F447734

General Info

Members Datasets Scaffolds Average Seq Length
456 272 913 217

Family's Representative Sequence

Representative Sequence 3300005834|Ga0068851_10003273|Ga0068851_100032733
Length 249
Sequence MKEYSHFLFALRTTPMADRKSSPISSRRKPKQARSNDLVAAILEAALQVLEKEGAQRFTTTRVAERAGVSVGSVYQYFPNKASILFRLQSDEWKQTSEMLGGILEDTQRPPLERLRMLVHAFVRSECEEAGMRVALSDAAPLYRDAPEAHEARAAGDRIMKAFMREALPHAVEATRAIAADLITTTFSAVGKQFSETPRTDAEIAAYSDAMADMFCAYLRSLGHGQEQALQPQQKRGQAGKRPRRPASR

Samples

Sample ID Description Type Environment
1 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
8 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
9 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
10 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
15 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
16 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
17 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
18 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
19 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
20 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
21 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
22 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
23 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
24 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
25 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
26 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
27 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
28 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
29 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
30 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
41 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
44 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
45 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
70 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
78 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
83 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
85 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
86 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
87 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
90 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
91 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
97 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
98 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
99 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
102 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
125 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
126 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
127 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
128 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
129 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
130 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
131 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
132 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
133 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
142 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
143 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
146 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
147 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
148 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
149 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
150 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
151 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
152 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
153 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
154 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
155 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
156 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
157 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
158 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
159 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
160 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
163 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
164 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
165 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
166 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
167 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
170 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
198 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
199 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
200 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
201 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
202 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
203 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
204 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
205 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
206 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
207 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
208 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
209 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
210 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
211 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
212 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
213 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
214 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
215 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
216 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
217 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
218 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
219 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
220 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
221 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
224 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
225 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
226 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
227 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
228 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
229 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
230 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
231 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
232 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
233 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
234 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
235 2643221618 Ensifer sp. Root231 Isolate Unclassified
236 2643221626 Ensifer sp. Root31 Isolate Unclassified
237 2643221640 Caulobacter sp. Root342 Isolate Unclassified
238 2643221642 Caulobacter sp. Root343 Isolate Unclassified
239 2643221645 Massilia sp. Root351 Isolate Unclassified
240 2643221655 Ensifer sp. Root1252 Isolate Unclassified
241 2643221659 Ensifer sp. Root127 Isolate Unclassified
242 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
243 2643221698 Ensifer sp. Root142 Isolate Unclassified
244 2643221712 Ensifer sp. Root258 Isolate Unclassified
245 2738541307 Variovorax sp. GV008 Isolate Unclassified
246 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
247 2818991440 Luteibacter yeojuensis 583 Isolate Unclassified
248 2818991446 Variovorax sp. 1180 Isolate Unclassified
249 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
250 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
251 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
252 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
253 2844163670 Ensifer sp. 1H6 Isolate Unclassified
254 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
255 2885198086 Variovorax sp. 679 Isolate Unclassified
256 2885211737 Variovorax sp. 553 Isolate Unclassified
257 2899924645 Variovorax sp. 369 Isolate Unclassified
258 2904463128 Luteibacter yeojuensis 3191 Isolate Unclassified
259 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
260 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
261 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
262 2928037797 Variovorax sp. 1126 Isolate Unclassified
263 2928044640 Variovorax sp. 1128 Isolate Unclassified
264 2928051484 Variovorax sp. 1133 Isolate Unclassified
265 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
266 2928070936 Variovorax gossypii 1167 Isolate Unclassified
267 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
268 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
269 2941489479 Lysobacter enzymogenes 2943 Isolate Rhizosphere
270 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
271 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
272 3002141150 Phyllobacterium sp. 628 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 89.04
Metatranscriptomes 0
Isolates 10.96

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.55
Nodule 1.32
Rhizoplane 1.75
Rhizosphere 44.74
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068851_10003273 3300005834 Bacteria 7185
2 JGI24740J21852_10002365 3300001979 Bacteria 8569
3 JGI24740J21852_10026098 3300001979 Bacteria 1961
4 JGI24739J22299_10000012 3300001989 Bacteria 53158
5 JGI24737J22298_10001092 3300001990 Bacteria 9530
6 JGI25156J39149_1000035 3300002705 Bacteria 112093
7 JGI25157J39369_1000048 3300002741 Bacteria 117419
8 JGI25152J39213_1000532 3300002773 Bacteria 21030
9 JGI25150J39212_1002659 3300002774 Bacteria 4375
10 JGI25159J45721_1000405 3300002987 Bacteria 20050
11 JGI25159J45721_1002728 3300002987 Bacteria 6551
12 JGI25151J46595_10001020 3300003187 Bacteria 21030
13 JGI25406J46586_10012573 3300003203 Bacteria 3667
14 JGI25153J46596_10000667 3300003215 Bacteria 21030
15 JGI25153J46596_10002422 3300003215 Bacteria 10759
16 JGI25153J46596_10046227 3300003215 Bacteria 1292
17 rootH1_10001574 3300003316 Bacteria 10332
18 rootH1_10004862 3300003316 Bacteria 1575
19 rootH1_10012200 3300003316 Bacteria 1953
20 rootH2_10021003 3300003320 Bacteria 6441
21 rootH2_10109356 3300003320 Bacteria 1697
22 rootL2_10044737 3300003322 Bacteria 5336
23 rootH1_10000736 3300003323 Bacteria 16818
24 rootH1_10031236 3300003323 Bacteria 2625
25 rootH1_10031237 3300003316 Bacteria 2187
26 rootH1_10031237 3300003323 Bacteria 3042
27 JGI25160J50197_1000610 3300003354 Bacteria 20050
28 JGI25160J50197_1005900 3300003354 Bacteria 5030
29 JGI25161J50226_1000462 3300003374 Bacteria 18715
30 Ga0055539_1000029 3300003752 Bacteria 257094
31 Ga0055533_1000008 3300003756 Bacteria 575861
32 Ga0055532_1008899 3300003758 Bacteria 1233
33 Ga0055525_1001019 3300003759 Bacteria 7397
34 Ga0055535_1000338 3300003761 Bacteria 46755
35 Ga0055535_1014451 3300003761 Bacteria 1133
36 Ga0055542_1000103 3300003762 Bacteria 114989
37 Ga0055526_1000707 3300003771 Bacteria 25281
38 Ga0055526_1001065 3300003771 Bacteria 20050
39 Ga0055526_1003242 3300003771 Bacteria 10479
40 Ga0055537_1000558 3300003773 Bacteria 21027
41 Ga0055524_1000847 3300003775 Bacteria 20050
42 Ga0055524_1001073 3300003775 Bacteria 16793
43 Ga0055524_1010979 3300003775 Bacteria 3567
44 Ga0055524_1012470 3300003775 Bacteria 3260
45 Ga0055536_1003795 3300003781 Bacteria 7967
46 Ga0055536_1030452 3300003781 Bacteria 1431
47 Ga0055534_1000524 3300003784 Bacteria 20674
48 Ga0055534_1003191 3300003784 Bacteria 5290
49 Ga0055528_1000834 3300003790 Bacteria 21027
50 Ga0055528_1002170 3300003790 Bacteria 10760
51 Ga0055530_10000039 3300003791 Bacteria 115587
52 Ga0055530_10000237 3300003791 Bacteria 49495
53 Ga0055540_1000002 3300003792 Bacteria 436954
54 Ga0055540_1005585 3300003792 Bacteria 5242
55 Ga0055540_1013402 3300003792 Bacteria 2506
56 Ga0055540_1015094 3300003792 Bacteria 2266
57 Ga0055531_10001532 3300003794 Bacteria 16929
58 Ga0055531_10002005 3300003794 Bacteria 14137
59 Ga0055531_10006462 3300003794 Bacteria 6652
60 Ga0055531_10008835 3300003794 Bacteria 5242
61 Ga0055543_1000420 3300004625 Bacteria 26756
62 Ga0055543_1000674 3300004625 Bacteria 17821
63 Ga0065165_1000755 3300005262 Bacteria 44054
64 Ga0065165_1000856 3300005262 Bacteria 39851
65 Ga0065165_1001375 3300005262 Bacteria 26747
66 Ga0065165_1003500 3300005262 Bacteria 10929
67 Ga0065165_1012894 3300005262 Bacteria 3363
68 Ga0065165_1064855 3300005262 Bacteria 988
69 Ga0065714_10083523 3300005288 Bacteria 2227
70 Ga0070658_10753670 3300005327 Bacteria 845
71 Ga0070690_100000968 3300005330 Bacteria 14599
72 Ga0068869_100056467 3300005334 Bacteria 2863
73 Ga0070680_100301396 3300005336 Bacteria 1359
74 Ga0070689_101153458 3300005340 Bacteria 694
75 Ga0070661_100138269 3300005344 Bacteria 1834
76 Ga0070674_100419385 3300005356 Bacteria 1098
77 Ga0070659_100005661 3300005366 Bacteria 8982
78 Ga0070659_100120660 3300005366 Bacteria 2123
79 Ga0070667_100669316 3300005367 Bacteria 959
80 Ga0070662_100287936 3300005457 Bacteria 1331
81 Ga0070662_100825738 3300005457 Bacteria 789
82 Ga0068853_100159107 3300005539 Bacteria 2037
83 Ga0068855_100001377 3300005563 Bacteria 30087
84 Ga0068855_100027534 3300005563 Bacteria 6798
85 Ga0068855_100038231 3300005563 Bacteria 5703
86 Ga0068857_100005340 3300005577 Bacteria 10947
87 Ga0068857_100036039 3300005577 Bacteria 4383
88 Ga0068854_100000954 3300005578 Bacteria 17396
89 Ga0068856_100009472 3300005614 Bacteria 9456
90 Ga0068856_100565721 3300005614 Bacteria 1158
91 Ga0068852_100033347 3300005616 Bacteria 4274
92 Ga0068852_100066327 3300005616 Bacteria 3152
93 Ga0068852_100115804 3300005616 Bacteria 2444
94 Ga0068852_100146031 3300005616 Bacteria 2194
95 Ga0068861_100020611 3300005719 Bacteria 4726
96 Ga0068851_10282100 3300005834 Bacteria 950
97 Ga0068858_100095872 3300005842 Bacteria 2764
98 Ga0068862_100017031 3300005844 Bacteria 6046
99 Ga0068862_100085217 3300005844 Bacteria 2746
100 Ga0081539_10002394 3300005985 Bacteria 26661
101 Ga0075363_100182085 3300006048 Bacteria 1196
102 Ga0075366_10010251 3300006195 Bacteria 5257
103 Ga0075366_10043170 3300006195 Bacteria 2670
104 Ga0075370_10073811 3300006353 Bacteria 1954
105 Ga0105250_10061428 3300009092 Bacteria 1511
106 Ga0105240_10005864 3300009093 Bacteria 18206
107 Ga0105240_10021457 3300009093 Bacteria 8588
108 Ga0105240_10021695 3300009093 Bacteria 8538
109 Ga0105240_10026401 3300009093 Bacteria 7619
110 Ga0105247_10019360 3300009101 Bacteria 4085
111 Ga0105243_10297684 3300009148 Bacteria 1461
112 Ga0105241_10206004 3300009174 Bacteria 1646
113 Ga0105241_10520646 3300009174 Bacteria 1063
114 Ga0105242_10360339 3300009176 Bacteria 1346
115 Ga0105237_10000016 3300009545 Bacteria 256506
116 Ga0105237_10257898 3300009545 Bacteria 1746
117 Ga0105238_10002198 3300009551 Bacteria 19700
118 Ga0105239_10163059 3300010375 Bacteria 2491
119 Ga0157314_1000401 3300012500 Bacteria 4367
120 Ga0157339_1016063 3300012505 Bacteria 745
121 Ga0157370_10137561 3300013104 Bacteria 2276
122 Ga0157370_10426909 3300013104 Bacteria 1219
123 Ga0157369_10095814 3300013105 Bacteria 3166
124 Ga0157369_10139240 3300013105 Bacteria 2568
125 Ga0157372_10101596 3300013307 Bacteria 3283
126 Ga0157375_10309193 3300013308 Bacteria 1745
127 Ga0182008_10000316 3300014497 Bacteria 37971
128 Ga0182008_10036438 3300014497 Bacteria 2462
129 Ga0157376_10379340 3300014969 Bacteria 1361
130 Ga0209436_102181 3300025208 Bacteria 6111
131 Ga0209674_100015 3300025226 Bacteria 697299
132 Ga0209672_100922 3300025228 Bacteria 13283
133 Ga0209147_100483 3300025229 Bacteria 23927
134 Ga0209563_100003 3300025230 Bacteria 1932942
135 Ga0209563_100017 3300025230 Bacteria 796449
136 Ga0207427_100391 3300025231 Bacteria 26259
137 Ga0209258_100133 3300025242 Bacteria 174846
138 Ga0209258_103589 3300025242 Bacteria 3276
139 Ga0207425_1000282 3300025245 Bacteria 37515
140 Ga0207425_1008328 3300025245 Bacteria 2662
141 Ga0207425_1011518 3300025245 Bacteria 2104
142 Ga0209646_1000131 3300025246 Bacteria 128289
143 Ga0209026_1000038 3300025250 Bacteria 281227
144 Ga0209677_100022 3300025253 Bacteria 410724
145 Ga0209677_100074 3300025253 Bacteria 133019
146 Ga0209677_102504 3300025253 Bacteria 6849
147 Ga0209148_1000188 3300025254 Bacteria 117310
148 Ga0209759_1000031 3300025256 Bacteria 281227
149 Ga0209759_1006398 3300025256 Bacteria 3962
150 Ga0209129_1000436 3300025258 Bacteria 31077
151 Ga0209129_1003128 3300025258 Bacteria 7428
152 Ga0209129_1008364 3300025258 Bacteria 2892
153 Ga0209565_1000165 3300025263 Bacteria 86871
154 Ga0209565_1000820 3300025263 Bacteria 17662
155 Ga0209673_1000454 3300025273 Bacteria 69331
156 Ga0209673_1001101 3300025273 Bacteria 30262
157 Ga0209673_1003562 3300025273 Bacteria 9069
158 Ga0209130_1000427 3300025284 Bacteria 45224
159 Ga0209130_1000924 3300025284 Bacteria 23585
160 Ga0209675_1000321 3300025291 Bacteria 43024
161 Ga0209675_1001260 3300025291 Bacteria 15176
162 Ga0209676_1000111 3300025292 Bacteria 213411
163 Ga0209676_1001670 3300025292 Bacteria 19271
164 Ga0209025_1001318 3300025294 Bacteria 33769
165 Ga0209564_1000070 3300025295 Bacteria 303126
166 Ga0209564_1000260 3300025295 Bacteria 112444
167 Ga0209564_1000352 3300025295 Bacteria 85941
168 Ga0209564_1019244 3300025295 Bacteria 2562
169 Ga0209758_1000297 3300025297 Bacteria 97664
170 Ga0209758_1000446 3300025297 Bacteria 68984
171 Ga0209758_1001260 3300025297 Bacteria 31379
172 Ga0209758_1003512 3300025297 Bacteria 14157
173 Ga0209758_1043906 3300025297 Bacteria 1641
174 Ga0209050_1000073 3300025298 Bacteria 292046
175 Ga0209050_1000111 3300025298 Bacteria 213411
176 Ga0209050_1000393 3300025298 Bacteria 82050
177 Ga0209256_1000047 3300025299 Bacteria 314709
178 Ga0209256_1000238 3300025299 Bacteria 97664
179 Ga0209256_1004321 3300025299 Bacteria 9034
180 Ga0209256_1005242 3300025299 Bacteria 7585
181 Ga0209256_1031051 3300025299 Bacteria 1467
182 Ga0207426_1000194 3300025302 Bacteria 150009
183 Ga0207426_1000294 3300025302 Bacteria 98700
184 Ga0209051_1000024 3300025303 Bacteria 437007
185 Ga0209051_1000340 3300025303 Bacteria 70080
186 Ga0209051_1013178 3300025303 Bacteria 3949
187 Ga0209257_1000099 3300025304 Bacteria 255304
188 Ga0209257_1000690 3300025304 Bacteria 52373
189 Ga0209257_1000906 3300025304 Bacteria 41475
190 Ga0209257_1001472 3300025304 Bacteria 27715
191 Ga0209257_1039425 3300025304 Bacteria 1420
192 Ga0207656_10015360 3300025321 Bacteria 2962
193 Ga0207647_10022213 3300025904 Bacteria 4219
194 Ga0207654_10176222 3300025911 Bacteria 1392
195 Ga0207654_10313392 3300025911 Bacteria 1070
196 Ga0207695_10000405 3300025913 Bacteria 96061
197 Ga0207695_10000715 3300025913 Bacteria 64608
198 Ga0207695_10001390 3300025913 Bacteria 40902
199 Ga0207695_10008821 3300025913 Bacteria 12556
200 Ga0207695_10021764 3300025913 Bacteria 7303
201 Ga0207671_10000137 3300025914 Bacteria 112029
202 Ga0207660_10233158 3300025917 Bacteria 1448
203 Ga0207657_10020547 3300025919 Bacteria 6237
204 Ga0207690_10045848 3300025932 Bacteria 2891
205 Ga0207690_10179576 3300025932 Bacteria 1593
206 Ga0207690_10360709 3300025932 Bacteria 1151
207 Ga0207706_10003934 3300025933 Bacteria 14082
208 Ga0207706_10296523 3300025933 Bacteria 1409
209 Ga0207686_10355002 3300025934 Bacteria 1105
210 Ga0207689_10023497 3300025942 Bacteria 5173
211 Ga0207679_10912072 3300025945 Bacteria 804
212 Ga0207667_10000047 3300025949 Bacteria 240471
213 Ga0207667_10010824 3300025949 Bacteria 10638
214 Ga0207667_10234369 3300025949 Bacteria 1879
215 Ga0207640_10002156 3300025981 Bacteria 10575
216 Ga0207640_10010048 3300025981 Bacteria 5318
217 Ga0207703_10231467 3300026035 Bacteria 1657
218 Ga0207703_10413265 3300026035 Bacteria 1254
219 Ga0207703_11066579 3300026035 Bacteria 776
220 Ga0207702_10000668 3300026078 Bacteria 37297
221 Ga0207702_10384454 3300026078 Bacteria 1350
222 Ga0207674_10000012 3300026116 Bacteria 193220
223 Ga0207674_10004431 3300026116 Bacteria 16878
224 Ga0207674_10065167 3300026116 Bacteria 3673
225 Ga0207675_100032459 3300026118 Bacteria 4863
226 Ga0207698_10027198 3300026142 Bacteria 4058
227 Ga0207698_10056786 3300026142 Bacteria 3024
228 Ga0207698_10154139 3300026142 Bacteria 1999
229 Ga0207698_10426726 3300026142 Bacteria 1274
230 Ga0268265_10010255 3300028380 Bacteria 6328
231 Ga0268265_10210395 3300028380 Bacteria 1694
232 Ga0265337_1002571 3300028556 Bacteria 8244
233 Ga0265319_1001865 3300028563 Bacteria 11993
234 Ga0265318_10003854 3300028577 Bacteria 7416
235 Ga0265323_10001153 3300028653 Bacteria 13512
236 Ga0265322_10002756 3300028654 Bacteria 5373
237 Ga0265336_10000909 3300028666 Bacteria 15043
238 Ga0265338_10000317 3300028800 Bacteria 87318
239 Ga0265324_10002396 3300029957 Bacteria 9650
240 Ga0316182_1099391 3300030745 Bacteria 2853
241 Ga0373923_0041460 3300035111 Bacteria 1898
242 Ga0395899_0062898 3300037312 Bacteria 2732
243 Ga0395900_0077350 3300037418 Bacteria 3418
244 Ga0395898_0411929 3300037466 Bacteria 1288
245 Ga0395905_0066198 3300037471 Bacteria 3384
246 Ga0395905_0446312 3300037471 Bacteria 1191
247 Ga0395901_0276298 3300038443 Bacteria 1746
248 Ga0439465_0017660 3300041413 Bacteria 2229
249 Ga0466966_0280861 3300044684 Bacteria 1001
250 Ga0466970_0000054 3300044765 Bacteria 43735
251 Ga0466970_0069116 3300044765 Bacteria 1898
252 Ga0495627_000301 3300046453 Bacteria 48812
253 Ga0495627_014021 3300046453 Bacteria 2810
254 Ga0495591_000523 3300046458 Bacteria 29987
255 Ga0495638_0004417 3300046460 Bacteria 10645
256 Ga0495638_0023910 3300046460 Bacteria 3991
257 Ga0495638_0071748 3300046460 Bacteria 2118
258 Ga0495638_0111921 3300046460 Bacteria 1621
259 Ga0495607_0049479 3300046501 Bacteria 2450
260 Ga0495583_0001679 3300046506 Bacteria 21403
261 Ga0495583_0013160 3300046506 Bacteria 4633
262 Ga0495606_0000329 3300046507 Bacteria 81972
263 Ga0495606_0000759 3300046507 Bacteria 49624
264 Ga0495610_0029945 3300046512 Bacteria 2859
265 Ga0495610_0069728 3300046512 Bacteria 1644
266 Ga0495610_0139286 3300046512 Bacteria 1046
267 Ga0495616_0000026 3300046513 Bacteria 141705
268 Ga0495616_0000350 3300046513 Bacteria 36334
269 Ga0495616_0139694 3300046513 Bacteria 1104
270 Ga0495620_0000476 3300046515 Bacteria 26107
271 Ga0495620_0030335 3300046515 Bacteria 2491
272 Ga0495631_0000182 3300046518 Bacteria 42891
273 Ga0495632_0000700 3300046519 Bacteria 30503
274 Ga0495632_0210512 3300046519 Bacteria 882
275 Ga0495643_0021800 3300046522 Bacteria 3667
276 Ga0495663_0066929 3300046525 Bacteria 1138
277 Ga0495597_0008219 3300046542 Bacteria 5245
278 Ga0495668_0007075 3300046616 Bacteria 7223
279 Ga0495668_0030027 3300046616 Bacteria 3070
280 Ga0495625_0001809 3300046660 Bacteria 24504
281 Ga0495625_0025406 3300046660 Bacteria 4493
282 Ga0495625_0083731 3300046660 Bacteria 2216
283 Ga0495625_0233705 3300046660 Bacteria 1200
284 Ga0495661_0000328 3300046665 Bacteria 51600
285 Ga0495588_0028293 3300046674 Bacteria 2804
286 Ga0495669_0069657 3300046684 Bacteria 1601
287 Ga0495670_0027447 3300046691 Bacteria 2821
288 Ga0495649_0000942 3300046694 Bacteria 22968
289 Ga0495589_0003998 3300046794 Bacteria 7912
290 Ga0495589_0033779 3300046794 Bacteria 2568
291 Ga0495660_0237022 3300046810 Bacteria 852
292 Ga0495679_000849 3300047446 Bacteria 19421
293 Ga0495673_0033842 3300047469 Bacteria 2367
294 Ga0495681_0008247 3300047470 Bacteria 6549
295 Ga0495681_0021328 3300047470 Bacteria 3494
296 Ga0495681_0027536 3300047470 Bacteria 2938
297 Ga0495686_0007135 3300047472 Bacteria 8414
298 Ga0495686_0007741 3300047472 Bacteria 8006
299 Ga0495686_0029952 3300047472 Bacteria 3536
300 Ga0495686_0178819 3300047472 Bacteria 1230
301 Ga0495593_0043123 3300047673 Bacteria 2419
302 Ga0495602_0230060 3300048088 Bacteria 1394
303 Ga0496106_0000038 3300048909 Bacteria 111983
304 Ga0496107_0076159 3300048910 Bacteria 2443
305 Ga0496113_0009799 3300048916 Bacteria 6302
306 Ga0496113_0471847 3300048916 Bacteria 1008
307 Ga0496115_0205680 3300048918 Bacteria 1626
308 Ga0496117_0000597 3300048920 Bacteria 59321
309 Ga0496117_0008977 3300048920 Bacteria 9409
310 Ga0496117_0172336 3300048920 Bacteria 1254
311 Ga0496117_0298197 3300048920 Bacteria 855
312 Ga0496118_0017510 3300048921 Bacteria 6518
313 Ga0496118_0028603 3300048921 Bacteria 4690
314 Ga0496118_0051923 3300048921 Bacteria 3132
315 Ga0496119_0031073 3300048922 Bacteria 3588
316 Ga0496120_0001745 3300048923 Bacteria 24689
317 Ga0496121_0003895 3300048924 Bacteria 20720
318 Ga0496121_0012270 3300048924 Bacteria 9379
319 Ga0496121_0013224 3300048924 Bacteria 8893
320 Ga0496121_0054667 3300048924 Bacteria 3333
321 Ga0496121_0201416 3300048924 Bacteria 1418
322 Ga0496122_0000509 3300048925 Bacteria 80337
323 Ga0496122_0011020 3300048925 Bacteria 9237
324 Ga0496122_0066181 3300048925 Bacteria 2613
325 Ga0496122_0088883 3300048925 Bacteria 2115
326 Ga0496122_0288771 3300048925 Bacteria 892
327 Ga0496123_0020622 3300048926 Bacteria 5150
328 Ga0496123_0033377 3300048926 Bacteria 3706
329 Ga0496123_0079562 3300048926 Bacteria 2002
330 Ga0496123_0093586 3300048926 Bacteria 1774
331 Ga0496124_0000747 3300048927 Bacteria 53318
332 Ga0496124_0008489 3300048927 Bacteria 10730
333 Ga0496124_0022460 3300048927 Bacteria 5782
334 Ga0496124_0027729 3300048927 Bacteria 5076
335 Ga0496124_0312710 3300048927 Bacteria 1129
336 Ga0496125_0000092 3300048928 Bacteria 211050
337 Ga0496125_0000147 3300048928 Bacteria 154731
338 Ga0496125_0000479 3300048928 Bacteria 70840
339 Ga0496125_0001927 3300048928 Bacteria 28394
340 Ga0496125_0013988 3300048928 Bacteria 7846
341 Ga0496125_0038877 3300048928 Bacteria 4108
342 Ga0496125_0202258 3300048928 Bacteria 1299
343 Ga0496125_0281646 3300048928 Bacteria 1029
344 Ga0496125_0393723 3300048928 Bacteria 812
345 Ga0496126_0135530 3300048929 Bacteria 2124
346 Ga0496126_0354233 3300048929 Bacteria 1200
347 Ga0496126_0471830 3300048929 Bacteria 1007
348 Ga0496126_0552156 3300048929 Bacteria 914
349 Ga0501032_0296933 3300049569 Bacteria 1045
350 Ga0501034_0055792 3300049571 Bacteria 3976
351 Ga0501038_0139430 3300049574 Bacteria 1985
352 Ga0501039_0647876 3300049575 Bacteria 827
353 Ga0501047_0514696 3300049581 Bacteria 1023
354 Ga0501067_0061726 3300049583 Bacteria 2075
355 Ga0501070_0440602 3300049586 Bacteria 1051
356 Ga0501073_0027274 3300049589 Bacteria 4086
357 Ga0501073_0182497 3300049589 Bacteria 1452
358 Ga0501080_0106202 3300049742 Bacteria 2602
359 Ga0501083_0095852 3300049744 Bacteria 1957
360 Ga0501083_0200303 3300049744 Bacteria 1302
361 Ga0501083_0265068 3300049744 Bacteria 1117
362 Ga0501044_0022605 3300049823 Bacteria 6700
363 Ga0501044_0466747 3300049823 Bacteria 1167
364 Ga0501044_1021922 3300049823 Bacteria 698
365 nmdc:mga0k408_209285_c1 3300050493 Bacteria 1164
366 nmdc:mga07m45_14552_c1 3300050496 Bacteria 3679
367 nmdc:mga07m45_373003_c1 3300050496 Bacteria 829
368 nmdc:mga0sz30_12525_c1 3300050516 Bacteria 3302
369 nmdc:mga0sz30_55627_c1 3300050516 Bacteria 1684
370 nmdc:mga0sz30_7093_c1 3300050516 Bacteria 4191
371 Ga0500643_003230 3300053087 Bacteria 7933
372 Ga0500643_004505 3300053087 Bacteria 6271
373 Ga0500644_0077176 3300053088 Bacteria 1216
374 Ga0500651_0000198 3300053093 Bacteria 38341
375 Ga0500651_0075695 3300053093 Bacteria 2091
376 Ga0500651_0166989 3300053093 Bacteria 1314
377 Ga0500571_000024 3300053110 Bacteria 52195
378 Ga0500572_016852 3300053111 Bacteria 1869
379 Ga0500593_000057 3300053117 Bacteria 41215
380 Ga0500597_124204 3300053120 Bacteria 1117
381 Ga0500608_206634 3300053122 Bacteria 806
382 Ga0500614_080187 3300053123 Bacteria 912
383 Ga0500618_000325 3300053125 Bacteria 34983
384 Ga0500618_003334 3300053125 Bacteria 5555
385 Ga0500618_014280 3300053125 Bacteria 2032
386 Ga0500626_009469 3300053128 Bacteria 4053
387 Ga0500642_0127604 3300053130 Bacteria 1191
388 Ga0500642_0218719 3300053130 Bacteria 883
389 Ga0500655_000237 3300053133 Bacteria 13113
390 Ga0500658_0000217 3300053134 Bacteria 27422
391 Ga0500658_0001231 3300053134 Bacteria 10410
392 Ga0500658_0053740 3300053134 Bacteria 1653
393 Ga0500564_003485 3300053138 Bacteria 6111
394 Ga0500568_0000111 3300053139 Bacteria 75413
395 Ga0500568_0000365 3300053139 Bacteria 35007
396 Ga0500568_0053472 3300053139 Bacteria 1583
397 Ga0500568_0072338 3300053139 Bacteria 1318
398 Ga0500574_002503 3300053141 Bacteria 3040
399 Ga0500604_0009707 3300053151 Bacteria 2564
400 Ga0500604_0009930 3300053151 Bacteria 2540
401 Ga0500616_0165752 3300053153 Bacteria 1008
402 Ga0500634_0010081 3300053161 Bacteria 4814
403 Ga0500636_0024988 3300053177 Bacteria 3530
404 Ga0500599_034332 3300053736 Bacteria 764
405 Ga0501084_0699291 3300054114 Bacteria 855
406 Ga0501082_0111321 3300060353 Bacteria 2370
407 Ga0501082_0238525 3300060353 Bacteria 1582
408 2509448207 2509276033 Bacteria 7180565
409 2511195995 2510917030 Bacteria 7460662
410 2511390928 2511231027 Bacteria 5013807
411 2554816334 2554235132 Bacteria 6772433
412 2585222605 2582581298 Bacteria 7315509
413 2585545188 2585427529 Bacteria 7395659
414 2599625299 2599185214 Bacteria 8209958
415 2599673249 2599185226 Bacteria 8233575
416 2599682919 2599185227 Bacteria 8246414
417 2599694857 2599185229 Bacteria 8216126
418 2643728693 2643221541 Bacteria 5498788
419 2644044708 2643221606 Bacteria 5588032
420 2644106245 2643221618 Bacteria 7717186
421 2644146791 2643221626 Bacteria 8069654
422 2644227656 2643221640 Bacteria 5258820
423 2644236826 2643221642 Bacteria 5357871
424 2644250692 2643221645 Bacteria 7207331
425 2644310856 2643221655 Bacteria 7722067
426 2644334359 2643221659 Bacteria 7890716
427 2644390881 2643221671 Bacteria 5496681
428 2644545436 2643221698 Bacteria 7756764
429 2644616690 2643221712 Bacteria 7729434
430 2738881088 2738541307 Bacteria 8606193
431 2793314800 2791355259 Bacteria 7254731
432 2819562861 2818991440 Bacteria 4774720
433 2819602183 2818991446 Bacteria 7757362
434 2831267472 2831265667 Bacteria 7184833
435 2838048586 2838042994 Bacteria 6046894
436 2838060425 2838054893 Bacteria 7451788
437 2842874347 2842871566 Bacteria 4827117
438 2844165996 2844163670 Bacteria 7266046
439 2857508735 2857504554 Bacteria 5369913
440 2885198233 2885198086 Bacteria 7212419
441 2885212387 2885211737 Bacteria 7212420
442 2899928751 2899924645 Bacteria 7487985
443 2904463472 2904463128 Bacteria 4775606
444 2904695483 2904690495 Bacteria 9412302
445 2908757471 2908756301 Bacteria 8864324
446 2919106491 2919100787 Bacteria 7710546
447 2928043312 2928037797 Bacteria 7273642
448 2928050754 2928044640 Bacteria 7271509
449 2928058754 2928051484 Bacteria 7773759
450 2928066173 2928064002 Bacteria 7419480
451 2928077796 2928070936 Bacteria 8062541
452 2928088093 2928084124 Bacteria 7159212
453 2939624913 2939622612 Bacteria 4698046
454 2941491413 2941489479 Bacteria 6313767
455 2945962447 2945961074 Bacteria 7342064
456 2954768064 2954767861 Bacteria 5535784
457 3002145906 3002141150 Bacteria 5254435
458 Ga0068851_10003273
459 JGI24740J21852_10002365
460 JGI24740J21852_10026098
461 JGI24739J22299_10000012
462 JGI24737J22298_10001092
463 JGI25156J39149_1000035
464 JGI25157J39369_1000048
465 JGI25152J39213_1000532
466 JGI25150J39212_1002659
467 JGI25159J45721_1000405
468 JGI25159J45721_1002728
469 JGI25151J46595_10001020
470 JGI25406J46586_10012573
471 JGI25153J46596_10000667
472 JGI25153J46596_10002422
473 JGI25153J46596_10046227
474 rootH1_10001574
475 rootH1_10004862
476 rootH1_10012200
477 rootH2_10021003
478 rootH2_10109356
479 rootL2_10044737
480 rootH1_10000736
481 rootH1_10031236
482 rootH1_10031237
483 JGI25160J50197_1000610
484 JGI25160J50197_1005900
485 JGI25161J50226_1000462
486 Ga0055539_1000029
487 Ga0055533_1000008
488 Ga0055532_1008899
489 Ga0055525_1001019
490 Ga0055535_1000338
491 Ga0055535_1014451
492 Ga0055542_1000103
493 Ga0055526_1000707
494 Ga0055526_1001065
495 Ga0055526_1003242
496 Ga0055537_1000558
497 Ga0055524_1000847
498 Ga0055524_1001073
499 Ga0055524_1010979
500 Ga0055524_1012470
501 Ga0055536_1003795
502 Ga0055536_1030452
503 Ga0055534_1000524
504 Ga0055534_1003191
505 Ga0055528_1000834
506 Ga0055528_1002170
507 Ga0055530_10000039
508 Ga0055530_10000237
509 Ga0055540_1000002
510 Ga0055540_1005585
511 Ga0055540_1013402
512 Ga0055540_1015094
513 Ga0055531_10001532
514 Ga0055531_10002005
515 Ga0055531_10006462
516 Ga0055531_10008835
517 Ga0055543_1000420
518 Ga0055543_1000674
519 Ga0065165_1000755
520 Ga0065165_1000856
521 Ga0065165_1001375
522 Ga0065165_1003500
523 Ga0065165_1012894
524 Ga0065165_1064855
525 Ga0065714_10083523
526 Ga0070658_10753670
527 Ga0070690_100000968
528 Ga0068869_100056467
529 Ga0070680_100301396
530 Ga0070689_101153458
531 Ga0070661_100138269
532 Ga0070674_100419385
533 Ga0070659_100005661
534 Ga0070659_100120660
535 Ga0070667_100669316
536 Ga0070662_100287936
537 Ga0070662_100825738
538 Ga0068853_100159107
539 Ga0068855_100001377
540 Ga0068855_100027534
541 Ga0068855_100038231
542 Ga0068857_100005340
543 Ga0068857_100036039
544 Ga0068854_100000954
545 Ga0068856_100009472
546 Ga0068856_100565721
547 Ga0068852_100033347
548 Ga0068852_100066327
549 Ga0068852_100115804
550 Ga0068852_100146031
551 Ga0068861_100020611
552 Ga0068851_10282100
553 Ga0068858_100095872
554 Ga0068862_100017031
555 Ga0068862_100085217
556 Ga0081539_10002394
557 Ga0075363_100182085
558 Ga0075366_10010251
559 Ga0075366_10043170
560 Ga0075370_10073811
561 Ga0105250_10061428
562 Ga0105240_10005864
563 Ga0105240_10021457
564 Ga0105240_10021695
565 Ga0105240_10026401
566 Ga0105247_10019360
567 Ga0105243_10297684
568 Ga0105241_10206004
569 Ga0105241_10520646
570 Ga0105242_10360339
571 Ga0105237_10000016
572 Ga0105237_10257898
573 Ga0105238_10002198
574 Ga0105239_10163059
575 Ga0157314_1000401
576 Ga0157339_1016063
577 Ga0157370_10137561
578 Ga0157370_10426909
579 Ga0157369_10095814
580 Ga0157369_10139240
581 Ga0157372_10101596
582 Ga0157375_10309193
583 Ga0182008_10000316
584 Ga0182008_10036438
585 Ga0157376_10379340
586 Ga0209436_102181
587 Ga0209674_100015
588 Ga0209672_100922
589 Ga0209147_100483
590 Ga0209563_100003
591 Ga0209563_100017
592 Ga0207427_100391
593 Ga0209258_100133
594 Ga0209258_103589
595 Ga0207425_1000282
596 Ga0207425_1008328
597 Ga0207425_1011518
598 Ga0209646_1000131
599 Ga0209026_1000038
600 Ga0209677_100022
601 Ga0209677_100074
602 Ga0209677_102504
603 Ga0209148_1000188
604 Ga0209759_1000031
605 Ga0209759_1006398
606 Ga0209129_1000436
607 Ga0209129_1003128
608 Ga0209129_1008364
609 Ga0209565_1000165
610 Ga0209565_1000820
611 Ga0209673_1000454
612 Ga0209673_1001101
613 Ga0209673_1003562
614 Ga0209130_1000427
615 Ga0209130_1000924
616 Ga0209675_1000321
617 Ga0209675_1001260
618 Ga0209676_1000111
619 Ga0209676_1001670
620 Ga0209025_1001318
621 Ga0209564_1000070
622 Ga0209564_1000260
623 Ga0209564_1000352
624 Ga0209564_1019244
625 Ga0209758_1000297
626 Ga0209758_1000446
627 Ga0209758_1001260
628 Ga0209758_1003512
629 Ga0209758_1043906
630 Ga0209050_1000073
631 Ga0209050_1000111
632 Ga0209050_1000393
633 Ga0209256_1000047
634 Ga0209256_1000238
635 Ga0209256_1004321
636 Ga0209256_1005242
637 Ga0209256_1031051
638 Ga0207426_1000194
639 Ga0207426_1000294
640 Ga0209051_1000024
641 Ga0209051_1000340
642 Ga0209051_1013178
643 Ga0209257_1000099
644 Ga0209257_1000690
645 Ga0209257_1000906
646 Ga0209257_1001472
647 Ga0209257_1039425
648 Ga0207656_10015360
649 Ga0207647_10022213
650 Ga0207654_10176222
651 Ga0207654_10313392
652 Ga0207695_10000405
653 Ga0207695_10000715
654 Ga0207695_10001390
655 Ga0207695_10008821
656 Ga0207695_10021764
657 Ga0207671_10000137
658 Ga0207660_10233158
659 Ga0207657_10020547
660 Ga0207690_10045848
661 Ga0207690_10179576
662 Ga0207690_10360709
663 Ga0207706_10003934
664 Ga0207706_10296523
665 Ga0207686_10355002
666 Ga0207689_10023497
667 Ga0207679_10912072
668 Ga0207667_10000047
669 Ga0207667_10010824
670 Ga0207667_10234369
671 Ga0207640_10002156
672 Ga0207640_10010048
673 Ga0207703_10231467
674 Ga0207703_10413265
675 Ga0207703_11066579
676 Ga0207702_10000668
677 Ga0207702_10384454
678 Ga0207674_10000012
679 Ga0207674_10004431
680 Ga0207674_10065167
681 Ga0207675_100032459
682 Ga0207698_10027198
683 Ga0207698_10056786
684 Ga0207698_10154139
685 Ga0207698_10426726
686 Ga0268265_10010255
687 Ga0268265_10210395
688 Ga0265337_1002571
689 Ga0265319_1001865
690 Ga0265318_10003854
691 Ga0265323_10001153
692 Ga0265322_10002756
693 Ga0265336_10000909
694 Ga0265338_10000317
695 Ga0265324_10002396
696 Ga0316182_1099391
697 Ga0373923_0041460
698 Ga0395899_0062898
699 Ga0395900_0077350
700 Ga0395898_0411929
701 Ga0395905_0066198
702 Ga0395905_0446312
703 Ga0395901_0276298
704 Ga0439465_0017660
705 Ga0466966_0280861
706 Ga0466970_0000054
707 Ga0466970_0069116
708 Ga0495627_000301
709 Ga0495627_014021
710 Ga0495591_000523
711 Ga0495638_0004417
712 Ga0495638_0023910
713 Ga0495638_0071748
714 Ga0495638_0111921
715 Ga0495607_0049479
716 Ga0495583_0001679
717 Ga0495583_0013160
718 Ga0495606_0000329
719 Ga0495606_0000759
720 Ga0495610_0029945
721 Ga0495610_0069728
722 Ga0495610_0139286
723 Ga0495616_0000026
724 Ga0495616_0000350
725 Ga0495616_0139694
726 Ga0495620_0000476
727 Ga0495620_0030335
728 Ga0495631_0000182
729 Ga0495632_0000700
730 Ga0495632_0210512
731 Ga0495643_0021800
732 Ga0495663_0066929
733 Ga0495597_0008219
734 Ga0495668_0007075
735 Ga0495668_0030027
736 Ga0495625_0001809
737 Ga0495625_0025406
738 Ga0495625_0083731
739 Ga0495625_0233705
740 Ga0495661_0000328
741 Ga0495588_0028293
742 Ga0495669_0069657
743 Ga0495670_0027447
744 Ga0495649_0000942
745 Ga0495589_0003998
746 Ga0495589_0033779
747 Ga0495660_0237022
748 Ga0495679_000849
749 Ga0495673_0033842
750 Ga0495681_0008247
751 Ga0495681_0021328
752 Ga0495681_0027536
753 Ga0495686_0007135
754 Ga0495686_0007741
755 Ga0495686_0029952
756 Ga0495686_0178819
757 Ga0495593_0043123
758 Ga0495602_0230060
759 Ga0496106_0000038
760 Ga0496107_0076159
761 Ga0496113_0009799
762 Ga0496113_0471847
763 Ga0496115_0205680
764 Ga0496117_0000597
765 Ga0496117_0008977
766 Ga0496117_0172336
767 Ga0496117_0298197
768 Ga0496118_0017510
769 Ga0496118_0028603
770 Ga0496118_0051923
771 Ga0496119_0031073
772 Ga0496120_0001745
773 Ga0496121_0003895
774 Ga0496121_0012270
775 Ga0496121_0013224
776 Ga0496121_0054667
777 Ga0496121_0201416
778 Ga0496122_0000509
779 Ga0496122_0011020
780 Ga0496122_0066181
781 Ga0496122_0088883
782 Ga0496122_0288771
783 Ga0496123_0020622
784 Ga0496123_0033377
785 Ga0496123_0079562
786 Ga0496123_0093586
787 Ga0496124_0000747
788 Ga0496124_0008489
789 Ga0496124_0022460
790 Ga0496124_0027729
791 Ga0496124_0312710
792 Ga0496125_0000092
793 Ga0496125_0000147
794 Ga0496125_0000479
795 Ga0496125_0001927
796 Ga0496125_0013988
797 Ga0496125_0038877
798 Ga0496125_0202258
799 Ga0496125_0281646
800 Ga0496125_0393723
801 Ga0496126_0135530
802 Ga0496126_0354233
803 Ga0496126_0471830
804 Ga0496126_0552156
805 Ga0501032_0296933
806 Ga0501034_0055792
807 Ga0501038_0139430
808 Ga0501039_0647876
809 Ga0501047_0514696
810 Ga0501067_0061726
811 Ga0501070_0440602
812 Ga0501073_0027274
813 Ga0501073_0182497
814 Ga0501080_0106202
815 Ga0501083_0095852
816 Ga0501083_0200303
817 Ga0501083_0265068
818 Ga0501044_0022605
819 Ga0501044_0466747
820 Ga0501044_1021922
821 nmdc:mga0k408_209285_c1
822 nmdc:mga07m45_14552_c1
823 nmdc:mga07m45_373003_c1
824 nmdc:mga0sz30_12525_c1
825 nmdc:mga0sz30_55627_c1
826 nmdc:mga0sz30_7093_c1
827 Ga0500643_003230
828 Ga0500643_004505
829 Ga0500644_0077176
830 Ga0500651_0000198
831 Ga0500651_0075695
832 Ga0500651_0166989
833 Ga0500571_000024
834 Ga0500572_016852
835 Ga0500593_000057
836 Ga0500597_124204
837 Ga0500608_206634
838 Ga0500614_080187
839 Ga0500618_000325
840 Ga0500618_003334
841 Ga0500618_014280
842 Ga0500626_009469
843 Ga0500642_0127604
844 Ga0500642_0218719
845 Ga0500655_000237
846 Ga0500658_0000217
847 Ga0500658_0001231
848 Ga0500658_0053740
849 Ga0500564_003485
850 Ga0500568_0000111
851 Ga0500568_0000365
852 Ga0500568_0053472
853 Ga0500568_0072338
854 Ga0500574_002503
855 Ga0500604_0009707
856 Ga0500604_0009930
857 Ga0500616_0165752
858 Ga0500634_0010081
859 Ga0500636_0024988
860 Ga0500599_034332
861 Ga0501084_0699291
862 Ga0501082_0111321
863 Ga0501082_0238525
864 2509448207
865 2511195995
866 2511390928
867 2554816334
868 2585222605
869 2585545188
870 2599625299
871 2599673249
872 2599682919
873 2599694857
874 2643728693
875 2644044708
876 2644106245
877 2644146791
878 2644227656
879 2644236826
880 2644250692
881 2644310856
882 2644334359
883 2644390881
884 2644545436
885 2644616690
886 2738881088
887 2793314800
888 2819562861
889 2819602183
890 2831267472
891 2838048586
892 2838060425
893 2842874347
894 2844165996
895 2857508735
896 2885198233
897 2885212387
898 2899928751
899 2904463472
900 2904695483
901 2908757471
902 2919106491
903 2928043312
904 2928050754
905 2928058754
906 2928066173
907 2928077796
908 2928088093
909 2939624913
910 2941491413
911 2945962447
912 2954768064
913 3002145906

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17923

TetR_C_18

Tetracyclin repressor-like, C-terminal domain

110

222

0.99

PF17918

TetR_C_15

Tetracyclin repressor-like, C-terminal domain

110

219

0.97

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

42

88

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oer-assembly1.cif.gz_A probable transcriptional regulator from pseudomonas aeruginosa 0.9399 22 208
2oer-assembly1.cif.gz_A probable transcriptional regulator from pseudomonas aeruginosa 0.9248 22 208
2oer-assembly1.cif.gz_B probable transcriptional regulator from pseudomonas aeruginosa 0.9088 21 210
2oer-assembly1.cif.gz_B probable transcriptional regulator from pseudomonas aeruginosa 0.8997 21 210
3egq-assembly1.cif.gz_B crystal structure of a tetr-family transcriptional regulator (af_1817) from archaeoglobus fulgidus at 2.55 a resolution 0.7335 22 199
ID Description Score Start End Superfamily
3whcE01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.956 21 65 1.10.10.60
3whcC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9505 22 65 1.10.10.60
2of7A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9501 16 64 1.10.10.60
3mvpB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9491 21 63 1.10.10.60
5gpcB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9405 23 65 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A160UY81-F1-model_v4 deleted 0.9758 25 210
AF-A0A0S2FKR6-F1-model_v4 deleted 0.9741 25 210
AF-A0A7W5LYZ9-F1-model_v4 AcrR family transcriptional regulator 0.9701 37 209 GO:0000976
GO:0003700
AF-A0A640JTJ1-F1-model_v4 deleted 0.9684 42 210
AF-A0A160UY81-F1-model_v4 deleted 0.9656 25 210

Map