301 Ga0495630_0007301_5614_6237 207
33 3300046526 Ga0495666_0005118 Ga0495666_0005118_4286_4909 207
34 3300046529 Ga0495652_0035762 Ga0495652_0035762_2330_2953 207
35 3300046529 Ga0495652_0328540 Ga0495652_0328540_405_1028 207
36 3300046533 Ga0495640_0000418 Ga0495640_0000418_29173_29796 207
37 3300046533 Ga0495640_0233409 Ga0495640_0233409_329_952 207
38 3300046535 Ga0495586_0000894 Ga0495586_0000894_11869_12492 207
39 3300046535 Ga0495586_0255883 Ga0495586_0255883_69_692 207
40 3300046536 Ga0495587_0093203 Ga0495587_0093203_499_1122 207
41 3300046538 Ga0495609_0128398 Ga0495609_0128398_406_1029 207
42 3300046539 Ga0495621_0222521 Ga0495621_0222521_129_752 207
43 3300046559 Ga0495667_0005672 Ga0495667_0005672_4993_5616 207
44 3300046642 Ga0495634_0003074 Ga0495634_0003074_10689_11312 207
45 3300046642 Ga0495634_0093305 Ga0495634_0093305_968_1591 207
46 3300046663 Ga0495635_0026655 Ga0495635_0026655_3067_3690 207
47 3300046663 Ga0495635_0199451 Ga0495635_0199451_445_1068 207
48 3300046663 Ga0495635_0360262 Ga0495635_0360262_93_716 207
49 3300046664 Ga0495659_0030251 Ga0495659_0030251_756_1379 207
50 3300046678 Ga0495599_0037906 Ga0495599_0037906_1853_2476 207
51 3300046678 Ga0495599_0224040 Ga0495599_0224040_242_865 207
52 3300046680 Ga0495646_0110605 Ga0495646_0110605_615_1238 207
53 3300046683 Ga0495658_0001390 Ga0495658_0001390_11772_12395 207
54 3300046689 Ga0495613_0003181 Ga0495613_0003181_1101_1724 207
55 3300046690 Ga0495624_0023371 Ga0495624_0023371_721_1344 207
56 3300046690 Ga0495624_0079382 Ga0495624_0079382_579_1202 207
57 3300046690 Ga0495624_0283801 Ga0495624_0283801_105_728 207
58 3300046809 Ga0495600_0058153 Ga0495600_0058153_1276_1899 207
59 3300047317 Ga0495604_0001668 Ga0495604_0001668_11890_12513 207
60 3300047317 Ga0495604_0243853 Ga0495604_0243853_530_1153 207
61 3300047318 Ga0495636_0001523 Ga0495636_0001523_7956_8579 207
62 3300047318 Ga0495636_0284929 Ga0495636_0284929_24_647 207
63 3300047319 Ga0495674_0031602 Ga0495674_0031602_3423_4046 207
64 3300047319 Ga0495674_0173995 Ga0495674_0173995_845_1468 207
65 3300047319 Ga0495674_0219791 Ga0495674_0219791_125_748 207
66 3300047322 Ga0495680_0003157 Ga0495680_0003157_10800_11423 207
67 3300047322 Ga0495680_0025132 Ga0495680_0025132_3528_4151 207
68 3300048088 Ga0495602_0111301 Ga0495602_0111301_159_782 207
69 3300049575 Ga0501039_0958500 Ga0501039_0958500_19_642 207
70 3300049742 Ga0501080_0376957 Ga0501080_0376957_592_1215 207
71 3300050515 nmdc:mga0a205_443656_c1 nmdc:mga0a205_443656_c1_183_806 207
72 3300053077 Ga0495601_0014742 Ga0495601_0014742_3301_3924 207
73 3300053078 Ga0495612_0103942 Ga0495612_0103942_246_869 207
74 3300053084 Ga0495595_0330639 Ga0495595_0330639_125_748 207
75 3300053085 Ga0495619_0026146 Ga0495619_0026146_2546_3169 207
76 3300053085 Ga0495619_0248396 Ga0495619_0248396_345_968 207
77 3300005547 Ga0070693_100347144 Ga0070693_1003471441 209
78 3300006852 Ga0075433_10129818 Ga0075433_101298182 209
79 3300007076 Ga0075435_100006511 Ga0075435_1000065113 209
80 3300007265 Ga0099794_10058448 Ga0099794_100584483 209
81 3300027671 Ga0209588_1031491 Ga0209588_10314913 209
82 3300034820 Ga0373959_0095475 Ga0373959_0095475_53_682 209
83 3300035086 Ga0373934_0089437 Ga0373934_0089437_450_1079 209
84 3300035724 Ga0373933_0010012 Ga0373933_0010012_3462_4091 209
85 3300036401 Ga0373937_0003689 Ga0373937_0003689_6293_6922 209
86 3300046511 Ga0495608_0126403 Ga0495608_0126403_611_1240 209
87 3300046675 Ga0495657_0050215 Ga0495657_0050215_233_862 209
88 3300049568 Ga0501031_0096339 Ga0501031_0096339_243_872 209
89 3300049570 Ga0501033_0482818 Ga0501033_0482818_66_695 209
90 3300049572 Ga0501036_0217905 Ga0501036_0217905_49_678 209
91 3300049575 Ga0501039_0045360 Ga0501039_0045360_1052_1681 209
92 3300049575 Ga0501039_0576807 Ga0501039_0576807_72_701 209
93 3300049576 Ga0501040_0161416 Ga0501040_0161416_486_1115 209
94 3300049577 Ga0501041_0139565 Ga0501041_0139565_580_1209 209
95 3300049578 Ga0501042_0079302 Ga0501042_0079302_1688_2317 209
96 3300049580 Ga0501046_0127899 Ga0501046_0127899_965_1594 209
97 3300049582 Ga0501048_0025752 Ga0501048_0025752_1305_1934 209
98 3300049582 Ga0501048_0181896 Ga0501048_0181896_441_1070 209
99 3300049587 Ga0501071_0276072 Ga0501071_0276072_232_861 209
100 3300049588 Ga0501072_0059305 Ga0501072_0059305_1363_1992 209
101 3300049588 Ga0501072_0218759 Ga0501072_0218759_761_1390 209
102 3300049590 Ga0501074_0189581 Ga0501074_0189581_404_1033 209
103 3300049591 Ga0501075_0036724 Ga0501075_0036724_446_1075 209
104 3300049592 Ga0501076_0089350 Ga0501076_0089350_717_1346 209
105 3300049593 Ga0501077_0043923 Ga0501077_0043923_597_1226 209
106 3300049741 Ga0501079_0076555 Ga0501079_0076555_555_1184 209
107 3300049743 Ga0501081_0036177 Ga0501081_0036177_1365_1994 209
108 3300049743 Ga0501081_0324500 Ga0501081_0324500_210_839 209
109 3300049743 Ga0501081_0395734 Ga0501081_0395734_64_693 209
110 3300049822 Ga0501035_0943801 Ga0501035_0943801_25_654 209
111 3300049824 Ga0501045_0021401 Ga0501045_0021401_2431_3060 209
112 3300050512 nmdc:mga0n895_3845_c1 nmdc:mga0n895_3845_c1_8243_8872 209
113 3300050513 nmdc:mga0rr50_4412_c1 nmdc:mga0rr50_4412_c1_1519_2148 209
114 3300050514 nmdc:mga08x19_58036_c1 nmdc:mga08x19_58036_c1_1088_1717 209
115 3300050515 nmdc:mga0a205_146886_c1 nmdc:mga0a205_146886_c1_557_1186 209
116 3300054114 Ga0501084_0066147 Ga0501084_0066147_2242_2871 209
117 3300005545 Ga0070695_100011156 Ga0070695_1000111566 211
118 3300005546 Ga0070696_100071538 Ga0070696_1000715382 211
119 3300006914 Ga0075436_100009290 Ga0075436_1000092902 211
120 3300007265 Ga0099794_10025069 Ga0099794_100250693 211
121 3300035085 Ga0373929_0033029 Ga0373929_0033029_355_990 211
122 3300035115 Ga0373941_0048947 Ga0373941_0048947_112_747 211
123 3300035241 Ga0373961_0060963 Ga0373961_0060963_465_1100 211
124 3300035691 Ga0373931_0008459 Ga0373931_0008459_1826_2461 211
125 3300049514 Ga0501291_045569 Ga0501291_045569_38_673 211
126 3300050514 nmdc:mga08x19_45640_c1 nmdc:mga08x19_45640_c1_409_1044 211
127 3300049577 Ga0501041_0066674 Ga0501041_0066674_131_796 212
128 3300049741 Ga0501079_0615138 Ga0501079_0615138_92_757 212
129 3300005444 Ga0070694_100137664 Ga0070694_1001376643 213
130 3300005545 Ga0070695_100041893 Ga0070695_1000418934 213
131 3300042435 Ga0439434_0158929 Ga0439434_0158929_78_719 213
132 3300049824 Ga0501045_0153426 Ga0501045_0153426_616_1284 213
133 3300005985 Ga0081539_10001863 Ga0081539_1000186332 217
134 3300006846 Ga0075430_100066775 Ga0075430_1000667752 217
135 3300014968 Ga0157379_10374759 Ga0157379_103747592 217
136 3300025933 Ga0207706_10264554 Ga0207706_102645542 217
137 3300027360 Ga0209969_1006766 Ga0209969_10067662 217
138 3300027364 Ga0209967_1000670 Ga0209967_10006704 217
139 3300027378 Ga0209981_1000849 Ga0209981_10008494 217
140 3300027462 Ga0210000_1000420 Ga0210000_10004202 217
141 3300027471 Ga0209995_1001939 Ga0209995_10019392 217
142 3300027526 Ga0209968_1002252 Ga0209968_10022524 217
143 3300027695 Ga0209966_1010715 Ga0209966_10107152 217
144 3300032002 Ga0307416_100228356 Ga0307416_1002283563 217
145 3300032002 Ga0307416_100929507 Ga0307416_1009295071 217
146 3300050509 nmdc:mga0qj67_73075_c1 nmdc:mga0qj67_73075_c1_1771_2424 217
147 3300005334 Ga0068869_100241321 Ga0068869_1002413212 218
148 3300005438 Ga0070701_10354236 Ga0070701_103542361 218
149 3300005467 Ga0070706_100864657 Ga0070706_1008646571 218
150 3300005536 Ga0070697_100004494 Ga0070697_1000044946 218
151 3300005546 Ga0070696_100325810 Ga0070696_1003258102 218
152 3300005546 Ga0070696_100702179 Ga0070696_1007021792 218
153 3300005549 Ga0070704_100523199 Ga0070704_1005231991 218
154 3300005615 Ga0070702_100344727 Ga0070702_1003447272 218
155 3300005617 Ga0068859_100450873 Ga0068859_1004508732 218
156 3300005842 Ga0068858_100412054 Ga0068858_1004120542 218
157 3300006844 Ga0075428_100071689 Ga0075428_1000716892 218
158 3300006847 Ga0075431_100073443 Ga0075431_1000734436 218
159 3300006880 Ga0075429_100060935 Ga0075429_1000609354 218
160 3300006931 Ga0097620_100450888 Ga0097620_1004508882 218
161 3300007076 Ga0075435_100019688 Ga0075435_1000196887 218
162 3300009147 Ga0114129_10176207 Ga0114129_101762076 218
163 3300025942 Ga0207689_10257313 Ga0207689_102573132 218
164 3300026075 Ga0207708_10291108 Ga0207708_102911082 218
165 3300027543 Ga0209999_1009166 Ga0209999_10091663 218
166 3300027671 Ga0209588_1040674 Ga0209588_10406742 218
167 3300027876 Ga0209974_10097186 Ga0209974_100971862 218
168 3300031548 Ga0307408_100507949 Ga0307408_1005079492 218
169 3300031548 Ga0307408_100658473 Ga0307408_1006584732 218
170 3300032002 Ga0307416_100459908 Ga0307416_1004599082 218
171 3300035092 Ga0373952_0081891 Ga0373952_0081891_21_677 218
172 3300035113 Ga0373936_0176357 Ga0373936_0176357_44_700 218
173 3300035114 Ga0373939_0138926 Ga0373939_0138926_66_722 218
174 3300046473 Ga0495582_0033300 Ga0495582_0033300_381_1037 218
175 3300046491 Ga0495584_0220507 Ga0495584_0220507_190_846 218
176 3300050507 nmdc:mga05p37_67749_c1 nmdc:mga05p37_67749_c1_3399_4055 218
177 3300050508 nmdc:mga09592_33293_c1 nmdc:mga09592_33293_c1_2900_3556 218
178 3300005295 Ga0065707_10153596 Ga0065707_101535961 220
179 3300005334 Ga0068869_100129604 Ga0068869_1001296042 220
180 3300005340 Ga0070689_100044068 Ga0070689_1000440683 220
181 3300005343 Ga0070687_100125973 Ga0070687_1001259732 220
182 3300005544 Ga0070686_100387975 Ga0070686_1003879752 220
183 3300005614 Ga0068856_100242674 Ga0068856_1002426743 220
184 3300005615 Ga0070702_100276079 Ga0070702_1002760792 220
185 3300005618 Ga0068864_100038245 Ga0068864_1000382455 220
186 3300006163 Ga0070715_10244414 Ga0070715_102444142 220
187 3300006844 Ga0075428_100005478 Ga0075428_1000054789 220
188 3300006852 Ga0075433_10076963 Ga0075433_100769632 220
189 3300006871 Ga0075434_100000002 Ga0075434_10000000290 220
190 3300006871 Ga0075434_100002230 Ga0075434_10000223017 220
191 3300006880 Ga0075429_100003080 Ga0075429_10000308010 220
192 3300006914 Ga0075436_100105134 Ga0075436_1001051343 220
193 3300007076 Ga0075435_100000089 Ga0075435_10000008942 220
194 3300009094 Ga0111539_10017672 Ga0111539_1001767212 220
195 3300009094 Ga0111539_10024952 Ga0111539_100249526 220
196 3300009147 Ga0114129_10003624 Ga0114129_1000362412 220
197 3300009147 Ga0114129_10997157 Ga0114129_109971572 220
198 3300009553 Ga0105249_10732643 Ga0105249_107326432 220
199 3300013105 Ga0157369_10447257 Ga0157369_104472571 220
200 3300025936 Ga0207670_10030770 Ga0207670_100307704 220
201 3300025942 Ga0207689_10171531 Ga0207689_101715312 220
202 3300026088 Ga0207641_10586066 Ga0207641_105860662 220
203 3300026088 Ga0207641_10736560 Ga0207641_107365602 220
204 3300026095 Ga0207676_10010321 Ga0207676_100103216 220
205 3300027907 Ga0207428_10017018 Ga0207428_100170187 220
206 3300031665 Ga0316575_10012693 Ga0316575_100126933 220
207 3300031728 Ga0316578_10007776 Ga0316578_100077762 220
208 3300031903 Ga0307407_10121325 Ga0307407_101213252 220
209 3300032002 Ga0307416_100356686 Ga0307416_1003566862 220
210 3300032005 Ga0307411_10108978 Ga0307411_101089782 220
211 3300032133 Ga0316583_10011098 Ga0316583_100110984 220
212 3300034957 Ga0373938_0023064 Ga0373938_0023064_396_1058 220
213 3300035083 Ga0373926_0000464 Ga0373926_0000464_8905_9567 220
214 3300035088 Ga0373940_0002594 Ga0373940_0002594_757_1419 220
215 3300035088 Ga0373940_0145723 Ga0373940_0145723_55_717 220
216 3300035089 Ga0373944_0007658 Ga0373944_0007658_1110_1772 220
217 3300035091 Ga0373951_0008788 Ga0373951_0008788_238_900 220
218 3300035092 Ga0373952_0012774 Ga0373952_0012774_654_1316 220
219 3300035111 Ga0373923_0162358 Ga0373923_0162358_262_924 220
220 3300035112 Ga0373932_0007455 Ga0373932_0007455_1465_2127 220
221 3300035113 Ga0373936_0015984 Ga0373936_0015984_359_1021 220
222 3300035114 Ga0373939_0032530 Ga0373939_0032530_105_767 220
223 3300035115 Ga0373941_0090390 Ga0373941_0090390_25_687 220
224 3300035115 Ga0373941_0103176 Ga0373941_0103176_32_694 220
225 3300035170 Ga0373943_0070434 Ga0373943_0070434_474_1136 220
226 3300035207 Ga0373942_0027304 Ga0373942_0027304_369_1031 220
227 3300035241 Ga0373961_0046119 Ga0373961_0046119_429_1091 220
228 3300035241 Ga0373961_0067803 Ga0373961_0067803_127_789 220
229 3300035242 Ga0373962_0003212 Ga0373962_0003212_922_1584 220
230 3300035398 Ga0316574_0071009 Ga0316574_0071009_1467_2129 220
231 3300035691 Ga0373931_0000307 Ga0373931_0000307_9097_9759 220
232 3300035692 Ga0373935_0009034 Ga0373935_0009034_4134_4796 220
233 3300035695 Ga0373927_0024017 Ga0373927_0024017_2165_2827 220
234 3300035725 Ga0373947_0017867 Ga0373947_0017867_474_1136 220
235 3300036647 Ga0316582_0004206 Ga0316582_0004206_6440_7102 220
236 3300037068 Ga0373925_0052139 Ga0373925_0052139_360_1022 220
237 3300037588 Ga0316581_0003153 Ga0316581_0003153_597_1259 220
238 3300042876 Ga0451577_0302095 Ga0451577_0302095_778_1440 220
239 3300044694 Ga0466963_0346490 Ga0466963_0346490_234_896 220
240 3300044712 Ga0453684_0144830 Ga0453684_0144830_494_1156 220
241 3300045051 Ga0451576_0019385 Ga0451576_0019385_6377_7039 220
242 3300045051 Ga0451576_0196583 Ga0451576_0196583_138_800 220
243 3300045051 Ga0451576_0410375 Ga0451576_0410375_54_716 220
244 3300045051 Ga0451576_1213792 Ga0451576_1213792_105_767 220
245 3300045976 Ga0466967_0014306 Ga0466967_0014306_3429_4091 220
246 3300046455 Ga0495603_0021666 Ga0495603_0021666_2919_3581 220
247 3300046472 Ga0495580_0012307 Ga0495580_0012307_3997_4659 220
248 3300046473 Ga0495582_0007877 Ga0495582_0007877_2267_2929 220
249 3300046475 Ga0495639_0210728 Ga0495639_0210728_157_819 220
250 3300046499 Ga0495594_0054049 Ga0495594_0054049_1006_1668 220
251 3300046511 Ga0495608_0258700 Ga0495608_0258700_13_675 220
252 3300046517 Ga0495630_0162504 Ga0495630_0162504_466_1128 220
253 3300046523 Ga0495644_0078151 Ga0495644_0078151_37_699 220
254 3300046525 Ga0495663_0154828 Ga0495663_0154828_53_715 220
255 3300046526 Ga0495666_0041103 Ga0495666_0041103_532_1194 220
256 3300046535 Ga0495586_0001224 Ga0495586_0001224_12529_13191 220
257 3300046537 Ga0495598_0005537 Ga0495598_0005537_746_1408 220
258 3300046615 Ga0495656_0066983 Ga0495656_0066983_432_1094 220
259 3300046664 Ga0495659_0018950 Ga0495659_0018950_631_1293 220
260 3300046674 Ga0495588_0008929 Ga0495588_0008929_3374_4036 220
261 3300046681 Ga0495647_0001660 Ga0495647_0001660_995_1657 220
262 3300046683 Ga0495658_0002491 Ga0495658_0002491_7705_8367 220
263 3300046691 Ga0495670_0280078 Ga0495670_0280078_97_759 220
264 3300047321 Ga0495676_0068243 Ga0495676_0068243_322_984 220
265 3300049568 Ga0501031_0019174 Ga0501031_0019174_3230_3892 220
266 3300049569 Ga0501032_0023948 Ga0501032_0023948_275_937 220
267 3300049570 Ga0501033_0006123 Ga0501033_0006123_3815_4477 220
268 3300049571 Ga0501034_0064201 Ga0501034_0064201_2787_3449 220
269 3300049572 Ga0501036_0000974 Ga0501036_0000974_6829_7491 220
270 3300049573 Ga0501037_0059190 Ga0501037_0059190_1256_1918 220
271 3300049574 Ga0501038_0000189 Ga0501038_0000189_39363_40025 220
272 3300049575 Ga0501039_0000247 Ga0501039_0000247_25712_26374 220
273 3300049576 Ga0501040_0000229 Ga0501040_0000229_6542_7204 220
274 3300049577 Ga0501041_0000032 Ga0501041_0000032_23614_24276 220
275 3300049578 Ga0501042_0002212 Ga0501042_0002212_530_1192 220
276 3300049578 Ga0501042_0294021 Ga0501042_0294021_54_716 220
277 3300049579 Ga0501043_0009483 Ga0501043_0009483_3400_4062 220
278 3300049580 Ga0501046_0000156 Ga0501046_0000156_27939_28601 220
279 3300049580 Ga0501046_0424629 Ga0501046_0424629_102_764 220
280 3300049582 Ga0501048_0002226 Ga0501048_0002226_501_1163 220
281 3300049584 Ga0501068_0013299 Ga0501068_0013299_1330_1992 220
282 3300049586 Ga0501070_0017698 Ga0501070_0017698_2720_3382 220
283 3300049587 Ga0501071_0002557 Ga0501071_0002557_6291_6953 220
284 3300049587 Ga0501071_0597436 Ga0501071_0597436_33_695 220
285 3300049588 Ga0501072_0002789 Ga0501072_0002789_1422_2084 220
286 3300049589 Ga0501073_0083658 Ga0501073_0083658_825_1487 220
287 3300049590 Ga0501074_0021489 Ga0501074_0021489_2336_2998 220
288 3300049590 Ga0501074_0604437 Ga0501074_0604437_62_724 220
289 3300049591 Ga0501075_0000053 Ga0501075_0000053_41786_42448 220
290 3300049593 Ga0501077_0000086 Ga0501077_0000086_5265_5927 220
291 3300049741 Ga0501079_0000208 Ga0501079_0000208_7894_8556 220
292 3300049742 Ga0501080_0038117 Ga0501080_0038117_2678_3340 220
293 3300049743 Ga0501081_0000127 Ga0501081_0000127_18687_19349 220
294 3300049770 Ga0501273_024264 Ga0501273_024264_128_790 220
295 3300049822 Ga0501035_0030034 Ga0501035_0030034_1385_2047 220
296 3300049823 Ga0501044_0273481 Ga0501044_0273481_630_1292 220
297 3300049824 Ga0501045_0000372 Ga0501045_0000372_16304_16966 220
298 3300050507 nmdc:mga05p37_1475_c1 nmdc:mga05p37_1475_c1_13491_14153 220
299 3300050508 nmdc:mga09592_1566_c1 nmdc:mga09592_1566_c1_13377_14039 220
300 3300050511 nmdc:mga08y16_117385_c1 nmdc:mga08y16_117385_c1_735_1397 220
301 3300050511 nmdc:mga08y16_14684_c1 nmdc:mga08y16_14684_c1_1690_2352 220
302 3300050512 nmdc:mga0n895_1409_c1 nmdc:mga0n895_1409_c1_2390_3052 220
303 3300050513 nmdc:mga0rr50_128_c1 nmdc:mga0rr50_128_c1_15556_16218 220
304 3300050514 nmdc:mga08x19_434_c1 nmdc:mga08x19_434_c1_9851_10513 220
305 3300050515 nmdc:mga0a205_160_c1 nmdc:mga0a205_160_c1_24292_24954 220
306 3300054114 Ga0501084_0003487 Ga0501084_0003487_4891_5553 220
307 3300054114 Ga0501084_0215286 Ga0501084_0215286_928_1590 220
308 3300059424 Ga0590075_071274 Ga0590075_071274_117_779 220
309 3300060353 Ga0501082_0003275 Ga0501082_0003275_3693_4355 220
310 3300061734 Ga0530510_0000115 Ga0530510_0000115_42384_43046 220
311 3300002239 JGI24034J26672_10015759 JGI24034J26672_100157592 222
312 3300005328 Ga0070676_10087962 Ga0070676_100879623 222
313 3300005329 Ga0070683_100479257 Ga0070683_1004792572 222
314 3300005330 Ga0070690_100000252 Ga0070690_10000025217 222
315 3300005334 Ga0068869_100000052 Ga0068869_10000005222 222
316 3300005336 Ga0070680_100001647 Ga0070680_10000164718 222
317 3300005336 Ga0070680_100112235 Ga0070680_1001122353 222
318 3300005337 Ga0070682_100017681 Ga0070682_1000176815 222
319 3300005338 Ga0068868_100001208 Ga0068868_10000120813 222
320 3300005340 Ga0070689_100000387 Ga0070689_1000003872 222
321 3300005340 Ga0070689_100248692 Ga0070689_1002486922 222
322 3300005341 Ga0070691_10000617 Ga0070691_100006177 222
323 3300005343 Ga0070687_100000053 Ga0070687_10000005327 222
324 3300005345 Ga0070692_10001036 Ga0070692_100010367 222
325 3300005406 Ga0070703_10003626 Ga0070703_100036265 222
326 3300005438 Ga0070701_10000715 Ga0070701_1000071512 222
327 3300005440 Ga0070705_100000253 Ga0070705_10000025334 222
328 3300005440 Ga0070705_100164552 Ga0070705_1001645522 222
329 3300005441 Ga0070700_100000447 Ga0070700_10000044719 222
330 3300005444 Ga0070694_100000058 Ga0070694_10000005819 222
331 3300005444 Ga0070694_100165713 Ga0070694_1001657132 222
332 3300005445 Ga0070708_100501472 Ga0070708_1005014722 222
333 3300005456 Ga0070678_100575308 Ga0070678_1005753082 222
334 3300005458 Ga0070681_10000135 Ga0070681_1000013545 222
335 3300005459 Ga0068867_100000138 Ga0068867_10000013821 222
336 3300005467 Ga0070706_100242767 Ga0070706_1002427673 222
337 3300005518 Ga0070699_100013835 Ga0070699_1000138354 222
338 3300005530 Ga0070679_100025518 Ga0070679_1000255184 222
339 3300005535 Ga0070684_100026833 Ga0070684_1000268335 222
340 3300005536 Ga0070697_100341191 Ga0070697_1003411911 222
341 3300005544 Ga0070686_100000132 Ga0070686_10000013217 222
342 3300005544 Ga0070686_100589449 Ga0070686_1005894492 222
343 3300005545 Ga0070695_100000434 Ga0070695_10000043411 222
344 3300005546 Ga0070696_100000008 Ga0070696_10000000848 222
345 3300005546 Ga0070696_100002386 Ga0070696_1000023868 222
346 3300005547 Ga0070693_100000008 Ga0070693_10000000829 222
347 3300005547 Ga0070693_100097225 Ga0070693_1000972252 222
348 3300005549 Ga0070704_100000044 Ga0070704_10000004418 222
349 3300005549 Ga0070704_100236185 Ga0070704_1002361851 222
350 3300005563 Ga0068855_100000880 Ga0068855_10000088018 222
351 3300005578 Ga0068854_100002322 Ga0068854_10000232216 222
352 3300005615 Ga0070702_100002197 Ga0070702_10000219710 222
353 3300005616 Ga0068852_100098085 Ga0068852_1000980852 222
354 3300005617 Ga0068859_100000906 Ga0068859_10000090620 222
355 3300005718 Ga0068866_10000862 Ga0068866_1000086215 222
356 3300005719 Ga0068861_100000076 Ga0068861_10000007652 222
357 3300005840 Ga0068870_10018761 Ga0068870_100187614 222
358 3300005841 Ga0068863_100106964 Ga0068863_1001069644 222
359 3300005842 Ga0068858_100001268 Ga0068858_1000012687 222
360 3300005843 Ga0068860_100000634 Ga0068860_10000063432 222
361 3300005844 Ga0068862_100000663 Ga0068862_1000006639 222
362 3300006163 Ga0070715_10402286 Ga0070715_104022861 222
363 3300006237 Ga0097621_100001432 Ga0097621_10000143210 222
364 3300006237 Ga0097621_100016784 Ga0097621_1000167844 222
365 3300006358 Ga0068871_100001528 Ga0068871_10000152812 222
366 3300006358 Ga0068871_100006526 Ga0068871_1000065266 222
367 3300006852 Ga0075433_10039738 Ga0075433_100397385 222
368 3300006871 Ga0075434_100470790 Ga0075434_1004707902 222
369 3300006881 Ga0068865_100000276 Ga0068865_10000027620 222
370 3300006914 Ga0075436_100002239 Ga0075436_10000223917 222
371 3300006914 Ga0075436_100015277 Ga0075436_1000152772 222
372 3300006914 Ga0075436_100058920 Ga0075436_1000589204 222
373 3300006931 Ga0097620_100000906 Ga0097620_10000090620 222
374 3300007076 Ga0075435_100143668 Ga0075435_1001436682 222
375 3300009092 Ga0105250_10082560 Ga0105250_100825602 222
376 3300009098 Ga0105245_10000221 Ga0105245_1000022119 222
377 3300009147 Ga0114129_10564282 Ga0114129_105642822 222
378 3300009148 Ga0105243_10000288 Ga0105243_1000028819 222
379 3300009174 Ga0105241_10060671 Ga0105241_100606714 222
380 3300009176 Ga0105242_10007197 Ga0105242_100071972 222
381 3300009177 Ga0105248_10244634 Ga0105248_102446343 222
382 3300009177 Ga0105248_10421584 Ga0105248_104215842 222
383 3300009553 Ga0105249_10005927 Ga0105249_100059272 222
384 3300010375 Ga0105239_10769174 Ga0105239_107691742 222
385 3300013297 Ga0157378_10003188 Ga0157378_1000318818 222
386 3300013308 Ga0157375_10964113 Ga0157375_109641131 222
387 3300014326 Ga0157380_10365277 Ga0157380_103652772 222
388 3300014968 Ga0157379_10145324 Ga0157379_101453242 222
389 3300014969 Ga0157376_10001746 Ga0157376_100017469 222
390 3300014969 Ga0157376_10114409 Ga0157376_101144092 222
391 3300025711 Ga0207696_1059279 Ga0207696_10592792 222
392 3300025885 Ga0207653_10003920 Ga0207653_100039204 222
393 3300025899 Ga0207642_10000648 Ga0207642_1000064812 222
394 3300025901 Ga0207688_10017562 Ga0207688_100175624 222
395 3300025905 Ga0207685_10193850 Ga0207685_101938501 222
396 3300025907 Ga0207645_10110269 Ga0207645_101102692 222
397 3300025908 Ga0207643_10016408 Ga0207643_100164083 222
398 3300025911 Ga0207654_10131135 Ga0207654_101311353 222
399 3300025912 Ga0207707_10003043 Ga0207707_1000304311 222
400 3300025917 Ga0207660_10000702 Ga0207660_1000070211 222
401 3300025917 Ga0207660_10115536 Ga0207660_101155363 222
402 3300025918 Ga0207662_10000147 Ga0207662_1000014736 222
403 3300025918 Ga0207662_10062976 Ga0207662_100629763 222
404 3300025918 Ga0207662_10264946 Ga0207662_102649462 222
405 3300025921 Ga0207652_10027643 Ga0207652_100276434 222
406 3300025927 Ga0207687_10000574 Ga0207687_1000057411 222
407 3300025927 Ga0207687_10215319 Ga0207687_102153192 222
408 3300025928 Ga0207700_10183492 Ga0207700_101834923 222
409 3300025929 Ga0207664_10035361 Ga0207664_100353612 222
410 3300025934 Ga0207686_10002658 Ga0207686_100026589 222
411 3300025935 Ga0207709_10000618 Ga0207709_1000061822 222
412 3300025936 Ga0207670_10000680 Ga0207670_1000068025 222
413 3300025936 Ga0207670_10168324 Ga0207670_101683242 222
414 3300025938 Ga0207704_10001535 Ga0207704_100015359 222
415 3300025939 Ga0207665_10229649 Ga0207665_102296491 222
416 3300025941 Ga0207711_10168739 Ga0207711_101687392 222
417 3300025942 Ga0207689_10000406 Ga0207689_1000040651 222
418 3300025944 Ga0207661_10418082 Ga0207661_104180822 222
419 3300025949 Ga0207667_10005238 Ga0207667_1000523810 222
420 3300025960 Ga0207651_10673661 Ga0207651_106736612 222
421 3300025981 Ga0207640_10036995 Ga0207640_100369955 222
422 3300026023 Ga0207677_10002410 Ga0207677_1000241011 222
423 3300026035 Ga0207703_10003447 Ga0207703_100034475 222
424 3300026041 Ga0207639_10038320 Ga0207639_100383204 222
425 3300026075 Ga0207708_10043534 Ga0207708_100435345 222
426 3300026075 Ga0207708_10423052 Ga0207708_104230522 222
427 3300026078 Ga0207702_10048213 Ga0207702_100482134 222
428 3300026088 Ga0207641_10064841 Ga0207641_100648412 222
429 3300026089 Ga0207648_10001117 Ga0207648_1000111718 222
430 3300026118 Ga0207675_100000880 Ga0207675_10000088020 222
431 3300026142 Ga0207698_10060202 Ga0207698_100602022 222
432 3300027395 Ga0209996_1011707 Ga0209996_10117072 222
433 3300028380 Ga0268265_10000457 Ga0268265_1000045740 222
434 3300028381 Ga0268264_10001149 Ga0268264_1000114917 222
435 3300035117 Ga0373953_0168563 Ga0373953_0168563_61_729 222
436 3300035691 Ga0373931_0021575 Ga0373931_0021575_2305_2973 222
437 3300035691 Ga0373931_0414886 Ga0373931_0414886_96_764 222
438 3300035724 Ga0373933_0145379 Ga0373933_0145379_461_1129 222
439 3300036401 Ga0373937_0264821 Ga0373937_0264821_805_1473 222
440 3300044901 Ga0466960_0124005 Ga0466960_0124005_440_1108 222
441 3300044901 Ga0466960_0155179 Ga0466960_0155179_521_1189 222
442 3300046454 Ga0495592_0201037 Ga0495592_0201037_353_1021 222
443 3300046462 Ga0495651_0048060 Ga0495651_0048060_1559_2227 222
444 3300046528 Ga0495642_0031504 Ga0495642_0031504_129_797 222
445 3300046684 Ga0495669_0018647 Ga0495669_0018647_889_1557 222
446 3300048917 Ga0496114_0253794 Ga0496114_0253794_642_1310 222
447 3300049583 Ga0501067_0048159 Ga0501067_0048159_641_1309 222
448 3300050507 nmdc:mga05p37_348392_c1 nmdc:mga05p37_348392_c1_522_1190 222
449 3300050512 nmdc:mga0n895_134158_c1 nmdc:mga0n895_134158_c1_295_963 222
450 3300050513 nmdc:mga0rr50_685455_c1 nmdc:mga0rr50_685455_c1_53_721 222
451 3300050513 nmdc:mga0rr50_685487_c1 nmdc:mga0rr50_685487_c1_155_823 222
452 3300050514 nmdc:mga08x19_23769_c1 nmdc:mga08x19_23769_c1_657_1325 222
453 3300050514 nmdc:mga08x19_2600_c1 nmdc:mga08x19_2600_c1_9611_10279 222
454 3300050515 nmdc:mga0a205_120739_c1 nmdc:mga0a205_120739_c1_817_1485 222
455 3300050515 nmdc:mga0a205_332924_c1 nmdc:mga0a205_332924_c1_586_1254 222

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

13

183

0.83

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

11

177

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ef7-assembly1.cif.gz_A crystal structure of xanthosine monophosphate phosphatase complex with xmp 0.8653 11 212
7ef6-assembly1.cif.gz_A crystal structure of xanthosine monophosphate phosphatase in the unliganded state 0.8533 11 212
3onn-assembly1.cif.gz_A crystal structure of 5'-nucleotidase sdt1 from saccharomyces cerevisiae 0.8374 7 216
3opx-assembly1.cif.gz_A crystal structure of pyrimidine 5 -nucleotidase sdt1 from saccharomyces cerevisiae complexed with uridine 5'-monophosphate 0.8361 5 216
3nuq-assembly1.cif.gz_A structure of a putative nucleotide phosphatase from saccharomyces cerevisiae 0.7986 6 216
ID Description Score Start End Superfamily
af_Q9SKY5_89_234_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9425 98 212 3.40.50.1000
af_B6TML6_112_257_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9328 110 214 3.40.50.1000
af_Q54B74_103_232_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9283 99 215 3.40.50.1000
af_A0A1D6LAC3_96_249_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9219 99 211 3.40.50.1000
1qo0E02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9215 31 64 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A259D2E8-F1-model_v4 deleted 0.9911 109 214
AF-A0A645H583-F1-model_v4 Phosphoglycolate phosphatase (EC 3.1.3.18) 0.9848 97 214 GO:0008967
AF-E6QNE7-F1-model_v4 HAD-superfamily hydrolase subfamily IA, variant 3:Pyrimidine 5-nucleotidase 0.9779 109 218 GO:0006281
GO:0008967
AF-A0A3D3JB81-F1-model_v4 deleted 0.9443 98 217
AF-E6QNE7-F1-model_v4 HAD-superfamily hydrolase subfamily IA, variant 3:Pyrimidine 5-nucleotidase 0.9359 109 218 GO:0006281
GO:0008967

Feature Viewer

pLDDT pTM Quality
85.31 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map