F447705

General Info

Members Datasets Scaffolds Average Seq Length
456 246 912 166

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10036975|rootH1_100369752
Length 179
Sequence MELESWNLKHLKMAEVSNSKLLQIDAGILNTNACVVIVRTEWNAAIIDELEKGCLRIFAQEGVKNVKVITVPGAFEIPFGIKSYWDANKYKDDRPHAFIALGCVLRGDTPHFDYVCQGVTHGVTQLNLTLPVPVIFGVLTVDNDQQAQERIGGKHGHKGEEAAITALKMISLTHSFKHQ

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
124 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
125 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
131 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
132 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
133 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
136 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
137 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
138 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
139 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
140 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
141 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
142 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
143 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
144 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
145 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
146 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
147 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
148 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
149 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
150 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
151 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
152 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
153 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
154 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
155 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
156 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
157 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
158 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
164 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
171 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
172 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
180 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
181 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
182 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
183 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
184 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
185 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
186 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
187 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
188 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
194 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
195 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
196 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
197 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
198 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
199 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
200 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
201 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
202 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
203 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
204 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
205 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
206 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
207 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
208 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
209 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
210 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
211 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
212 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
213 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
214 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
215 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
216 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
219 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
220 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
221 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
224 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
225 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
228 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
229 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
230 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
231 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
232 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
233 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
234 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
235 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
236 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
237 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
238 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
239 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
240 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
241 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
242 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
243 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
244 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
245 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
246 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0
Isolates 0.22

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.7
Nodule 0
Rhizoplane 1.54
Rhizosphere 86.18
Stem 0
Stem Tuber 0
Unclassified 16.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10036975 3300003323 Bacteria 1981
2 rootH2_10036968 3300003320 Bacteria 2218
3 rootH2_10054391 3300003320 Bacteria 21114
4 rootH2_10156759 3300003320 Bacteria 1734
5 rootL2_10090031 3300003322 Bacteria 2990
6 rootL2_10182034 3300003322 Unclassified 1460
7 rootL2_10232757 3300003322 Bacteria 2548
8 rootL2_10243903 3300003322 Unclassified 1422
9 rootL2_10373757 3300003322 Unclassified 1277
10 rootH1_10005214 3300003323 Bacteria 46503
11 rootH1_10153273 3300003323 Unclassified 1020
12 rootH1_10359476 3300003323 Unclassified 1165
13 Ga0065714_10071215 3300005288 Bacteria 3635
14 Ga0065712_10015463 3300005290 Unclassified 1501
15 Ga0065712_10031236 3300005290 Unclassified 1338
16 Ga0065707_10254426 3300005295 Unclassified 1115
17 Ga0070683_100008322 3300005329 Bacteria 8811
18 Ga0070670_100087214 3300005331 Bacteria 2682
19 Ga0070670_100111545 3300005331 Unclassified 2357
20 Ga0070670_100112123 3300005331 Unclassified 2350
21 Ga0070670_100303337 3300005331 Bacteria 1397
22 Ga0070670_100535702 3300005331 Unclassified 1044
23 Ga0070670_100650900 3300005331 Unclassified 945
24 Ga0070670_100718539 3300005331 Bacteria 899
25 Ga0068869_100012684 3300005334 Bacteria 5574
26 Ga0068869_100069203 3300005334 Bacteria 2609
27 Ga0068869_100920891 3300005334 Unclassified 757
28 Ga0068869_100972185 3300005334 Bacteria 738
29 Ga0070666_10120229 3300005335 Bacteria 1821
30 Ga0070666_10701029 3300005335 Bacteria 742
31 Ga0068868_102053913 3300005338 Unclassified 543
32 Ga0070689_100638390 3300005340 Bacteria 925
33 Ga0070687_100183115 3300005343 Bacteria 1256
34 Ga0070661_100646326 3300005344 Bacteria 858
35 Ga0070668_100028760 3300005347 Bacteria 4217
36 Ga0070669_100024483 3300005353 Bacteria 4327
37 Ga0070675_100143540 3300005354 Bacteria 2042
38 Ga0070675_100185717 3300005354 Bacteria 1799
39 Ga0070675_100309614 3300005354 Bacteria 1393
40 Ga0070675_100706405 3300005354 Unclassified 918
41 Ga0070675_100780017 3300005354 Bacteria 873
42 Ga0070671_100135726 3300005355 Bacteria 2074
43 Ga0070674_100092051 3300005356 Bacteria 2191
44 Ga0070673_100451776 3300005364 Unclassified 1156
45 Ga0070688_100081698 3300005365 Bacteria 2093
46 Ga0070659_100451726 3300005366 Bacteria 1090
47 Ga0070667_100238455 3300005367 Bacteria 1623
48 Ga0070667_101001267 3300005367 Bacteria 780
49 Ga0070667_101233803 3300005367 Bacteria 700
50 Ga0070662_100537733 3300005457 Unclassified 978
51 Ga0070662_100745248 3300005457 Unclassified 830
52 Ga0070681_10200420 3300005458 Bacteria 1914
53 Ga0068867_100070414 3300005459 Bacteria 2615
54 Ga0068867_100104679 3300005459 Bacteria 2166
55 Ga0068867_100687380 3300005459 Unclassified 902
56 Ga0068867_100697984 3300005459 Unclassified 895
57 Ga0068867_100962529 3300005459 Bacteria 772
58 Ga0068867_101153253 3300005459 Bacteria 710
59 Ga0070706_100213445 3300005467 Bacteria 1802
60 Ga0070706_100383439 3300005467 Bacteria 1309
61 Ga0070698_100004775 3300005471 Bacteria 14871
62 Ga0070698_100020223 3300005471 Bacteria 6979
63 Ga0070698_100080254 3300005471 Bacteria 3257
64 Ga0070684_100049917 3300005535 Bacteria 3633
65 Ga0068853_100005327 3300005539 Bacteria 10070
66 Ga0068853_100007730 3300005539 Bacteria 8622
67 Ga0068853_100655600 3300005539 Bacteria 999
68 Ga0070672_101402461 3300005543 Bacteria 625
69 Ga0070672_101671028 3300005543 Unclassified 572
70 Ga0070696_100697243 3300005546 Bacteria 827
71 Ga0070665_100000031 3300005548 Bacteria 333365
72 Ga0068855_100000108 3300005563 Bacteria 103059
73 Ga0068855_100011960 3300005563 Bacteria 10492
74 Ga0068855_100098757 3300005563 Bacteria 3363
75 Ga0070664_101293607 3300005564 Bacteria 689
76 Ga0068857_100009142 3300005577 Bacteria 8599
77 Ga0068857_100057880 3300005577 Bacteria 3441
78 Ga0068857_100238382 3300005577 Bacteria 1665
79 Ga0068857_100888310 3300005577 Bacteria 854
80 Ga0068854_100008838 3300005578 Bacteria 6483
81 Ga0068854_101067319 3300005578 Unclassified 718
82 Ga0068856_100120024 3300005614 Bacteria 2631
83 Ga0068852_100001099 3300005616 Bacteria 17846
84 Ga0068852_100089437 3300005616 Bacteria 2752
85 Ga0068852_100179098 3300005616 Bacteria 1992
86 Ga0068859_100312763 3300005617 Bacteria 1664
87 Ga0068859_101085537 3300005617 Bacteria 880
88 Ga0068859_101279567 3300005617 Bacteria 808
89 Ga0068864_100108577 3300005618 Bacteria 2469
90 Ga0068866_10646187 3300005718 Bacteria 720
91 Ga0068851_10241886 3300005834 Bacteria 1021
92 Ga0068870_10090909 3300005840 Unclassified 1706
93 Ga0068863_100031995 3300005841 Bacteria 5017
94 Ga0068860_100001760 3300005843 Bacteria 23110
95 Ga0068860_100466739 3300005843 Bacteria 1257
96 Ga0068860_101040024 3300005843 Bacteria 837
97 Ga0068862_100383588 3300005844 Bacteria 1311
98 Ga0081540_1016972 3300005983 Bacteria 4527
99 Ga0070715_10250278 3300006163 Unclassified 926
100 Ga0070716_100130985 3300006173 Bacteria 1585
101 Ga0075366_10049627 3300006195 Bacteria 2490
102 Ga0075366_10155305 3300006195 Bacteria 1386
103 Ga0075366_10199363 3300006195 Bacteria 1217
104 Ga0075366_10294111 3300006195 Bacteria 993
105 Ga0075366_10452045 3300006195 Bacteria 793
106 Ga0097621_100023930 3300006237 Bacteria 4761
107 Ga0097621_100087725 3300006237 Bacteria 2598
108 Ga0097621_100265068 3300006237 Bacteria 1508
109 Ga0097621_100386207 3300006237 Unclassified 1251
110 Ga0068871_100010651 3300006358 Bacteria 6721
111 Ga0068871_100029511 3300006358 Bacteria 4309
112 Ga0068871_100584582 3300006358 Bacteria 1014
113 Ga0068871_100931492 3300006358 Bacteria 806
114 Ga0075428_100006899 3300006844 Bacteria 12614
115 Ga0075431_100213393 3300006847 Bacteria 1971
116 Ga0075429_101156915 3300006880 Bacteria 675
117 Ga0068865_100205292 3300006881 Bacteria 1532
118 Ga0075436_100663179 3300006914 Unclassified 771
119 Ga0097620_100312770 3300006931 Bacteria 1664
120 Ga0097620_101085726 3300006931 Bacteria 880
121 Ga0097620_101279508 3300006931 Bacteria 808
122 Ga0105240_10000152 3300009093 Bacteria 141054
123 Ga0105240_10000991 3300009093 Bacteria 50697
124 Ga0105240_10001109 3300009093 Bacteria 47404
125 Ga0105240_10002195 3300009093 Bacteria 31863
126 Ga0105240_10027645 3300009093 Bacteria 7424
127 Ga0105240_10032566 3300009093 Bacteria 6749
128 Ga0105240_10047770 3300009093 Bacteria 5414
129 Ga0105240_10098474 3300009093 Bacteria 3561
130 Ga0105240_10350008 3300009093 Unclassified 1676
131 Ga0105240_10382307 3300009093 Unclassified 1590
132 Ga0105240_11549829 3300009093 Bacteria 694
133 Ga0111539_10650517 3300009094 Bacteria 1227
134 Ga0111539_10964975 3300009094 Bacteria 991
135 Ga0114129_10020859 3300009147 Bacteria 9309
136 Ga0105243_10801305 3300009148 Unclassified 928
137 Ga0105241_10000813 3300009174 Bacteria 23714
138 Ga0105241_10040241 3300009174 Bacteria 3528
139 Ga0105241_10140646 3300009174 Bacteria 1965
140 Ga0105241_11216542 3300009174 Bacteria 714
141 Ga0105242_10031440 3300009176 Bacteria 4239
142 Ga0105242_10206266 3300009176 Bacteria 1748
143 Ga0105242_10227989 3300009176 Bacteria 1668
144 Ga0105242_10291974 3300009176 Bacteria 1485
145 Ga0105237_10001480 3300009545 Bacteria 30945
146 Ga0105237_10003916 3300009545 Bacteria 17440
147 Ga0105237_10004983 3300009545 Bacteria 15140
148 Ga0105237_10008202 3300009545 Bacteria 11345
149 Ga0105237_10067676 3300009545 Bacteria 3565
150 Ga0105237_10106705 3300009545 Bacteria 2793
151 Ga0105237_10794544 3300009545 Bacteria 953
152 Ga0105238_10003001 3300009551 Bacteria 16856
153 Ga0105238_10041526 3300009551 Bacteria 4658
154 Ga0105238_11120996 3300009551 Bacteria 810
155 Ga0105238_12168701 3300009551 Unclassified 590
156 Ga0105249_10143296 3300009553 Bacteria 2293
157 Ga0105249_10145745 3300009553 Bacteria 2275
158 Ga0105249_11115917 3300009553 Bacteria 859
159 Ga0105239_10000168 3300010375 Bacteria 94279
160 Ga0105239_10000596 3300010375 Bacteria 51547
161 Ga0105239_10001322 3300010375 Bacteria 33365
162 Ga0105239_10003797 3300010375 Bacteria 18389
163 Ga0105239_10014706 3300010375 Bacteria 8679
164 Ga0105239_10052987 3300010375 Bacteria 4450
165 Ga0105239_10233462 3300010375 Bacteria 2064
166 Ga0105239_10882865 3300010375 Bacteria 1026
167 Ga0105246_10679782 3300011119 Bacteria 899
168 Ga0105246_10998553 3300011119 Unclassified 758
169 Ga0157373_10039687 3300013100 Bacteria 3370
170 Ga0157373_10291014 3300013100 Bacteria 1158
171 Ga0157371_10205763 3300013102 Bacteria 1412
172 Ga0157370_10020017 3300013104 Bacteria 6694
173 Ga0157369_10025968 3300013105 Bacteria 6500
174 Ga0157374_10000002 3300013296 Bacteria 1054226
175 Ga0157374_10026510 3300013296 Bacteria 5215
176 Ga0157374_10118567 3300013296 Unclassified 2552
177 Ga0157374_10308260 3300013296 Bacteria 1567
178 Ga0157374_10405699 3300013296 Bacteria 1360
179 Ga0157378_10105100 3300013297 Bacteria 2581
180 Ga0157378_10155726 3300013297 Bacteria 2133
181 Ga0157378_10293292 3300013297 Bacteria 1572
182 Ga0157378_10553213 3300013297 Unclassified 1156
183 Ga0157378_11072106 3300013297 Bacteria 842
184 Ga0163162_10017051 3300013306 Bacteria 7107
185 Ga0163162_10030731 3300013306 Bacteria 5323
186 Ga0163162_10493529 3300013306 Bacteria 1355
187 Ga0157372_10001946 3300013307 Bacteria 22414
188 Ga0157372_10029448 3300013307 Bacteria 5995
189 Ga0157372_10045722 3300013307 Bacteria 4858
190 Ga0157372_10464167 3300013307 Bacteria 1476
191 Ga0157372_11365610 3300013307 Unclassified 817
192 Ga0157372_11959208 3300013307 Bacteria 673
193 Ga0157372_12366412 3300013307 Unclassified 610
194 Ga0157375_10486745 3300013308 Unclassified 1398
195 Ga0157375_10585952 3300013308 Unclassified 1275
196 Ga0157380_10227844 3300014326 Unclassified 1672
197 Ga0157380_10661899 3300014326 Bacteria 1043
198 Ga0157380_10862244 3300014326 Bacteria 928
199 Ga0157380_11299738 3300014326 Bacteria 775
200 Ga0157377_10967489 3300014745 Bacteria 642
201 Ga0157377_11396423 3300014745 Unclassified 552
202 Ga0157379_10216622 3300014968 Unclassified 1734
203 Ga0157376_10005066 3300014969 Bacteria 9191
204 Ga0157376_10016736 3300014969 Bacteria 5576
205 Ga0157376_10074751 3300014969 Bacteria 2889
206 Ga0157376_10220680 3300014969 Bacteria 1755
207 Ga0157376_10781608 3300014969 Bacteria 966
208 Ga0163161_10647848 3300017792 Bacteria 875
209 Ga0209646_1014056 3300025246 Bacteria 1208
210 Ga0207688_10879807 3300025901 Unclassified 567
211 Ga0207680_10104856 3300025903 Bacteria 1823
212 Ga0207680_10450053 3300025903 Bacteria 914
213 Ga0207647_10007349 3300025904 Bacteria 7968
214 Ga0207647_10060816 3300025904 Bacteria 2308
215 Ga0207647_10061637 3300025904 Bacteria 2288
216 Ga0207654_10003071 3300025911 Bacteria 8456
217 Ga0207707_10068254 3300025912 Bacteria 3098
218 Ga0207695_10000060 3300025913 Bacteria 360217
219 Ga0207695_10000185 3300025913 Bacteria 180225
220 Ga0207695_10000666 3300025913 Bacteria 67698
221 Ga0207695_10002019 3300025913 Bacteria 31240
222 Ga0207695_10062024 3300025913 Bacteria 3862
223 Ga0207695_10131928 3300025913 Bacteria 2455
224 Ga0207695_10218111 3300025913 Bacteria 1816
225 Ga0207695_10358583 3300025913 Bacteria 1345
226 Ga0207671_10001265 3300025914 Bacteria 29785
227 Ga0207671_10001378 3300025914 Bacteria 28270
228 Ga0207671_10010285 3300025914 Bacteria 7731
229 Ga0207671_10013045 3300025914 Bacteria 6645
230 Ga0207671_10127409 3300025914 Bacteria 1951
231 Ga0207671_10404223 3300025914 Bacteria 1086
232 Ga0207662_10599431 3300025918 Unclassified 766
233 Ga0207681_11537427 3300025923 Bacteria 558
234 Ga0207694_10018611 3300025924 Bacteria 5251
235 Ga0207694_10278869 3300025924 Unclassified 1372
236 Ga0207650_10007216 3300025925 Bacteria 7575
237 Ga0207650_10253924 3300025925 Bacteria 1424
238 Ga0207650_10494907 3300025925 Unclassified 1021
239 Ga0207650_10605524 3300025925 Bacteria 922
240 Ga0207690_10556917 3300025932 Bacteria 932
241 Ga0207686_10246382 3300025934 Unclassified 1303
242 Ga0207689_10028091 3300025942 Bacteria 4705
243 Ga0207661_10003629 3300025944 Bacteria 10748
244 Ga0207667_10000084 3300025949 Bacteria 152086
245 Ga0207667_10004030 3300025949 Bacteria 18046
246 Ga0207667_10014573 3300025949 Bacteria 8955
247 Ga0207667_10140792 3300025949 Unclassified 2484
248 Ga0207712_10041919 3300025961 Bacteria 3149
249 Ga0207712_10207207 3300025961 Bacteria 1559
250 Ga0207668_10059263 3300025972 Unclassified 2681
251 Ga0207668_10171994 3300025972 Bacteria 1700
252 Ga0207640_10032994 3300025981 Bacteria 3216
253 Ga0207640_10074249 3300025981 Bacteria 2301
254 Ga0207703_10705280 3300026035 Bacteria 960
255 Ga0207639_10001323 3300026041 Bacteria 16766
256 Ga0207639_10019987 3300026041 Bacteria 4787
257 Ga0207708_10490817 3300026075 Bacteria 1028
258 Ga0207702_10088280 3300026078 Bacteria 2708
259 Ga0207641_10455196 3300026088 Bacteria 1237
260 Ga0207648_10037999 3300026089 Bacteria 4237
261 Ga0207648_10060445 3300026089 Unclassified 3305
262 Ga0207648_10172070 3300026089 Bacteria 1915
263 Ga0207648_10480987 3300026089 Bacteria 1134
264 Ga0207648_10688467 3300026089 Unclassified 947
265 Ga0207676_10133984 3300026095 Bacteria 2111
266 Ga0207676_10635224 3300026095 Bacteria 1029
267 Ga0207676_11343790 3300026095 Bacteria 710
268 Ga0207674_10000487 3300026116 Bacteria 52391
269 Ga0207674_10066882 3300026116 Bacteria 3619
270 Ga0207675_100064193 3300026118 Bacteria 3432
271 Ga0207683_10487157 3300026121 Unclassified 1138
272 Ga0207698_10008203 3300026142 Bacteria 6589
273 Ga0207698_10051550 3300026142 Bacteria 3147
274 Ga0207698_10055138 3300026142 Bacteria 3061
275 Ga0207698_10168065 3300026142 Unclassified 1928
276 Ga0268265_10310395 3300028380 Unclassified 1424
277 Ga0268265_10826124 3300028380 Bacteria 905
278 Ga0268264_10008441 3300028381 Bacteria 8566
279 Ga0268264_10038110 3300028381 Bacteria 3966
280 Ga0268264_10231430 3300028381 Bacteria 1707
281 Ga0268264_10390844 3300028381 Bacteria 1334
282 Ga0307517_10000959 3300028786 Bacteria 48920
283 Ga0307515_10000001 3300028794 Bacteria 4259510
284 Ga0307511_10000498 3300030521 Bacteria 42446
285 Ga0265340_10147697 3300031247 Bacteria 1073
286 Ga0307513_10174168 3300031456 Bacteria 2025
287 Ga0307513_10449620 3300031456 Bacteria 1013
288 Ga0307509_10010139 3300031507 Bacteria 11601
289 Ga0307509_10030460 3300031507 Bacteria 5968
290 Ga0265313_10090782 3300031595 Unclassified 1372
291 Ga0307508_10003711 3300031616 Bacteria 15293
292 Ga0307508_10266842 3300031616 Unclassified 1306
293 Ga0307405_10229731 3300031731 Bacteria 1367
294 Ga0307413_11195412 3300031824 Bacteria 661
295 Ga0307407_10036315 3300031903 Bacteria 2715
296 Ga0307407_10487731 3300031903 Bacteria 901
297 Ga0307416_100642167 3300032002 Bacteria 1145
298 Ga0307416_101192901 3300032002 Bacteria 867
299 Ga0307414_10187092 3300032004 Bacteria 1672
300 Ga0307414_10270439 3300032004 Unclassified 1423
301 Ga0307414_10829093 3300032004 Bacteria 845
302 Ga0307411_10458019 3300032005 Bacteria 1069
303 Ga0307415_100075021 3300032126 Bacteria 2392
304 Ga0307510_10000074 3300033180 Bacteria 75194
305 Ga0373937_0196376 3300036401 Unclassified 1897
306 Ga0373937_0347236 3300036401 Bacteria 1405
307 Ga0373937_0582758 3300036401 Bacteria 1062
308 Ga0395905_0010691 3300037471 Bacteria 8901
309 Ga0395905_0170550 3300037471 Bacteria 2044
310 Ga0439436_0020942 3300041404 Bacteria 1946
311 Ga0439439_0176761 3300041406 Bacteria 614
312 Ga0439439_0210194 3300041406 Bacteria 568
313 Ga0439453_0028565 3300041408 Bacteria 1045
314 Ga0439465_0007808 3300041413 Bacteria 3391
315 Ga0451791_0125496 3300041451 Bacteria 665
316 Ga0451802_1242863 3300041460 Bacteria 930
317 Ga0451807_0898765 3300041486 Bacteria 819
318 Ga0451807_2589385 3300041486 Bacteria 573
319 Ga0451833_1396747 3300041491 Bacteria 1208
320 Ga0451835_0047063 3300041492 Bacteria 1479
321 Ga0451839_1114815 3300041496 Unclassified 573
322 Ga0451841_0225345 3300041498 Bacteria 870
323 Ga0451849_0473236 3300041505 Bacteria 787
324 Ga0451855_1067066 3300041511 Bacteria 609
325 Ga0439431_0192626 3300041997 Unclassified 592
326 Ga0439441_043643 3300042001 Unclassified 905
327 Ga0439445_0062821 3300042004 Bacteria 1018
328 Ga0439445_0082364 3300042004 Bacteria 900
329 Ga0439449_0025680 3300042007 Bacteria 2201
330 Ga0439449_0026869 3300042007 Unclassified 2148
331 Ga0439449_0039185 3300042007 Bacteria 1762
332 Ga0439449_0184155 3300042007 Bacteria 781
333 Ga0439457_008376 3300042014 Bacteria 2441
334 Ga0439457_144385 3300042014 Bacteria 570
335 Ga0439462_0007240 3300042015 Bacteria 2774
336 Ga0450898_034786 3300042134 Unclassified 936
337 Ga0450906_013822 3300042145 Bacteria 1484
338 Ga0439434_0194979 3300042435 Bacteria 682
339 Ga0466969_0000033 3300044656 Bacteria 82227
340 Ga0466972_0000396 3300044658 Bacteria 23138
341 Ga0466972_0003676 3300044658 Bacteria 7628
342 Ga0466965_0059846 3300044683 Bacteria 1902
343 Ga0466966_0000693 3300044684 Bacteria 21422
344 Ga0466961_0031329 3300044693 Bacteria 3418
345 Ga0466964_0385634 3300044706 Bacteria 728
346 Ga0453684_0150494 3300044712 Bacteria 2766
347 Ga0466971_0588225 3300044719 Bacteria 554
348 Ga0466968_0046618 3300044735 Bacteria 1841
349 Ga0466957_0004183 3300044842 Bacteria 7996
350 Ga0466957_0123688 3300044842 Bacteria 1651
351 Ga0466957_0672271 3300044842 Bacteria 729
352 Ga0466960_0032432 3300044901 Bacteria 2419
353 Ga0466959_0000048 3300045049 Bacteria 83528
354 Ga0466959_0015931 3300045049 Bacteria 5484
355 Ga0466958_0048237 3300045836 Bacteria 2573
356 Ga0495638_0417038 3300046460 Unclassified 693
357 Ga0495638_0572741 3300046460 Unclassified 558
358 Ga0495650_0172950 3300046471 Bacteria 764
359 Ga0495594_0139287 3300046499 Bacteria 1376
360 Ga0495632_0196948 3300046519 Bacteria 919
361 Ga0495622_0054668 3300046557 Bacteria 1852
362 Ga0495611_0002116 3300046648 Bacteria 9308
363 Ga0495625_0088111 3300046660 Bacteria 2151
364 Ga0495649_0408461 3300046694 Unclassified 681
365 Ga0495600_0708922 3300046809 Bacteria 605
366 Ga0495672_0014487 3300047320 Bacteria 5398
367 Ga0495687_200504 3300047443 Bacteria 634
368 Ga0495686_0000102 3300047472 Bacteria 177525
369 Ga0495686_0016899 3300047472 Bacteria 4932
370 Ga0495686_0305895 3300047472 Bacteria 876
371 Ga0496114_0404055 3300048917 Unclassified 1210
372 Ga0496115_0898417 3300048918 Unclassified 683
373 Ga0496115_1050614 3300048918 Unclassified 620
374 Ga0501290_005917 3300049513 Bacteria 1525
375 Ga0501292_011453 3300049515 Bacteria 1342
376 Ga0501292_042819 3300049515 Bacteria 786
377 Ga0501298_002141 3300049521 Bacteria 2968
378 Ga0501299_005456 3300049522 Bacteria 1956
379 Ga0501033_0934611 3300049570 Bacteria 582
380 Ga0501043_0061113 3300049579 Bacteria 2959
381 Ga0501047_0017254 3300049581 Bacteria 6912
382 Ga0501047_0056859 3300049581 Bacteria 3784
383 Ga0501047_0767257 3300049581 Unclassified 780
384 Ga0501072_0156630 3300049588 Bacteria 1816
385 Ga0501198_001317 3300049649 Bacteria 3222
386 Ga0501202_000435 3300049652 Bacteria 5901
387 Ga0501202_070878 3300049652 Bacteria 803
388 Ga0501202_146640 3300049652 Bacteria 614
389 Ga0501206_003677 3300049653 Bacteria 1949
390 Ga0501207_017748 3300049654 Bacteria 1113
391 Ga0501216_021941 3300049660 Bacteria 1126
392 Ga0501217_000220 3300049661 Bacteria 8651
393 Ga0501223_000584 3300049663 Bacteria 8796
394 Ga0501223_060217 3300049663 Bacteria 741
395 Ga0501223_095402 3300049663 Bacteria 608
396 Ga0501224_012798 3300049664 Bacteria 1237
397 Ga0501233_000359 3300049668 Bacteria 7146
398 Ga0501235_005398 3300049669 Bacteria 2783
399 Ga0501240_000382 3300049673 Bacteria 3531
400 Ga0501242_004179 3300049674 Bacteria 1595
401 Ga0501243_001137 3300049675 Bacteria 3781
402 Ga0501247_048071 3300049677 Bacteria 626
403 Ga0501251_011174 3300049681 Unclassified 1066
404 Ga0501251_013035 3300049681 Bacteria 1014
405 Ga0501252_000124 3300049682 Bacteria 4528
406 Ga0501253_014329 3300049683 Bacteria 1281
407 Ga0501257_012147 3300049686 Bacteria 1969
408 Ga0501257_040905 3300049686 Bacteria 1138
409 Ga0501257_084203 3300049686 Bacteria 822
410 Ga0501260_001487 3300049689 Bacteria 1938
411 Ga0501219_000013 3300049703 Bacteria 28251
412 Ga0501221_001606 3300049704 Bacteria 3755
413 Ga0501225_0001084 3300049705 Bacteria 8547
414 Ga0501225_0019993 3300049705 Bacteria 1851
415 Ga0501225_0037521 3300049705 Bacteria 1336
416 Ga0501234_011285 3300049707 Unclassified 1396
417 Ga0501245_002660 3300049708 Bacteria 2395
418 Ga0501080_0147826 3300049742 Bacteria 2172
419 Ga0501241_065076 3300049758 Unclassified 737
420 Ga0501273_031417 3300049770 Bacteria 757
421 Ga0501281_07872 3300049777 Unclassified 744
422 Ga0501035_0069668 3300049822 Bacteria 3117
423 Ga0501035_0798266 3300049822 Bacteria 754
424 Ga0501044_0002053 3300049823 Bacteria 23236
425 Ga0501204_011632 3300049850 Bacteria 1047
426 Ga0501212_000592 3300049851 Bacteria 3612
427 Ga0501284_00078 3300050005 Bacteria 25912
428 nmdc:mga0k408_446896_c1 3300050493 Unclassified 768
429 nmdc:mga0k408_9357_c1 3300050493 Bacteria 5278
430 nmdc:mga05p37_7934_c1 3300050507 Bacteria 9309
431 nmdc:mga09592_17767_c1 3300050508 Bacteria 5829
432 nmdc:mga09592_206475_c1 3300050508 Bacteria 1702
433 nmdc:mga0qj67_395356_c1 3300050509 Bacteria 1116
434 nmdc:mga06r32_230983_c1 3300050510 Bacteria 1838
435 nmdc:mga08y16_290726_c1 3300050511 Bacteria 1685
436 Ga0500578_0000097 3300053086 Bacteria 100607
437 Ga0500578_0196602 3300053086 Bacteria 1236
438 Ga0500644_0070997 3300053088 Bacteria 1255
439 Ga0500646_0022471 3300053090 Bacteria 1687
440 Ga0500646_0058600 3300053090 Bacteria 1127
441 Ga0500583_0000031 3300053092 Bacteria 104319
442 Ga0500583_0000640 3300053092 Bacteria 10418
443 Ga0500583_0330370 3300053092 Bacteria 742
444 Ga0500651_0049277 3300053093 Bacteria 2646
445 Ga0500651_0261644 3300053093 Bacteria 1003
446 Ga0500651_0457330 3300053093 Bacteria 709
447 Ga0500554_167164 3300053102 Bacteria 742
448 Ga0500556_0132559 3300053104 Bacteria 977
449 Ga0500652_037024 3300053131 Bacteria 1945
450 Ga0500559_0065574 3300053136 Bacteria 1627
451 Ga0500588_0172580 3300053146 Bacteria 792
452 Ga0500622_0054752 3300053156 Bacteria 2045
453 Ga0500636_0009710 3300053177 Bacteria 5604
454 Ga0500611_131611 3300053727 Bacteria 674
455 Ga0466962_0134691 3300061719 Unclassified 1195
456 2738730469 2738541278 Bacteria 9755573
457 rootH1_10036975
458 rootH2_10036968
459 rootH2_10054391
460 rootH2_10156759
461 rootL2_10090031
462 rootL2_10182034
463 rootL2_10232757
464 rootL2_10243903
465 rootL2_10373757
466 rootH1_10005214
467 rootH1_10153273
468 rootH1_10359476
469 Ga0065714_10071215
470 Ga0065712_10015463
471 Ga0065712_10031236
472 Ga0065707_10254426
473 Ga0070683_100008322
474 Ga0070670_100087214
475 Ga0070670_100111545
476 Ga0070670_100112123
477 Ga0070670_100303337
478 Ga0070670_100535702
479 Ga0070670_100650900
480 Ga0070670_100718539
481 Ga0068869_100012684
482 Ga0068869_100069203
483 Ga0068869_100920891
484 Ga0068869_100972185
485 Ga0070666_10120229
486 Ga0070666_10701029
487 Ga0068868_102053913
488 Ga0070689_100638390
489 Ga0070687_100183115
490 Ga0070661_100646326
491 Ga0070668_100028760
492 Ga0070669_100024483
493 Ga0070675_100143540
494 Ga0070675_100185717
495 Ga0070675_100309614
496 Ga0070675_100706405
497 Ga0070675_100780017
498 Ga0070671_100135726
499 Ga0070674_100092051
500 Ga0070673_100451776
501 Ga0070688_100081698
502 Ga0070659_100451726
503 Ga0070667_100238455
504 Ga0070667_101001267
505 Ga0070667_101233803
506 Ga0070662_100537733
507 Ga0070662_100745248
508 Ga0070681_10200420
509 Ga0068867_100070414
510 Ga0068867_100104679
511 Ga0068867_100687380
512 Ga0068867_100697984
513 Ga0068867_100962529
514 Ga0068867_101153253
515 Ga0070706_100213445
516 Ga0070706_100383439
517 Ga0070698_100004775
518 Ga0070698_100020223
519 Ga0070698_100080254
520 Ga0070684_100049917
521 Ga0068853_100005327
522 Ga0068853_100007730
523 Ga0068853_100655600
524 Ga0070672_101402461
525 Ga0070672_101671028
526 Ga0070696_100697243
527 Ga0070665_100000031
528 Ga0068855_100000108
529 Ga0068855_100011960
530 Ga0068855_100098757
531 Ga0070664_101293607
532 Ga0068857_100009142
533 Ga0068857_100057880
534 Ga0068857_100238382
535 Ga0068857_100888310
536 Ga0068854_100008838
537 Ga0068854_101067319
538 Ga0068856_100120024
539 Ga0068852_100001099
540 Ga0068852_100089437
541 Ga0068852_100179098
542 Ga0068859_100312763
543 Ga0068859_101085537
544 Ga0068859_101279567
545 Ga0068864_100108577
546 Ga0068866_10646187
547 Ga0068851_10241886
548 Ga0068870_10090909
549 Ga0068863_100031995
550 Ga0068860_100001760
551 Ga0068860_100466739
552 Ga0068860_101040024
553 Ga0068862_100383588
554 Ga0081540_1016972
555 Ga0070715_10250278
556 Ga0070716_100130985
557 Ga0075366_10049627
558 Ga0075366_10155305
559 Ga0075366_10199363
560 Ga0075366_10294111
561 Ga0075366_10452045
562 Ga0097621_100023930
563 Ga0097621_100087725
564 Ga0097621_100265068
565 Ga0097621_100386207
566 Ga0068871_100010651
567 Ga0068871_100029511
568 Ga0068871_100584582
569 Ga0068871_100931492
570 Ga0075428_100006899
571 Ga0075431_100213393
572 Ga0075429_101156915
573 Ga0068865_100205292
574 Ga0075436_100663179
575 Ga0097620_100312770
576 Ga0097620_101085726
577 Ga0097620_101279508
578 Ga0105240_10000152
579 Ga0105240_10000991
580 Ga0105240_10001109
581 Ga0105240_10002195
582 Ga0105240_10027645
583 Ga0105240_10032566
584 Ga0105240_10047770
585 Ga0105240_10098474
586 Ga0105240_10350008
587 Ga0105240_10382307
588 Ga0105240_11549829
589 Ga0111539_10650517
590 Ga0111539_10964975
591 Ga0114129_10020859
592 Ga0105243_10801305
593 Ga0105241_10000813
594 Ga0105241_10040241
595 Ga0105241_10140646
596 Ga0105241_11216542
597 Ga0105242_10031440
598 Ga0105242_10206266
599 Ga0105242_10227989
600 Ga0105242_10291974
601 Ga0105237_10001480
602 Ga0105237_10003916
603 Ga0105237_10004983
604 Ga0105237_10008202
605 Ga0105237_10067676
606 Ga0105237_10106705
607 Ga0105237_10794544
608 Ga0105238_10003001
609 Ga0105238_10041526
610 Ga0105238_11120996
611 Ga0105238_12168701
612 Ga0105249_10143296
613 Ga0105249_10145745
614 Ga0105249_11115917
615 Ga0105239_10000168
616 Ga0105239_10000596
617 Ga0105239_10001322
618 Ga0105239_10003797
619 Ga0105239_10014706
620 Ga0105239_10052987
621 Ga0105239_10233462
622 Ga0105239_10882865
623 Ga0105246_10679782
624 Ga0105246_10998553
625 Ga0157373_10039687
626 Ga0157373_10291014
627 Ga0157371_10205763
628 Ga0157370_10020017
629 Ga0157369_10025968
630 Ga0157374_10000002
631 Ga0157374_10026510
632 Ga0157374_10118567
633 Ga0157374_10308260
634 Ga0157374_10405699
635 Ga0157378_10105100
636 Ga0157378_10155726
637 Ga0157378_10293292
638 Ga0157378_10553213
639 Ga0157378_11072106
640 Ga0163162_10017051
641 Ga0163162_10030731
642 Ga0163162_10493529
643 Ga0157372_10001946
644 Ga0157372_10029448
645 Ga0157372_10045722
646 Ga0157372_10464167
647 Ga0157372_11365610
648 Ga0157372_11959208
649 Ga0157372_12366412
650 Ga0157375_10486745
651 Ga0157375_10585952
652 Ga0157380_10227844
653 Ga0157380_10661899
654 Ga0157380_10862244
655 Ga0157380_11299738
656 Ga0157377_10967489
657 Ga0157377_11396423
658 Ga0157379_10216622
659 Ga0157376_10005066
660 Ga0157376_10016736
661 Ga0157376_10074751
662 Ga0157376_10220680
663 Ga0157376_10781608
664 Ga0163161_10647848
665 Ga0209646_1014056
666 Ga0207688_10879807
667 Ga0207680_10104856
668 Ga0207680_10450053
669 Ga0207647_10007349
670 Ga0207647_10060816
671 Ga0207647_10061637
672 Ga0207654_10003071
673 Ga0207707_10068254
674 Ga0207695_10000060
675 Ga0207695_10000185
676 Ga0207695_10000666
677 Ga0207695_10002019
678 Ga0207695_10062024
679 Ga0207695_10131928
680 Ga0207695_10218111
681 Ga0207695_10358583
682 Ga0207671_10001265
683 Ga0207671_10001378
684 Ga0207671_10010285
685 Ga0207671_10013045
686 Ga0207671_10127409
687 Ga0207671_10404223
688 Ga0207662_10599431
689 Ga0207681_11537427
690 Ga0207694_10018611
691 Ga0207694_10278869
692 Ga0207650_10007216
693 Ga0207650_10253924
694 Ga0207650_10494907
695 Ga0207650_10605524
696 Ga0207690_10556917
697 Ga0207686_10246382
698 Ga0207689_10028091
699 Ga0207661_10003629
700 Ga0207667_10000084
701 Ga0207667_10004030
702 Ga0207667_10014573
703 Ga0207667_10140792
704 Ga0207712_10041919
705 Ga0207712_10207207
706 Ga0207668_10059263
707 Ga0207668_10171994
708 Ga0207640_10032994
709 Ga0207640_10074249
710 Ga0207703_10705280
711 Ga0207639_10001323
712 Ga0207639_10019987
713 Ga0207708_10490817
714 Ga0207702_10088280
715 Ga0207641_10455196
716 Ga0207648_10037999
717 Ga0207648_10060445
718 Ga0207648_10172070
719 Ga0207648_10480987
720 Ga0207648_10688467
721 Ga0207676_10133984
722 Ga0207676_10635224
723 Ga0207676_11343790
724 Ga0207674_10000487
725 Ga0207674_10066882
726 Ga0207675_100064193
727 Ga0207683_10487157
728 Ga0207698_10008203
729 Ga0207698_10051550
730 Ga0207698_10055138
731 Ga0207698_10168065
732 Ga0268265_10310395
733 Ga0268265_10826124
734 Ga0268264_10008441
735 Ga0268264_10038110
736 Ga0268264_10231430
737 Ga0268264_10390844
738 Ga0307517_10000959
739 Ga0307515_10000001
740 Ga0307511_10000498
741 Ga0265340_10147697
742 Ga0307513_10174168
743 Ga0307513_10449620
744 Ga0307509_10010139
745 Ga0307509_10030460
746 Ga0265313_10090782
747 Ga0307508_10003711
748 Ga0307508_10266842
749 Ga0307405_10229731
750 Ga0307413_11195412
751 Ga0307407_10036315
752 Ga0307407_10487731
753 Ga0307416_100642167
754 Ga0307416_101192901
755 Ga0307414_10187092
756 Ga0307414_10270439
757 Ga0307414_10829093
758 Ga0307411_10458019
759 Ga0307415_100075021
760 Ga0307510_10000074
761 Ga0373937_0196376
762 Ga0373937_0347236
763 Ga0373937_0582758
764 Ga0395905_0010691
765 Ga0395905_0170550
766 Ga0439436_0020942
767 Ga0439439_0176761
768 Ga0439439_0210194
769 Ga0439453_0028565
770 Ga0439465_0007808
771 Ga0451791_0125496
772 Ga0451802_1242863
773 Ga0451807_0898765
774 Ga0451807_2589385
775 Ga0451833_1396747
776 Ga0451835_0047063
777 Ga0451839_1114815
778 Ga0451841_0225345
779 Ga0451849_0473236
780 Ga0451855_1067066
781 Ga0439431_0192626
782 Ga0439441_043643
783 Ga0439445_0062821
784 Ga0439445_0082364
785 Ga0439449_0025680
786 Ga0439449_0026869
787 Ga0439449_0039185
788 Ga0439449_0184155
789 Ga0439457_008376
790 Ga0439457_144385
791 Ga0439462_0007240
792 Ga0450898_034786
793 Ga0450906_013822
794 Ga0439434_0194979
795 Ga0466969_0000033
796 Ga0466972_0000396
797 Ga0466972_0003676
798 Ga0466965_0059846
799 Ga0466966_0000693
800 Ga0466961_0031329
801 Ga0466964_0385634
802 Ga0453684_0150494
803 Ga0466971_0588225
804 Ga0466968_0046618
805 Ga0466957_0004183
806 Ga0466957_0123688
807 Ga0466957_0672271
808 Ga0466960_0032432
809 Ga0466959_0000048
810 Ga0466959_0015931
811 Ga0466958_0048237
812 Ga0495638_0417038
813 Ga0495638_0572741
814 Ga0495650_0172950
815 Ga0495594_0139287
816 Ga0495632_0196948
817 Ga0495622_0054668
818 Ga0495611_0002116
819 Ga0495625_0088111
820 Ga0495649_0408461
821 Ga0495600_0708922
822 Ga0495672_0014487
823 Ga0495687_200504
824 Ga0495686_0000102
825 Ga0495686_0016899
826 Ga0495686_0305895
827 Ga0496114_0404055
828 Ga0496115_0898417
829 Ga0496115_1050614
830 Ga0501290_005917
831 Ga0501292_011453
832 Ga0501292_042819
833 Ga0501298_002141
834 Ga0501299_005456
835 Ga0501033_0934611
836 Ga0501043_0061113
837 Ga0501047_0017254
838 Ga0501047_0056859
839 Ga0501047_0767257
840 Ga0501072_0156630
841 Ga0501198_001317
842 Ga0501202_000435
843 Ga0501202_070878
844 Ga0501202_146640
845 Ga0501206_003677
846 Ga0501207_017748
847 Ga0501216_021941
848 Ga0501217_000220
849 Ga0501223_000584
850 Ga0501223_060217
851 Ga0501223_095402
852 Ga0501224_012798
853 Ga0501233_000359
854 Ga0501235_005398
855 Ga0501240_000382
856 Ga0501242_004179
857 Ga0501243_001137
858 Ga0501247_048071
859 Ga0501251_011174
860 Ga0501251_013035
861 Ga0501252_000124
862 Ga0501253_014329
863 Ga0501257_012147
864 Ga0501257_040905
865 Ga0501257_084203
866 Ga0501260_001487
867 Ga0501219_000013
868 Ga0501221_001606
869 Ga0501225_0001084
870 Ga0501225_0019993
871 Ga0501225_0037521
872 Ga0501234_011285
873 Ga0501245_002660
874 Ga0501080_0147826
875 Ga0501241_065076
876 Ga0501273_031417
877 Ga0501281_07872
878 Ga0501035_0069668
879 Ga0501035_0798266
880 Ga0501044_0002053
881 Ga0501204_011632
882 Ga0501212_000592
883 Ga0501284_00078
884 nmdc:mga0k408_446896_c1
885 nmdc:mga0k408_9357_c1
886 nmdc:mga05p37_7934_c1
887 nmdc:mga09592_17767_c1
888 nmdc:mga09592_206475_c1
889 nmdc:mga0qj67_395356_c1
890 nmdc:mga06r32_230983_c1
891 nmdc:mga08y16_290726_c1
892 Ga0500578_0000097
893 Ga0500578_0196602
894 Ga0500644_0070997
895 Ga0500646_0022471
896 Ga0500646_0058600
897 Ga0500583_0000031
898 Ga0500583_0000640
899 Ga0500583_0330370
900 Ga0500651_0049277
901 Ga0500651_0261644
902 Ga0500651_0457330
903 Ga0500554_167164
904 Ga0500556_0132559
905 Ga0500652_037024
906 Ga0500559_0065574
907 Ga0500588_0172580
908 Ga0500622_0054752
909 Ga0500636_0009710
910 Ga0500611_131611
911 Ga0466962_0134691
912 2738730469

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00885

DMRL_synthase

6,7-dimethyl-8-ribityllumazine synthase

32

174

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4kq6-assembly1.cif.gz_E product complex of lumazine synthase from candida glabrata 0.9597 24 158
2jfb-assembly1.cif.gz_A 3d structure of lumazine synthase from candida albicans 0.9564 22 160
1c41-assembly1.cif.gz_A crystal structures of a pentameric fungal and an icosahedral plant lumazine synthase reveals the structural basis for differences in assembly 0.9543 22 164
1ejb-assembly1.cif.gz_E lumazine synthase from saccharomyces cerevisiae 0.9473 20 159
2o6h-assembly1.cif.gz_A lumazine synthase ribh1 from brucella melitensis (gene bmei1187, swiss-prot entry q8ygh2) complexed with inhibitor 5-nitro-6-(d-ribitylamino)-2,4(1h,3h) pyrimidinedione 0.9352 20 164
ID Description Score Start End Superfamily
4kq6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9436 18 158 3.40.50.960
af_B4FBV7_62_217_3.40.50.960 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9309 15 162 3.40.50.960
3mk3100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9292 16 163 3.40.50.960
1nqwC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9208 20 165 3.40.50.960
af_Q57751_4_141_3.40.50.960 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Lumazine/riboflavin synthase 0.9207 22 164 3.40.50.960
ID Description Score Start End GO Terms
AF-A0A3D4TA54-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (EC 2.5.1.78) 0.9927 83 164 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A562SM01-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9911 27 165 GO:0000906
GO:0005829
GO:0009231
GO:0009349
AF-A0A7J0ADY9-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.987 22 163 GO:0000906
GO:0009231
GO:0009349
AF-A0A351PZA8-F1-model_v4 deleted 0.9837 22 165
AF-A0A1I0RC19-F1-model_v4 6,7-dimethyl-8-ribityllumazine synthase (DMRL synthase) (LS) (Lumazine synthase) (EC 2.5.1.78) 0.9772 14 163 GO:0000906
GO:0005829
GO:0009231
GO:0009349

Map