F447783

General Info

Members Datasets Scaffolds Average Seq Length
456 256 912 151

Family's Representative Sequence

Representative Sequence 3300021384|Ga0213876_10182986|Ga0213876_101829862
Length 180
Sequence MSGDTPSAPRSLAEAYEQLEAQAKAKPAEPPLSSKARRARTVARLAAVQALYQMEIGGAGVEAVIREFADFRFEADLEDRLLADADEDFFAAIVRGAVEHQHGVDQAIAKRLAQGWRLDRIDATLRAMFRAGTYELMHRPDVPTEVAIDEYVEIAKSFFEGPEPGFVNGALDGIARDVRG

Samples

Sample ID Description Type Environment
1 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
2 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
20 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
35 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
47 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
48 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
49 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
50 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
51 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
52 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
57 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
58 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
59 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
60 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
62 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
99 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
102 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
107 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
108 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
109 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
110 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
117 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
118 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
121 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
122 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
123 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
124 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
125 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
128 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
129 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
133 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
134 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
137 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
138 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
139 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
140 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
141 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
142 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
143 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
144 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
145 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
146 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
147 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
150 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
151 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
152 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
161 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
162 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
163 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
164 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
171 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
175 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
176 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
177 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
178 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
179 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
180 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
181 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
184 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
185 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
191 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
192 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
193 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
194 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
195 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
196 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
197 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
198 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
199 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
200 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
201 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
202 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
203 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
204 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
205 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
206 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
207 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
208 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
209 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
210 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
211 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
212 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
213 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
214 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
215 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
216 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
217 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
218 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
219 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
220 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
221 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
222 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
223 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
224 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
225 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
226 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
227 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
228 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
229 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
230 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
231 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
232 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
233 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
234 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
235 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
236 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
237 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
238 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
239 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
240 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
241 2643221583 Caulobacter sp. Root655 Isolate Unclassified
242 2643221584 Caulobacter sp. Root656 Isolate Unclassified
243 2643221640 Caulobacter sp. Root342 Isolate Unclassified
244 2643221642 Caulobacter sp. Root343 Isolate Unclassified
245 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
246 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
247 2818991435 Caulobacter henricii 536 Isolate Unclassified
248 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
249 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
250 2849560528 Caulobacter zeae 410 Isolate Unclassified
251 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
252 2851153111 Caulobacter radicis 736 Isolate Unclassified
253 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
254 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
255 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
256 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.96
Metatranscriptomes 0
Isolates 5.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.46
Nodule 0
Rhizoplane 2.63
Rhizosphere 64.91
Stem 0
Stem Tuber 0
Unclassified 0.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213876_10182986 3300021384 Bacteria 1114
2 Ga0055537_1001849 3300003773 Bacteria 7643
3 Ga0055536_1039668 3300003781 Bacteria 1128
4 Ga0055536_1039936 3300003781 Bacteria 1122
5 Ga0055530_10005476 3300003791 Bacteria 6015
6 Ga0055530_10042110 3300003791 Bacteria 1110
7 Ga0055531_10006551 3300003794 Bacteria 6588
8 Ga0055531_10073415 3300003794 Bacteria 780
9 Ga0065165_1000911 3300005262 Bacteria 38161
10 Ga0070658_10072478 3300005327 Bacteria 2823
11 Ga0070658_10176324 3300005327 Bacteria 1797
12 Ga0070676_10523096 3300005328 Bacteria 845
13 Ga0070670_100000039 3300005331 Bacteria 152618
14 Ga0070670_100066765 3300005331 Bacteria 3087
15 Ga0070670_100099982 3300005331 Bacteria 2496
16 Ga0068868_100586243 3300005338 Bacteria 986
17 Ga0070668_100001314 3300005347 Bacteria 17796
18 Ga0070668_100008342 3300005347 Bacteria 7694
19 Ga0070668_100092997 3300005347 Bacteria 2379
20 Ga0070669_100017499 3300005353 Bacteria 5112
21 Ga0070669_100111916 3300005353 Bacteria 2072
22 Ga0070671_100052127 3300005355 Bacteria 3403
23 Ga0070659_100019177 3300005366 Bacteria 5177
24 Ga0070667_100000164 3300005367 Bacteria 82930
25 Ga0070667_100008541 3300005367 Bacteria 8490
26 Ga0070667_100009378 3300005367 Bacteria 8116
27 Ga0070713_101800839 3300005436 Bacteria 594
28 Ga0070663_100183025 3300005455 Bacteria 1627
29 Ga0070663_100743160 3300005455 Bacteria 837
30 Ga0070679_101209787 3300005530 Bacteria 701
31 Ga0068853_100242168 3300005539 Bacteria 1653
32 Ga0070672_100641328 3300005543 Bacteria 927
33 Ga0070686_101031214 3300005544 Bacteria 676
34 Ga0070665_100000489 3300005548 Bacteria 56677
35 Ga0070665_100046995 3300005548 Bacteria 4332
36 Ga0070665_100057710 3300005548 Bacteria 3892
37 Ga0070665_100747881 3300005548 Bacteria 991
38 Ga0068855_100012184 3300005563 Bacteria 10392
39 Ga0068855_100135152 3300005563 Bacteria 2814
40 Ga0068855_100327404 3300005563 Bacteria 1692
41 Ga0068855_101045651 3300005563 Bacteria 856
42 Ga0070664_100020803 3300005564 Bacteria 5405
43 Ga0068854_101017910 3300005578 Unclassified 734
44 Ga0068852_100006205 3300005616 Bacteria 8617
45 Ga0068852_100944855 3300005616 Bacteria 880
46 Ga0068859_100007694 3300005617 Bacteria 10942
47 Ga0068859_100074718 3300005617 Bacteria 3428
48 Ga0068859_100198810 3300005617 Bacteria 2089
49 Ga0068859_102304441 3300005617 Bacteria 594
50 Ga0068864_100000068 3300005618 Bacteria 115507
51 Ga0068864_100000115 3300005618 Bacteria 79542
52 Ga0068864_100637010 3300005618 Bacteria 1037
53 Ga0068864_100825912 3300005618 Bacteria 912
54 Ga0068861_100103396 3300005719 Bacteria 2270
55 Ga0068861_100460953 3300005719 Bacteria 1141
56 Ga0068861_101373609 3300005719 Bacteria 689
57 Ga0068863_100000007 3300005841 Bacteria 257578
58 Ga0068863_100012835 3300005841 Bacteria 8079
59 Ga0068863_100015866 3300005841 Bacteria 7226
60 Ga0068863_100051273 3300005841 Bacteria 3911
61 Ga0068863_100348797 3300005841 Bacteria 1441
62 Ga0068858_100000031 3300005842 Bacteria 143397
63 Ga0068858_100002686 3300005842 Bacteria 17901
64 Ga0068858_100007071 3300005842 Bacteria 10894
65 Ga0068858_100217668 3300005842 Bacteria 1808
66 Ga0068860_100000625 3300005843 Bacteria 41833
67 Ga0068860_100026830 3300005843 Bacteria 5550
68 Ga0068860_100042258 3300005843 Bacteria 4354
69 Ga0068862_100001908 3300005844 Bacteria 18938
70 Ga0068862_100019762 3300005844 Bacteria 5626
71 Ga0068862_100030528 3300005844 Bacteria 4542
72 Ga0075367_10759934 3300006178 Bacteria 617
73 Ga0075369_10007617 3300006186 Bacteria 4136
74 Ga0075366_10031053 3300006195 Bacteria 3143
75 Ga0075366_10191926 3300006195 Bacteria 1241
76 Ga0075366_11078929 3300006195 Bacteria 501
77 Ga0068865_100273499 3300006881 Bacteria 1342
78 Ga0097620_100007694 3300006931 Bacteria 10942
79 Ga0097620_100074716 3300006931 Bacteria 3428
80 Ga0097620_100198806 3300006931 Bacteria 2089
81 Ga0097620_102304606 3300006931 Bacteria 594
82 Ga0105250_10014477 3300009092 Bacteria 3241
83 Ga0105240_10105361 3300009093 Bacteria 3423
84 Ga0105240_11682467 3300009093 Bacteria 663
85 Ga0105247_10318460 3300009101 Bacteria 1084
86 Ga0105243_10708652 3300009148 Bacteria 982
87 Ga0105248_10031199 3300009177 Bacteria 5956
88 Ga0105248_10039633 3300009177 Bacteria 5279
89 Ga0105248_10066598 3300009177 Bacteria 4044
90 Ga0105248_10117460 3300009177 Bacteria 3000
91 Ga0105249_10001181 3300009553 Bacteria 23119
92 Ga0105239_11441154 3300010375 Bacteria 795
93 Ga0157327_1016883 3300012512 Bacteria 777
94 Ga0157373_10002645 3300013100 Bacteria 13586
95 Ga0157370_10129336 3300013104 Bacteria 2356
96 Ga0157369_10358236 3300013105 Bacteria 1515
97 Ga0157374_10216845 3300013296 Bacteria 1877
98 Ga0163162_10268722 3300013306 Bacteria 1837
99 Ga0163162_10487182 3300013306 Bacteria 1364
100 Ga0163162_10591445 3300013306 Bacteria 1236
101 Ga0157372_10356173 3300013307 Bacteria 1705
102 Ga0157372_12746740 3300013307 Bacteria 565
103 Ga0157375_10867734 3300013308 Bacteria 1048
104 Ga0163163_10018714 3300014325 Bacteria 6490
105 Ga0163163_10040269 3300014325 Bacteria 4563
106 Ga0163163_10226615 3300014325 Bacteria 1918
107 Ga0163163_11299881 3300014325 Bacteria 789
108 Ga0163163_11579633 3300014325 Bacteria 717
109 Ga0182008_10239445 3300014497 Bacteria 933
110 Ga0157379_10000909 3300014968 Bacteria 23893
111 Ga0157379_10024695 3300014968 Bacteria 5334
112 Ga0157379_11210715 3300014968 Bacteria 727
113 Ga0163161_11044212 3300017792 Bacteria 700
114 Ga0213876_10129239 3300021384 Bacteria 1342
115 Ga0209026_1000477 3300025250 Bacteria 30249
116 Ga0209148_1008328 3300025254 Bacteria 2090
117 Ga0209565_1000392 3300025263 Bacteria 36920
118 Ga0209673_1002199 3300025273 Bacteria 14296
119 Ga0209673_1057664 3300025273 Bacteria 988
120 Ga0209675_1005101 3300025291 Bacteria 5603
121 Ga0209676_1000031 3300025292 Bacteria 478976
122 Ga0209676_1000391 3300025292 Bacteria 80028
123 Ga0209564_1000667 3300025295 Bacteria 50734
124 Ga0209564_1024270 3300025295 Bacteria 2076
125 Ga0209564_1030590 3300025295 Bacteria 1665
126 Ga0209758_1006495 3300025297 Bacteria 8364
127 Ga0209758_1006985 3300025297 Bacteria 7860
128 Ga0209050_1001337 3300025298 Bacteria 27313
129 Ga0209050_1006784 3300025298 Bacteria 6674
130 Ga0209050_1033427 3300025298 Bacteria 1559
131 Ga0209256_1005130 3300025299 Bacteria 7751
132 Ga0209256_1007782 3300025299 Bacteria 5169
133 Ga0209256_1038409 3300025299 Bacteria 1241
134 Ga0209051_1004749 3300025303 Bacteria 8221
135 Ga0209257_1000264 3300025304 Bacteria 120518
136 Ga0209257_1000625 3300025304 Bacteria 56966
137 Ga0209257_1013303 3300025304 Bacteria 3680
138 Ga0207696_1011282 3300025711 Bacteria 3229
139 Ga0207680_10423623 3300025903 Bacteria 943
140 Ga0207705_10060478 3300025909 Bacteria 2736
141 Ga0207705_10706752 3300025909 Bacteria 783
142 Ga0207707_10025726 3300025912 Bacteria 5148
143 Ga0207695_10010898 3300025913 Bacteria 11064
144 Ga0207660_10112819 3300025917 Bacteria 2048
145 Ga0207652_10451550 3300025921 Bacteria 1159
146 Ga0207681_10058520 3300025923 Bacteria 2639
147 Ga0207681_10293852 3300025923 Bacteria 1283
148 Ga0207650_10000099 3300025925 Bacteria 113522
149 Ga0207650_10110396 3300025925 Bacteria 2128
150 Ga0207650_10249422 3300025925 Bacteria 1437
151 Ga0207644_10023439 3300025931 Bacteria 4228
152 Ga0207644_10071254 3300025931 Bacteria 2542
153 Ga0207644_11667993 3300025931 Bacteria 534
154 Ga0207690_10019805 3300025932 Bacteria 4148
155 Ga0207711_10002202 3300025941 Bacteria 17507
156 Ga0207711_10008270 3300025941 Bacteria 8709
157 Ga0207711_10010573 3300025941 Bacteria 7671
158 Ga0207711_10050004 3300025941 Bacteria 3579
159 Ga0207679_10025200 3300025945 Bacteria 4088
160 Ga0207667_10013885 3300025949 Bacteria 9202
161 Ga0207667_10102522 3300025949 Bacteria 2952
162 Ga0207712_10000810 3300025961 Bacteria 23035
163 Ga0207668_10000413 3300025972 Bacteria 26960
164 Ga0207668_10005338 3300025972 Bacteria 7560
165 Ga0207668_10009302 3300025972 Bacteria 5882
166 Ga0207658_10000106 3300025986 Bacteria 90920
167 Ga0207658_10069476 3300025986 Bacteria 2661
168 Ga0207658_10132060 3300025986 Bacteria 2007
169 Ga0207703_10000038 3300026035 Bacteria 175917
170 Ga0207703_10002283 3300026035 Bacteria 16717
171 Ga0207703_10083855 3300026035 Bacteria 2664
172 Ga0207703_10353006 3300026035 Bacteria 1354
173 Ga0207639_10149620 3300026041 Bacteria 1954
174 Ga0207678_10188423 3300026067 Bacteria 1762
175 Ga0207678_10302637 3300026067 Bacteria 1374
176 Ga0207702_10810582 3300026078 Bacteria 925
177 Ga0207702_11063394 3300026078 Bacteria 803
178 Ga0207702_11415675 3300026078 Bacteria 689
179 Ga0207641_10000012 3300026088 Bacteria 375486
180 Ga0207641_10002857 3300026088 Bacteria 15687
181 Ga0207641_10095223 3300026088 Bacteria 2613
182 Ga0207641_10213781 3300026088 Bacteria 1784
183 Ga0207641_10364529 3300026088 Bacteria 1380
184 Ga0207676_10000119 3300026095 Bacteria 69303
185 Ga0207676_10000610 3300026095 Bacteria 29371
186 Ga0207676_10756411 3300026095 Bacteria 945
187 Ga0207675_100139706 3300026118 Bacteria 2301
188 Ga0207675_100231530 3300026118 Bacteria 1783
189 Ga0207698_10747423 3300026142 Bacteria 977
190 Ga0268266_10004729 3300028379 Bacteria 12943
191 Ga0268266_10052251 3300028379 Bacteria 3509
192 Ga0268266_10144080 3300028379 Bacteria 2140
193 Ga0268266_10184589 3300028379 Bacteria 1901
194 Ga0268265_10003868 3300028380 Bacteria 10572
195 Ga0268265_10038332 3300028380 Bacteria 3525
196 Ga0268265_10041590 3300028380 Bacteria 3403
197 Ga0268264_10000059 3300028381 Bacteria 306927
198 Ga0268264_10034926 3300028381 Bacteria 4138
199 Ga0268264_10038712 3300028381 Bacteria 3937
200 Ga0307517_10012217 3300028786 Bacteria 11814
201 Ga0307517_10143126 3300028786 Bacteria 1670
202 Ga0307515_10184073 3300028794 Bacteria 2026
203 Ga0307515_10368791 3300028794 Bacteria 1073
204 Ga0265338_10050898 3300028800 Bacteria 3738
205 Ga0265338_10225573 3300028800 Bacteria 1397
206 Ga0265338_10434083 3300028800 Bacteria 932
207 Ga0265340_10023067 3300031247 Bacteria 3175
208 Ga0265327_10000166 3300031251 Bacteria 141539
209 Ga0265327_10000758 3300031251 Bacteria 50091
210 Ga0265327_10001144 3300031251 Bacteria 36241
211 Ga0307513_10025779 3300031456 Bacteria 6800
212 Ga0307513_10027970 3300031456 Bacteria 6461
213 Ga0307508_10288900 3300031616 Bacteria 1233
214 Ga0265314_10112022 3300031711 Bacteria 1732
215 Ga0307407_10093419 3300031903 Bacteria 1850
216 Ga0307409_100275011 3300031995 Bacteria 1553
217 Ga0307416_101898020 3300032002 Bacteria 699
218 Ga0307416_103166363 3300032002 Bacteria 551
219 Ga0307411_10309803 3300032005 Bacteria 1270
220 Ga0307510_10056604 3300033180 Bacteria 4080
221 Ga0373935_0103270 3300035692 Bacteria 1882
222 Ga0373937_0561592 3300036401 Bacteria 1084
223 Ga0373925_0050501 3300037068 Bacteria 3102
224 Ga0395899_0000100 3300037312 Bacteria 151710
225 Ga0395899_0136232 3300037312 Bacteria 1750
226 Ga0395900_0000009 3300037418 Bacteria 476249
227 Ga0395900_0029418 3300037418 Bacteria 5635
228 Ga0395900_0137456 3300037418 Bacteria 2504
229 Ga0395900_0660470 3300037418 Bacteria 981
230 Ga0395898_0101595 3300037466 Bacteria 2761
231 Ga0395898_0154842 3300037466 Bacteria 2192
232 Ga0395898_0294024 3300037466 Bacteria 1549
233 Ga0395905_0016592 3300037471 Bacteria 6999
234 Ga0395905_0086901 3300037471 Bacteria 2931
235 Ga0395905_0293926 3300037471 Bacteria 1511
236 Ga0436364_0700085 3300037853 Bacteria 2114
237 Ga0395901_0000014 3300038443 Bacteria 375100
238 Ga0395901_0627504 3300038443 Bacteria 1081
239 Ga0395901_0987737 3300038443 Bacteria 818
240 Ga0395901_1208540 3300038443 Bacteria 721
241 Ga0436365_0021072 3300039437 Bacteria 1155
242 Ga0436365_0946242 3300039437 Bacteria 671
243 Ga0436365_1139091 3300039437 Bacteria 1346
244 Ga0436360_1006068 3300039438 Bacteria 642
245 Ga0436360_1044028 3300039438 Bacteria 2640
246 Ga0439445_0124216 3300042004 Bacteria 742
247 Ga0439446_0016071 3300042156 Bacteria 2082
248 Ga0439435_0044745 3300042436 Bacteria 1249
249 Ga0439459_0005106 3300042438 Bacteria 2143
250 Ga0466969_0455558 3300044656 Bacteria 582
251 Ga0466965_0272799 3300044683 Bacteria 912
252 Ga0495627_000360 3300046453 Bacteria 42630
253 Ga0495590_0007815 3300046457 Bacteria 4104
254 Ga0495629_0074451 3300046459 Bacteria 2371
255 Ga0495638_0001615 3300046460 Bacteria 20105
256 Ga0495638_0011171 3300046460 Bacteria 6201
257 Ga0495638_0043980 3300046460 Bacteria 2815
258 Ga0495638_0046994 3300046460 Bacteria 2709
259 Ga0495650_0063483 3300046471 Bacteria 1472
260 Ga0495596_0418944 3300046500 Bacteria 522
261 Ga0495583_0017377 3300046506 Bacteria 3822
262 Ga0495606_0092220 3300046507 Bacteria 1861
263 Ga0495610_0001891 3300046512 Bacteria 18089
264 Ga0495610_0002172 3300046512 Bacteria 16661
265 Ga0495610_0096975 3300046512 Bacteria 1327
266 Ga0495616_0001376 3300046513 Bacteria 16933
267 Ga0495616_0101355 3300046513 Bacteria 1350
268 Ga0495616_0397914 3300046513 Bacteria 566
269 Ga0495620_0024475 3300046515 Bacteria 2871
270 Ga0495631_0004495 3300046518 Bacteria 7417
271 Ga0495631_0166869 3300046518 Bacteria 944
272 Ga0495631_0247393 3300046518 Bacteria 760
273 Ga0495632_0006957 3300046519 Bacteria 7178
274 Ga0495637_0014631 3300046520 Bacteria 3698
275 Ga0495643_0051866 3300046522 Bacteria 2205
276 Ga0495643_0146698 3300046522 Bacteria 1172
277 Ga0495648_0000724 3300046524 Bacteria 35198
278 Ga0495648_0059322 3300046524 Bacteria 2283
279 Ga0495654_0000109 3300046530 Bacteria 93356
280 Ga0495597_0012714 3300046542 Bacteria 4054
281 Ga0495597_0035166 3300046542 Bacteria 2261
282 Ga0495597_0049386 3300046542 Bacteria 1859
283 Ga0495597_0079256 3300046542 Bacteria 1407
284 Ga0495622_0009433 3300046557 Bacteria 4514
285 Ga0495622_0204119 3300046557 Bacteria 880
286 Ga0495633_0156162 3300046558 Bacteria 1053
287 Ga0495668_0000039 3300046616 Bacteria 231402
288 Ga0495668_0007592 3300046616 Bacteria 6917
289 Ga0495668_0008982 3300046616 Bacteria 6171
290 Ga0495668_0076912 3300046616 Bacteria 1832
291 Ga0495668_0087740 3300046616 Bacteria 1705
292 Ga0495668_0103975 3300046616 Bacteria 1554
293 Ga0495668_0109496 3300046616 Bacteria 1511
294 Ga0495668_0295823 3300046616 Bacteria 887
295 Ga0495611_0013778 3300046648 Bacteria 3447
296 Ga0495611_0192781 3300046648 Bacteria 951
297 Ga0495625_0000271 3300046660 Bacteria 80817
298 Ga0495625_0011581 3300046660 Bacteria 7178
299 Ga0495625_0025386 3300046660 Bacteria 4495
300 Ga0495625_0033287 3300046660 Bacteria 3813
301 Ga0495625_0119985 3300046660 Bacteria 1790
302 Ga0495635_0388780 3300046663 Bacteria 928
303 Ga0495658_0726525 3300046683 Bacteria 636
304 Ga0495613_0004569 3300046689 Bacteria 10382
305 Ga0495613_0499328 3300046689 Bacteria 819
306 Ga0495671_0141405 3300046692 Bacteria 1173
307 Ga0495589_0091238 3300046794 Bacteria 1479
308 Ga0495660_0006079 3300046810 Bacteria 7169
309 Ga0495660_0067514 3300046810 Bacteria 1904
310 Ga0495660_0126277 3300046810 Bacteria 1288
311 Ga0495581_0469195 3300047315 Bacteria 732
312 Ga0495672_0001875 3300047320 Bacteria 20021
313 Ga0495672_0041690 3300047320 Bacteria 2774
314 Ga0495687_127410 3300047443 Bacteria 907
315 Ga0495677_0147913 3300047445 Bacteria 904
316 Ga0495679_031945 3300047446 Bacteria 1694
317 Ga0495673_0000189 3300047469 Bacteria 99018
318 Ga0495673_0000296 3300047469 Bacteria 66691
319 Ga0495673_0005796 3300047469 Bacteria 7394
320 Ga0495681_0080598 3300047470 Bacteria 1454
321 Ga0495681_0186773 3300047470 Bacteria 848
322 Ga0495686_0001394 3300047472 Bacteria 26804
323 Ga0495686_0003688 3300047472 Bacteria 13088
324 Ga0495686_0051600 3300047472 Bacteria 2580
325 Ga0495686_0281928 3300047472 Bacteria 923
326 Ga0495593_0099419 3300047673 Bacteria 1493
327 Ga0495602_0113582 3300048088 Bacteria 2195
328 Ga0496100_0565828 3300048903 Bacteria 880
329 Ga0496100_0917034 3300048903 Bacteria 688
330 Ga0496101_0090971 3300048904 Bacteria 2270
331 Ga0496102_0233153 3300048905 Bacteria 1735
332 Ga0496106_0030438 3300048909 Bacteria 4025
333 Ga0496106_0786800 3300048909 Bacteria 755
334 Ga0496106_0944790 3300048909 Bacteria 680
335 Ga0496107_0000037 3300048910 Bacteria 78089
336 Ga0496114_1511939 3300048917 Bacteria 559
337 Ga0496115_0005281 3300048918 Bacteria 9392
338 Ga0496115_0090930 3300048918 Bacteria 2494
339 Ga0496115_0628815 3300048918 Bacteria 851
340 Ga0496116_0170323 3300048919 Bacteria 1181
341 Ga0496117_0093756 3300048920 Bacteria 1924
342 Ga0496118_0005891 3300048921 Bacteria 13725
343 Ga0496119_0023770 3300048922 Bacteria 4334
344 Ga0496121_0000009 3300048924 Bacteria 836971
345 Ga0496121_0028692 3300048924 Bacteria 5174
346 Ga0496121_0136551 3300048924 Bacteria 1826
347 Ga0496122_0189095 3300048925 Bacteria 1218
348 Ga0496123_0227607 3300048926 Bacteria 936
349 Ga0496123_0338563 3300048926 Bacteria 704
350 Ga0496124_0074078 3300048927 Bacteria 2815
351 Ga0496125_0068479 3300048928 Bacteria 2792
352 Ga0496126_0005629 3300048929 Bacteria 14247
353 Ga0495678_001148 3300049459 Bacteria 22016
354 Ga0495682_0120298 3300049460 Bacteria 940
355 Ga0501047_0001192 3300049581 Bacteria 25737
356 Ga0501047_0362060 3300049581 Bacteria 1286
357 Ga0501047_0624381 3300049581 Bacteria 898
358 Ga0501070_0328264 3300049586 Bacteria 1244
359 Ga0501035_0005859 3300049822 Bacteria 11581
360 Ga0501035_0188528 3300049822 Bacteria 1774
361 Ga0501044_0768810 3300049823 Bacteria 844
362 nmdc:mga0k408_40641_c1 3300050493 Bacteria 2677
363 nmdc:mga0k408_54130_c1 3300050493 Bacteria 2326
364 nmdc:mga0sz30_4746_c2 3300050516 Bacteria 3327
365 Ga0500635_0001089 3300053080 Bacteria 6493
366 Ga0500578_0000035 3300053086 Bacteria 136406
367 Ga0500578_0256426 3300053086 Bacteria 1052
368 Ga0500643_139230 3300053087 Bacteria 652
369 Ga0500644_0000341 3300053088 Bacteria 23674
370 Ga0500647_0003051 3300053091 Bacteria 6424
371 Ga0500651_0042521 3300053093 Bacteria 2863
372 Ga0500566_0023945 3300053094 Bacteria 3586
373 Ga0500641_0012436 3300053096 Bacteria 3108
374 Ga0500641_0029077 3300053096 Bacteria 2163
375 Ga0500650_0073471 3300053098 Bacteria 1599
376 Ga0500554_006594 3300053102 Bacteria 2615
377 Ga0500555_027703 3300053103 Bacteria 1616
378 Ga0500555_108149 3300053103 Bacteria 701
379 Ga0500556_0000111 3300053104 Bacteria 72589
380 Ga0500556_0061008 3300053104 Bacteria 1389
381 Ga0500562_000348 3300053108 Bacteria 11115
382 Ga0500562_005290 3300053108 Bacteria 3242
383 Ga0500562_009904 3300053108 Bacteria 2410
384 Ga0500562_013362 3300053108 Bacteria 2096
385 Ga0500569_001684 3300053109 Bacteria 4216
386 Ga0500572_028022 3300053111 Bacteria 1547
387 Ga0500595_003363 3300053119 Bacteria 7501
388 Ga0500597_291339 3300053120 Bacteria 654
389 Ga0500607_070336 3300053121 Bacteria 1809
390 Ga0500608_000163 3300053122 Bacteria 27612
391 Ga0500608_003023 3300053122 Bacteria 6225
392 Ga0500614_002328 3300053123 Bacteria 4254
393 Ga0500614_155478 3300053123 Bacteria 690
394 Ga0500618_000186 3300053125 Bacteria 51092
395 Ga0500642_0009190 3300053130 Bacteria 3418
396 Ga0500642_0044259 3300053130 Bacteria 1938
397 Ga0500642_0170143 3300053130 Bacteria 1020
398 Ga0500658_0011117 3300053134 Bacteria 3316
399 Ga0500559_0000035 3300053136 Bacteria 110851
400 Ga0500559_0000324 3300053136 Bacteria 36134
401 Ga0500559_0005509 3300053136 Bacteria 5821
402 Ga0500559_0024197 3300053136 Bacteria 2582
403 Ga0500559_0218873 3300053136 Bacteria 898
404 Ga0500561_0165084 3300053137 Bacteria 693
405 Ga0500564_000144 3300053138 Bacteria 18381
406 Ga0500577_0002627 3300053142 Bacteria 4602
407 Ga0500577_0277684 3300053142 Bacteria 730
408 Ga0500588_0053675 3300053146 Bacteria 1267
409 Ga0500603_034823 3300053150 Bacteria 1317
410 Ga0500616_0051455 3300053153 Bacteria 2170
411 Ga0500616_0075245 3300053153 Bacteria 1710
412 Ga0500616_0278750 3300053153 Bacteria 703
413 Ga0500619_012911 3300053154 Bacteria 2198
414 Ga0500619_141612 3300053154 Bacteria 819
415 Ga0500620_025304 3300053155 Bacteria 1825
416 Ga0500622_0000180 3300053156 Bacteria 68052
417 Ga0500622_0007585 3300053156 Bacteria 6145
418 Ga0500622_0013756 3300053156 Bacteria 4359
419 Ga0500627_0051577 3300053158 Bacteria 1794
420 Ga0500638_009580 3300053162 Bacteria 4199
421 Ga0500638_327036 3300053162 Bacteria 579
422 Ga0500639_116936 3300053163 Bacteria 1287
423 Ga0500639_198170 3300053163 Bacteria 866
424 Ga0500636_0014403 3300053177 Bacteria 4651
425 Ga0500636_0135965 3300053177 Bacteria 1365
426 Ga0500636_0470779 3300053177 Bacteria 562
427 Ga0500637_0032237 3300053178 Bacteria 2921
428 Ga0500637_0142924 3300053178 Bacteria 1384
429 Ga0500645_000433 3300053730 Bacteria 28666
430 Ga0500645_002551 3300053730 Bacteria 8022
431 Ga0500552_027863 3300053733 Bacteria 852
432 Ga0500596_002099 3300053735 Bacteria 3966
433 Ga0500661_042595 3300055283 Bacteria 805
434 2511122172 2510917020 Bacteria 5657507
435 2585149191 2582581279 Bacteria 4980720
436 2585155109 2582581280 Bacteria 5994497
437 2585199064 2582581293 Bacteria 5907401
438 2587916898 2585428106 Bacteria 5179711
439 2643750690 2643221545 Bacteria 5083237
440 2643782034 2643221552 Bacteria 5708754
441 2643926269 2643221583 Bacteria 5218014
442 2643927885 2643221584 Bacteria 5511711
443 2644225574 2643221640 Bacteria 5258820
444 2644234965 2643221642 Bacteria 5357871
445 2644509764 2643221691 Bacteria 5093099
446 2792462015 2791355048 Bacteria 5832535
447 2819535924 2818991435 Bacteria 5433759
448 2819646156 2818991454 Bacteria 5563326
449 2843748877 2843744320 Bacteria 5659202
450 2849563075 2849560528 Bacteria 5393480
451 2849578641 2849573788 Bacteria 5421256
452 2851153498 2851153111 Bacteria 5542585
453 2857507603 2857504554 Bacteria 5369913
454 2884964608 2884960567 Bacteria 5437054
455 2898333569 2898329390 Bacteria 5168154
456 2928535526 2928531327 Bacteria 5101314
457 Ga0213876_10182986
458 Ga0055537_1001849
459 Ga0055536_1039668
460 Ga0055536_1039936
461 Ga0055530_10005476
462 Ga0055530_10042110
463 Ga0055531_10006551
464 Ga0055531_10073415
465 Ga0065165_1000911
466 Ga0070658_10072478
467 Ga0070658_10176324
468 Ga0070676_10523096
469 Ga0070670_100000039
470 Ga0070670_100066765
471 Ga0070670_100099982
472 Ga0068868_100586243
473 Ga0070668_100001314
474 Ga0070668_100008342
475 Ga0070668_100092997
476 Ga0070669_100017499
477 Ga0070669_100111916
478 Ga0070671_100052127
479 Ga0070659_100019177
480 Ga0070667_100000164
481 Ga0070667_100008541
482 Ga0070667_100009378
483 Ga0070713_101800839
484 Ga0070663_100183025
485 Ga0070663_100743160
486 Ga0070679_101209787
487 Ga0068853_100242168
488 Ga0070672_100641328
489 Ga0070686_101031214
490 Ga0070665_100000489
491 Ga0070665_100046995
492 Ga0070665_100057710
493 Ga0070665_100747881
494 Ga0068855_100012184
495 Ga0068855_100135152
496 Ga0068855_100327404
497 Ga0068855_101045651
498 Ga0070664_100020803
499 Ga0068854_101017910
500 Ga0068852_100006205
501 Ga0068852_100944855
502 Ga0068859_100007694
503 Ga0068859_100074718
504 Ga0068859_100198810
505 Ga0068859_102304441
506 Ga0068864_100000068
507 Ga0068864_100000115
508 Ga0068864_100637010
509 Ga0068864_100825912
510 Ga0068861_100103396
511 Ga0068861_100460953
512 Ga0068861_101373609
513 Ga0068863_100000007
514 Ga0068863_100012835
515 Ga0068863_100015866
516 Ga0068863_100051273
517 Ga0068863_100348797
518 Ga0068858_100000031
519 Ga0068858_100002686
520 Ga0068858_100007071
521 Ga0068858_100217668
522 Ga0068860_100000625
523 Ga0068860_100026830
524 Ga0068860_100042258
525 Ga0068862_100001908
526 Ga0068862_100019762
527 Ga0068862_100030528
528 Ga0075367_10759934
529 Ga0075369_10007617
530 Ga0075366_10031053
531 Ga0075366_10191926
532 Ga0075366_11078929
533 Ga0068865_100273499
534 Ga0097620_100007694
535 Ga0097620_100074716
536 Ga0097620_100198806
537 Ga0097620_102304606
538 Ga0105250_10014477
539 Ga0105240_10105361
540 Ga0105240_11682467
541 Ga0105247_10318460
542 Ga0105243_10708652
543 Ga0105248_10031199
544 Ga0105248_10039633
545 Ga0105248_10066598
546 Ga0105248_10117460
547 Ga0105249_10001181
548 Ga0105239_11441154
549 Ga0157327_1016883
550 Ga0157373_10002645
551 Ga0157370_10129336
552 Ga0157369_10358236
553 Ga0157374_10216845
554 Ga0163162_10268722
555 Ga0163162_10487182
556 Ga0163162_10591445
557 Ga0157372_10356173
558 Ga0157372_12746740
559 Ga0157375_10867734
560 Ga0163163_10018714
561 Ga0163163_10040269
562 Ga0163163_10226615
563 Ga0163163_11299881
564 Ga0163163_11579633
565 Ga0182008_10239445
566 Ga0157379_10000909
567 Ga0157379_10024695
568 Ga0157379_11210715
569 Ga0163161_11044212
570 Ga0213876_10129239
571 Ga0209026_1000477
572 Ga0209148_1008328
573 Ga0209565_1000392
574 Ga0209673_1002199
575 Ga0209673_1057664
576 Ga0209675_1005101
577 Ga0209676_1000031
578 Ga0209676_1000391
579 Ga0209564_1000667
580 Ga0209564_1024270
581 Ga0209564_1030590
582 Ga0209758_1006495
583 Ga0209758_1006985
584 Ga0209050_1001337
585 Ga0209050_1006784
586 Ga0209050_1033427
587 Ga0209256_1005130
588 Ga0209256_1007782
589 Ga0209256_1038409
590 Ga0209051_1004749
591 Ga0209257_1000264
592 Ga0209257_1000625
593 Ga0209257_1013303
594 Ga0207696_1011282
595 Ga0207680_10423623
596 Ga0207705_10060478
597 Ga0207705_10706752
598 Ga0207707_10025726
599 Ga0207695_10010898
600 Ga0207660_10112819
601 Ga0207652_10451550
602 Ga0207681_10058520
603 Ga0207681_10293852
604 Ga0207650_10000099
605 Ga0207650_10110396
606 Ga0207650_10249422
607 Ga0207644_10023439
608 Ga0207644_10071254
609 Ga0207644_11667993
610 Ga0207690_10019805
611 Ga0207711_10002202
612 Ga0207711_10008270
613 Ga0207711_10010573
614 Ga0207711_10050004
615 Ga0207679_10025200
616 Ga0207667_10013885
617 Ga0207667_10102522
618 Ga0207712_10000810
619 Ga0207668_10000413
620 Ga0207668_10005338
621 Ga0207668_10009302
622 Ga0207658_10000106
623 Ga0207658_10069476
624 Ga0207658_10132060
625 Ga0207703_10000038
626 Ga0207703_10002283
627 Ga0207703_10083855
628 Ga0207703_10353006
629 Ga0207639_10149620
630 Ga0207678_10188423
631 Ga0207678_10302637
632 Ga0207702_10810582
633 Ga0207702_11063394
634 Ga0207702_11415675
635 Ga0207641_10000012
636 Ga0207641_10002857
637 Ga0207641_10095223
638 Ga0207641_10213781
639 Ga0207641_10364529
640 Ga0207676_10000119
641 Ga0207676_10000610
642 Ga0207676_10756411
643 Ga0207675_100139706
644 Ga0207675_100231530
645 Ga0207698_10747423
646 Ga0268266_10004729
647 Ga0268266_10052251
648 Ga0268266_10144080
649 Ga0268266_10184589
650 Ga0268265_10003868
651 Ga0268265_10038332
652 Ga0268265_10041590
653 Ga0268264_10000059
654 Ga0268264_10034926
655 Ga0268264_10038712
656 Ga0307517_10012217
657 Ga0307517_10143126
658 Ga0307515_10184073
659 Ga0307515_10368791
660 Ga0265338_10050898
661 Ga0265338_10225573
662 Ga0265338_10434083
663 Ga0265340_10023067
664 Ga0265327_10000166
665 Ga0265327_10000758
666 Ga0265327_10001144
667 Ga0307513_10025779
668 Ga0307513_10027970
669 Ga0307508_10288900
670 Ga0265314_10112022
671 Ga0307407_10093419
672 Ga0307409_100275011
673 Ga0307416_101898020
674 Ga0307416_103166363
675 Ga0307411_10309803
676 Ga0307510_10056604
677 Ga0373935_0103270
678 Ga0373937_0561592
679 Ga0373925_0050501
680 Ga0395899_0000100
681 Ga0395899_0136232
682 Ga0395900_0000009
683 Ga0395900_0029418
684 Ga0395900_0137456
685 Ga0395900_0660470
686 Ga0395898_0101595
687 Ga0395898_0154842
688 Ga0395898_0294024
689 Ga0395905_0016592
690 Ga0395905_0086901
691 Ga0395905_0293926
692 Ga0436364_0700085
693 Ga0395901_0000014
694 Ga0395901_0627504
695 Ga0395901_0987737
696 Ga0395901_1208540
697 Ga0436365_0021072
698 Ga0436365_0946242
699 Ga0436365_1139091
700 Ga0436360_1006068
701 Ga0436360_1044028
702 Ga0439445_0124216
703 Ga0439446_0016071
704 Ga0439435_0044745
705 Ga0439459_0005106
706 Ga0466969_0455558
707 Ga0466965_0272799
708 Ga0495627_000360
709 Ga0495590_0007815
710 Ga0495629_0074451
711 Ga0495638_0001615
712 Ga0495638_0011171
713 Ga0495638_0043980
714 Ga0495638_0046994
715 Ga0495650_0063483
716 Ga0495596_0418944
717 Ga0495583_0017377
718 Ga0495606_0092220
719 Ga0495610_0001891
720 Ga0495610_0002172
721 Ga0495610_0096975
722 Ga0495616_0001376
723 Ga0495616_0101355
724 Ga0495616_0397914
725 Ga0495620_0024475
726 Ga0495631_0004495
727 Ga0495631_0166869
728 Ga0495631_0247393
729 Ga0495632_0006957
730 Ga0495637_0014631
731 Ga0495643_0051866
732 Ga0495643_0146698
733 Ga0495648_0000724
734 Ga0495648_0059322
735 Ga0495654_0000109
736 Ga0495597_0012714
737 Ga0495597_0035166
738 Ga0495597_0049386
739 Ga0495597_0079256
740 Ga0495622_0009433
741 Ga0495622_0204119
742 Ga0495633_0156162
743 Ga0495668_0000039
744 Ga0495668_0007592
745 Ga0495668_0008982
746 Ga0495668_0076912
747 Ga0495668_0087740
748 Ga0495668_0103975
749 Ga0495668_0109496
750 Ga0495668_0295823
751 Ga0495611_0013778
752 Ga0495611_0192781
753 Ga0495625_0000271
754 Ga0495625_0011581
755 Ga0495625_0025386
756 Ga0495625_0033287
757 Ga0495625_0119985
758 Ga0495635_0388780
759 Ga0495658_0726525
760 Ga0495613_0004569
761 Ga0495613_0499328
762 Ga0495671_0141405
763 Ga0495589_0091238
764 Ga0495660_0006079
765 Ga0495660_0067514
766 Ga0495660_0126277
767 Ga0495581_0469195
768 Ga0495672_0001875
769 Ga0495672_0041690
770 Ga0495687_127410
771 Ga0495677_0147913
772 Ga0495679_031945
773 Ga0495673_0000189
774 Ga0495673_0000296
775 Ga0495673_0005796
776 Ga0495681_0080598
777 Ga0495681_0186773
778 Ga0495686_0001394
779 Ga0495686_0003688
780 Ga0495686_0051600
781 Ga0495686_0281928
782 Ga0495593_0099419
783 Ga0495602_0113582
784 Ga0496100_0565828
785 Ga0496100_0917034
786 Ga0496101_0090971
787 Ga0496102_0233153
788 Ga0496106_0030438
789 Ga0496106_0786800
790 Ga0496106_0944790
791 Ga0496107_0000037
792 Ga0496114_1511939
793 Ga0496115_0005281
794 Ga0496115_0090930
795 Ga0496115_0628815
796 Ga0496116_0170323
797 Ga0496117_0093756
798 Ga0496118_0005891
799 Ga0496119_0023770
800 Ga0496121_0000009
801 Ga0496121_0028692
802 Ga0496121_0136551
803 Ga0496122_0189095
804 Ga0496123_0227607
805 Ga0496123_0338563
806 Ga0496124_0074078
807 Ga0496125_0068479
808 Ga0496126_0005629
809 Ga0495678_001148
810 Ga0495682_0120298
811 Ga0501047_0001192
812 Ga0501047_0362060
813 Ga0501047_0624381
814 Ga0501070_0328264
815 Ga0501035_0005859
816 Ga0501035_0188528
817 Ga0501044_0768810
818 nmdc:mga0k408_40641_c1
819 nmdc:mga0k408_54130_c1
820 nmdc:mga0sz30_4746_c2
821 Ga0500635_0001089
822 Ga0500578_0000035
823 Ga0500578_0256426
824 Ga0500643_139230
825 Ga0500644_0000341
826 Ga0500647_0003051
827 Ga0500651_0042521
828 Ga0500566_0023945
829 Ga0500641_0012436
830 Ga0500641_0029077
831 Ga0500650_0073471
832 Ga0500554_006594
833 Ga0500555_027703
834 Ga0500555_108149
835 Ga0500556_0000111
836 Ga0500556_0061008
837 Ga0500562_000348
838 Ga0500562_005290
839 Ga0500562_009904
840 Ga0500562_013362
841 Ga0500569_001684
842 Ga0500572_028022
843 Ga0500595_003363
844 Ga0500597_291339
845 Ga0500607_070336
846 Ga0500608_000163
847 Ga0500608_003023
848 Ga0500614_002328
849 Ga0500614_155478
850 Ga0500618_000186
851 Ga0500642_0009190
852 Ga0500642_0044259
853 Ga0500642_0170143
854 Ga0500658_0011117
855 Ga0500559_0000035
856 Ga0500559_0000324
857 Ga0500559_0005509
858 Ga0500559_0024197
859 Ga0500559_0218873
860 Ga0500561_0165084
861 Ga0500564_000144
862 Ga0500577_0002627
863 Ga0500577_0277684
864 Ga0500588_0053675
865 Ga0500603_034823
866 Ga0500616_0051455
867 Ga0500616_0075245
868 Ga0500616_0278750
869 Ga0500619_012911
870 Ga0500619_141612
871 Ga0500620_025304
872 Ga0500622_0000180
873 Ga0500622_0007585
874 Ga0500622_0013756
875 Ga0500627_0051577
876 Ga0500638_009580
877 Ga0500638_327036
878 Ga0500639_116936
879 Ga0500639_198170
880 Ga0500636_0014403
881 Ga0500636_0135965
882 Ga0500636_0470779
883 Ga0500637_0032237
884 Ga0500637_0142924
885 Ga0500645_000433
886 Ga0500645_002551
887 Ga0500552_027863
888 Ga0500596_002099
889 Ga0500661_042595
890 2511122172
891 2585149191
892 2585155109
893 2585199064
894 2587916898
895 2643750690
896 2643782034
897 2643926269
898 2643927885
899 2644225574
900 2644234965
901 2644509764
902 2792462015
903 2819535924
904 2819646156
905 2843748877
906 2849563075
907 2849578641
908 2851153498
909 2857507603
910 2884964608
911 2898333569
912 2928535526

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01029

NusB

NusB family

41

176

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3imq-assembly1.cif.gz_A crystal structure of the nusb101-s10(delta loop) complex 0.9247 11 152
3d3c-assembly3.cif.gz_C structural and functional analysis of the e. coli nusb-s10 transcription antitermination complex. 0.9048 11 152
3imq-assembly1.cif.gz_A crystal structure of the nusb101-s10(delta loop) complex 0.867 11 152
3r2d-assembly1.cif.gz_A crystal structure of antitermination factors nusb and nuse in complex with dsrna 0.8625 7 150
1tzx-assembly2.cif.gz_B t. maritima nusb, p3221 0.8571 8 153
ID Description Score Start End Superfamily
af_P0A780_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.9093 6 152 1.10.940.10
af_Q2FY45_1_129_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.886 10 147 1.10.940.10
af_Q2FZ67_2_133_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8852 13 149 1.10.940.10
af_P9WGX3_13_148_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.884 7 149 1.10.940.10
af_P0A780_1_139_1.10.940.10 Mainly Alpha;Orthogonal Bundle;N-utilizing Substance Protein B Homolog; Chain A;NusB-like 0.8722 6 152 1.10.940.10
ID Description Score Start End GO Terms
AF-A0A2S5LQA4-F1-model_v4 Transcription antitermination factor NusB 0.964 58 152 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A2E5BLZ8-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9595 9 152 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A2H3NVV7-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9515 10 150 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A494TKY5-F1-model_v4 Transcription antitermination protein NusB (Antitermination factor NusB) 0.9494 9 152 GO:0003723
GO:0005829
GO:0006353
GO:0031564
AF-A0A436QL07-F1-model_v4 Transcription antitermination factor NusB 0.949 57 152 GO:0003723
GO:0005829
GO:0006353
GO:0031564

Map