F447799

General Info

Members Datasets Scaffolds Average Seq Length
456 199 912 155

Family's Representative Sequence

Representative Sequence 3300025940|Ga0207691_10042467|Ga0207691_100424674
Length 170
Sequence MIAQLVQGSADDLDAVMQVMTAAFPDRFGEAWTRSQCAGILPMTGVKLILAEDGDDKVVGFSLYRTITDDAELLLLAVDPDSQGKGIGRQLLSNFIEESRKQGASRIHLEVRDGNSAIEVYRAAGFDQVNRRRNYYRSRDGDSFDALTFVLSNEDWSTSILALYCRVHFK

Samples

Sample ID Description Type Environment
1 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
156 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
173 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
174 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
180 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
181 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
182 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
199 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.78
Metatranscriptomes 0.22
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.39
Rhizosphere 95.18
Stem 0
Stem Tuber 0
Unclassified 7.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207691_10042467 3300025940 Bacteria 4191
2 JGI24739J22299_10030108 3300001989 Bacteria 1883
3 JGI24739J22299_10039334 3300001989 Bacteria 1584
4 JGI24743J22301_10027434 3300001991 Bacteria 1111
5 JGI24744J21845_10000335 3300002077 Bacteria 7936
6 rootH1_10263190 3300003323 Bacteria 1478
7 rootH1_10304483 3300003323 Bacteria 1184
8 Ga0065712_10010008 3300005290 Bacteria 2167
9 Ga0065715_10036286 3300005293 Bacteria 1976
10 Ga0065715_10209356 3300005293 Bacteria 1321
11 Ga0070658_10005539 3300005327 Bacteria 10247
12 Ga0070658_10012328 3300005327 Bacteria 6864
13 Ga0070658_10075412 3300005327 Bacteria 2766
14 Ga0070658_10225022 3300005327 Bacteria 1587
15 Ga0070658_10623174 3300005327 Unclassified 935
16 Ga0070658_10645631 3300005327 Bacteria 918
17 Ga0070658_10716540 3300005327 Bacteria 869
18 Ga0070676_10019947 3300005328 Bacteria 3735
19 Ga0070676_10165891 3300005328 Bacteria 1425
20 Ga0070683_100078711 3300005329 Bacteria 3084
21 Ga0070683_100498591 3300005329 Bacteria 1163
22 Ga0070690_100019496 3300005330 Bacteria 4118
23 Ga0070690_100163700 3300005330 Bacteria 1526
24 Ga0070690_100314336 3300005330 Bacteria 1127
25 Ga0070670_100204288 3300005331 Bacteria 1717
26 Ga0070670_100221014 3300005331 Bacteria 1648
27 Ga0070670_100550306 3300005331 Bacteria 1029
28 Ga0070677_10119412 3300005333 Bacteria 1189
29 Ga0070666_10000415 3300005335 Bacteria 26514
30 Ga0070666_10003290 3300005335 Bacteria 9807
31 Ga0070666_10010540 3300005335 Bacteria 5782
32 Ga0070680_100165817 3300005336 Bacteria 1857
33 Ga0070680_100937036 3300005336 Bacteria 747
34 Ga0070682_100471475 3300005337 Bacteria 966
35 Ga0068868_100000422 3300005338 Bacteria 28550
36 Ga0068868_100001497 3300005338 Bacteria 16125
37 Ga0068868_100227378 3300005338 Bacteria 1564
38 Ga0068868_100505509 3300005338 Bacteria 1059
39 Ga0070660_100013767 3300005339 Bacteria 5818
40 Ga0070660_100022407 3300005339 Bacteria 4671
41 Ga0070660_100032905 3300005339 Bacteria 3905
42 Ga0070660_100034524 3300005339 Bacteria 3822
43 Ga0070660_100257456 3300005339 Bacteria 1424
44 Ga0070660_100418316 3300005339 Bacteria 1109
45 Ga0070687_100043045 3300005343 Bacteria 2292
46 Ga0070661_100009699 3300005344 Bacteria 6678
47 Ga0070661_100037907 3300005344 Bacteria 3508
48 Ga0070661_100093310 3300005344 Bacteria 2230
49 Ga0070661_100108799 3300005344 Bacteria 2068
50 Ga0070661_100167077 3300005344 Bacteria 1669
51 Ga0070661_100453362 3300005344 Bacteria 1021
52 Ga0070692_10033761 3300005345 Bacteria 2579
53 Ga0070668_100049354 3300005347 Bacteria 3238
54 Ga0070668_100677296 3300005347 Unclassified 908
55 Ga0070669_100046325 3300005353 Bacteria 3171
56 Ga0070669_100164242 3300005353 Bacteria 1727
57 Ga0070675_100023540 3300005354 Bacteria 4926
58 Ga0070675_100062506 3300005354 Bacteria 3076
59 Ga0070675_100069765 3300005354 Bacteria 2912
60 Ga0070671_100000793 3300005355 Bacteria 22759
61 Ga0070671_100006203 3300005355 Bacteria 9525
62 Ga0070671_100007657 3300005355 Bacteria 8634
63 Ga0070671_100366997 3300005355 Unclassified 1229
64 Ga0070674_100001248 3300005356 Bacteria 13383
65 Ga0070674_100004983 3300005356 Bacteria 7614
66 Ga0070674_100006134 3300005356 Bacteria 6988
67 Ga0070674_100079168 3300005356 Bacteria 2344
68 Ga0070673_100002090 3300005364 Bacteria 12058
69 Ga0070673_100003531 3300005364 Bacteria 9752
70 Ga0070673_100005150 3300005364 Bacteria 8339
71 Ga0070673_100050944 3300005364 Bacteria 3240
72 Ga0070673_100133280 3300005364 Bacteria 2088
73 Ga0070688_100255611 3300005365 Bacteria 1249
74 Ga0070659_100018789 3300005366 Bacteria 5218
75 Ga0070659_100023685 3300005366 Bacteria 4701
76 Ga0070659_100074043 3300005366 Bacteria 2712
77 Ga0070659_100094063 3300005366 Bacteria 2406
78 Ga0070659_100117176 3300005366 Bacteria 2154
79 Ga0070659_100372066 3300005366 Unclassified 1202
80 Ga0070659_100435746 3300005366 Bacteria 1110
81 Ga0070659_100558852 3300005366 Bacteria 980
82 Ga0070667_100000839 3300005367 Bacteria 28510
83 Ga0070709_10030762 3300005434 Bacteria 3224
84 Ga0070714_100027087 3300005435 Bacteria 4743
85 Ga0070714_100066060 3300005435 Bacteria 3117
86 Ga0070714_100067014 3300005435 Bacteria 3094
87 Ga0070713_100028174 3300005436 Bacteria 4433
88 Ga0070663_100037039 3300005455 Bacteria 3393
89 Ga0070663_100121445 3300005455 Bacteria 1974
90 Ga0070663_100223860 3300005455 Bacteria 1478
91 Ga0070663_100552773 3300005455 Unclassified 962
92 Ga0070678_100005013 3300005456 Bacteria 7591
93 Ga0070678_100011240 3300005456 Bacteria 5513
94 Ga0070678_100020268 3300005456 Bacteria 4359
95 Ga0070662_100002632 3300005457 Bacteria 11074
96 Ga0070662_100045199 3300005457 Bacteria 3158
97 Ga0070662_100068146 3300005457 Bacteria 2615
98 Ga0070662_100164318 3300005457 Bacteria 1738
99 Ga0070662_100329019 3300005457 Bacteria 1248
100 Ga0070681_10096572 3300005458 Bacteria 2903
101 Ga0070681_10179608 3300005458 Bacteria 2038
102 Ga0070681_10395603 3300005458 Bacteria 1293
103 Ga0068867_100006361 3300005459 Bacteria 8348
104 Ga0068867_100163194 3300005459 Bacteria 1758
105 Ga0070679_100679176 3300005530 Bacteria 972
106 Ga0070679_101122968 3300005530 Bacteria 731
107 Ga0070679_101180383 3300005530 Bacteria 710
108 Ga0068853_100079395 3300005539 Bacteria 2869
109 Ga0068853_100086205 3300005539 Bacteria 2753
110 Ga0070672_100006621 3300005543 Bacteria 7802
111 Ga0070672_100101673 3300005543 Bacteria 2332
112 Ga0070672_100166087 3300005543 Bacteria 1833
113 Ga0070672_100488304 3300005543 Bacteria 1064
114 Ga0070686_100028133 3300005544 Bacteria 3407
115 Ga0070695_100687283 3300005545 Bacteria 811
116 Ga0070696_100149697 3300005546 Bacteria 1712
117 Ga0070693_100001691 3300005547 Bacteria 10011
118 Ga0070665_100006465 3300005548 Bacteria 11928
119 Ga0070665_100016126 3300005548 Bacteria 7498
120 Ga0070665_100910727 3300005548 Unclassified 892
121 Ga0068855_100298497 3300005563 Bacteria 1784
122 Ga0068855_100715327 3300005563 Bacteria 1070
123 Ga0068855_100756852 3300005563 Bacteria 1035
124 Ga0068855_100873648 3300005563 Unclassified 951
125 Ga0070664_100007622 3300005564 Bacteria 8740
126 Ga0070664_100017531 3300005564 Bacteria 5882
127 Ga0070664_100031963 3300005564 Bacteria 4402
128 Ga0070664_100032733 3300005564 Bacteria 4349
129 Ga0070664_100126690 3300005564 Bacteria 2241
130 Ga0068857_100155923 3300005577 Bacteria 2070
131 Ga0068854_100019849 3300005578 Bacteria 4536
132 Ga0068854_100135698 3300005578 Bacteria 1883
133 Ga0068854_100154675 3300005578 Bacteria 1771
134 Ga0068854_100285959 3300005578 Bacteria 1329
135 Ga0068854_100361187 3300005578 Bacteria 1191
136 Ga0068856_100039322 3300005614 Bacteria 4644
137 Ga0068856_100189827 3300005614 Bacteria 2068
138 Ga0070702_100084843 3300005615 Bacteria 1906
139 Ga0070702_100520110 3300005615 Bacteria 877
140 Ga0068852_100004886 3300005616 Bacteria 9519
141 Ga0068852_100088726 3300005616 Bacteria 2762
142 Ga0068852_100308007 3300005616 Bacteria 1535
143 Ga0068852_100626937 3300005616 Unclassified 1081
144 Ga0068852_100737599 3300005616 Unclassified 997
145 Ga0068859_100017599 3300005617 Bacteria 7185
146 Ga0068864_100088193 3300005618 Bacteria 2732
147 Ga0068864_100814717 3300005618 Bacteria 918
148 Ga0068866_10018283 3300005718 Bacteria 3167
149 Ga0068861_100398719 3300005719 Unclassified 1220
150 Ga0068851_10006186 3300005834 Bacteria 5464
151 Ga0068851_10169758 3300005834 Unclassified 1203
152 Ga0068870_10015557 3300005840 Bacteria 3613
153 Ga0068870_10133983 3300005840 Bacteria 1442
154 Ga0068863_100709362 3300005841 Bacteria 1000
155 Ga0068858_100002249 3300005842 Bacteria 19508
156 Ga0068860_100092570 3300005843 Bacteria 2881
157 Ga0068860_100321821 3300005843 Bacteria 1518
158 Ga0068860_100504794 3300005843 Bacteria 1208
159 Ga0070717_10178803 3300006028 Bacteria 1848
160 Ga0070716_100431786 3300006173 Bacteria 955
161 Ga0070712_100055046 3300006175 Bacteria 2784
162 Ga0097621_100473082 3300006237 Bacteria 1132
163 Ga0075428_100067140 3300006844 Bacteria 3926
164 Ga0075429_100396133 3300006880 Bacteria 1209
165 Ga0068865_100006686 3300006881 Bacteria 7052
166 Ga0068865_100096480 3300006881 Bacteria 2156
167 Ga0068865_100370204 3300006881 Bacteria 1166
168 Ga0097620_100017600 3300006931 Bacteria 7185
169 Ga0105240_10070774 3300009093 Bacteria 4314
170 Ga0105240_10182065 3300009093 Bacteria 2479
171 Ga0105240_10527381 3300009093 Bacteria 1310
172 Ga0105245_10010546 3300009098 Bacteria 8041
173 Ga0105245_10127530 3300009098 Bacteria 2383
174 Ga0105245_10136962 3300009098 Bacteria 2302
175 Ga0105247_10063947 3300009101 Bacteria 2285
176 Ga0114129_10150002 3300009147 Bacteria 3191
177 Ga0105243_10023919 3300009148 Bacteria 4655
178 Ga0105243_10274823 3300009148 Bacteria 1515
179 Ga0105242_10009591 3300009176 Bacteria 7420
180 Ga0105248_10001057 3300009177 Bacteria 30519
181 Ga0105248_10038332 3300009177 Bacteria 5363
182 Ga0105248_10088941 3300009177 Bacteria 3476
183 Ga0105248_10438558 3300009177 Bacteria 1471
184 Ga0105238_10016671 3300009551 Bacteria 7443
185 Ga0105239_10191836 3300010375 Bacteria 2287
186 Ga0157373_10048666 3300013100 Bacteria 3022
187 Ga0157373_10055204 3300013100 Bacteria 2822
188 Ga0157373_10145672 3300013100 Bacteria 1666
189 Ga0157373_10163093 3300013100 Bacteria 1568
190 Ga0157373_10173697 3300013100 Bacteria 1516
191 Ga0157373_10376694 3300013100 Bacteria 1015
192 Ga0157371_10024770 3300013102 Bacteria 4379
193 Ga0157371_10034279 3300013102 Bacteria 3642
194 Ga0157371_10071430 3300013102 Bacteria 2457
195 Ga0157371_10195186 3300013102 Bacteria 1450
196 Ga0157371_10283381 3300013102 Bacteria 1197
197 Ga0157369_10065683 3300013105 Bacteria 3904
198 Ga0157369_10188149 3300013105 Bacteria 2170
199 Ga0157369_10475901 3300013105 Bacteria 1293
200 Ga0157369_10524984 3300013105 Unclassified 1225
201 Ga0157374_10005380 3300013296 Bacteria 10755
202 Ga0157374_10012445 3300013296 Bacteria 7402
203 Ga0157374_10022956 3300013296 Bacteria 5572
204 Ga0157374_10295539 3300013296 Bacteria 1602
205 Ga0157374_10322722 3300013296 Bacteria 1530
206 Ga0157374_10826642 3300013296 Bacteria 943
207 Ga0157378_10012580 3300013297 Bacteria 7408
208 Ga0157378_10031417 3300013297 Bacteria 4691
209 Ga0163162_10020561 3300013306 Bacteria 6485
210 Ga0163162_10055919 3300013306 Bacteria 3974
211 Ga0157372_10221082 3300013307 Bacteria 2195
212 Ga0157372_10309027 3300013307 Bacteria 1840
213 Ga0157372_10440168 3300013307 Bacteria 1519
214 Ga0157375_10009954 3300013308 Bacteria 8358
215 Ga0157375_10044591 3300013308 Bacteria 4310
216 Ga0157375_10201961 3300013308 Bacteria 2144
217 Ga0163163_10058270 3300014325 Bacteria 3819
218 Ga0157380_10266337 3300014326 Bacteria 1559
219 Ga0157377_10026060 3300014745 Bacteria 3125
220 Ga0157377_10032443 3300014745 Bacteria 2844
221 Ga0157379_10010521 3300014968 Bacteria 8064
222 Ga0157376_10035069 3300014969 Bacteria 4056
223 Ga0157376_10100365 3300014969 Bacteria 2527
224 Ga0157376_10679564 3300014969 Bacteria 1033
225 Ga0206356_11084597 3300020070 Bacteria 795
226 Ga0207697_10001678 3300025315 Bacteria 11951
227 Ga0207697_10038057 3300025315 Bacteria 1972
228 Ga0207697_10040718 3300025315 Bacteria 1907
229 Ga0207656_10399213 3300025321 Unclassified 691
230 Ga0207682_10006519 3300025893 Bacteria 4694
231 Ga0207642_10035023 3300025899 Bacteria 2140
232 Ga0207688_10027018 3300025901 Bacteria 3157
233 Ga0207680_10001306 3300025903 Bacteria 11767
234 Ga0207680_10001418 3300025903 Bacteria 11355
235 Ga0207647_10003162 3300025904 Bacteria 12354
236 Ga0207647_10006862 3300025904 Bacteria 8258
237 Ga0207699_10171065 3300025906 Bacteria 1453
238 Ga0207645_10026652 3300025907 Bacteria 3734
239 Ga0207645_10300722 3300025907 Bacteria 1068
240 Ga0207643_10077374 3300025908 Bacteria 1923
241 Ga0207643_10091137 3300025908 Bacteria 1777
242 Ga0207705_10028881 3300025909 Bacteria 3953
243 Ga0207705_10047893 3300025909 Bacteria 3074
244 Ga0207707_10183265 3300025912 Bacteria 1828
245 Ga0207707_10627877 3300025912 Bacteria 907
246 Ga0207695_10019656 3300025913 Bacteria 7769
247 Ga0207693_10165055 3300025915 Bacteria 1743
248 Ga0207660_10200180 3300025917 Bacteria 1559
249 Ga0207660_11005605 3300025917 Bacteria 680
250 Ga0207662_10033128 3300025918 Bacteria 3009
251 Ga0207657_10004412 3300025919 Bacteria 14886
252 Ga0207657_10006116 3300025919 Bacteria 12512
253 Ga0207657_10021157 3300025919 Bacteria 6129
254 Ga0207657_10098195 3300025919 Bacteria 2434
255 Ga0207657_10299326 3300025919 Bacteria 1274
256 Ga0207649_10027651 3300025920 Bacteria 3331
257 Ga0207649_10061891 3300025920 Bacteria 2357
258 Ga0207649_10873356 3300025920 Bacteria 704
259 Ga0207652_10174624 3300025921 Bacteria 1929
260 Ga0207681_10879973 3300025923 Bacteria 750
261 Ga0207694_10039710 3300025924 Bacteria 3622
262 Ga0207650_10072856 3300025925 Bacteria 2586
263 Ga0207650_10159585 3300025925 Bacteria 1786
264 Ga0207650_10516713 3300025925 Unclassified 999
265 Ga0207659_10041504 3300025926 Bacteria 3222
266 Ga0207659_10247323 3300025926 Unclassified 1445
267 Ga0207687_10014749 3300025927 Bacteria 5117
268 Ga0207687_10085163 3300025927 Bacteria 2292
269 Ga0207687_10092622 3300025927 Bacteria 2207
270 Ga0207687_10176028 3300025927 Unclassified 1654
271 Ga0207700_10058255 3300025928 Bacteria 2917
272 Ga0207664_10068594 3300025929 Bacteria 2849
273 Ga0207644_10001055 3300025931 Bacteria 17632
274 Ga0207644_10001701 3300025931 Bacteria 14200
275 Ga0207644_10002053 3300025931 Bacteria 13049
276 Ga0207644_10309378 3300025931 Bacteria 1275
277 Ga0207690_10038177 3300025932 Bacteria 3124
278 Ga0207690_10040408 3300025932 Bacteria 3049
279 Ga0207690_10102076 3300025932 Bacteria 2050
280 Ga0207690_10127243 3300025932 Bacteria 1859
281 Ga0207690_10139699 3300025932 Bacteria 1783
282 Ga0207690_10311939 3300025932 Unclassified 1234
283 Ga0207690_10316521 3300025932 Bacteria 1225
284 Ga0207706_10002977 3300025933 Bacteria 16347
285 Ga0207706_10004662 3300025933 Bacteria 12849
286 Ga0207706_10013884 3300025933 Bacteria 7305
287 Ga0207706_10045079 3300025933 Bacteria 3908
288 Ga0207706_10060807 3300025933 Bacteria 3327
289 Ga0207706_10159919 3300025933 Bacteria 1980
290 Ga0207686_10004481 3300025934 Bacteria 7482
291 Ga0207709_10095048 3300025935 Bacteria 1957
292 Ga0207709_10175380 3300025935 Bacteria 1509
293 Ga0207670_10248749 3300025936 Bacteria 1373
294 Ga0207670_10543190 3300025936 Bacteria 949
295 Ga0207669_10002568 3300025937 Bacteria 7757
296 Ga0207669_10005160 3300025937 Bacteria 5826
297 Ga0207704_10024134 3300025938 Bacteria 3291
298 Ga0207704_10074184 3300025938 Bacteria 2170
299 Ga0207704_10083205 3300025938 Bacteria 2076
300 Ga0207665_10426074 3300025939 Bacteria 1014
301 Ga0207691_10002787 3300025940 Bacteria 17036
302 Ga0207691_10027583 3300025940 Bacteria 5324
303 Ga0207691_10043406 3300025940 Bacteria 4144
304 Ga0207691_10386554 3300025940 Bacteria 1194
305 Ga0207711_10000372 3300025941 Bacteria 47656
306 Ga0207711_10009940 3300025941 Bacteria 7910
307 Ga0207711_10323694 3300025941 Bacteria 1425
308 Ga0207689_10039666 3300025942 Bacteria 3898
309 Ga0207679_10206746 3300025945 Bacteria 1644
310 Ga0207667_10043092 3300025949 Bacteria 4790
311 Ga0207667_10241733 3300025949 Bacteria 1847
312 Ga0207667_10652051 3300025949 Unclassified 1058
313 Ga0207667_10695782 3300025949 Unclassified 1019
314 Ga0207651_10001542 3300025960 Bacteria 10516
315 Ga0207651_10019921 3300025960 Bacteria 4034
316 Ga0207651_10021384 3300025960 Bacteria 3931
317 Ga0207651_10033468 3300025960 Bacteria 3315
318 Ga0207651_10073751 3300025960 Bacteria 2428
319 Ga0207651_10410143 3300025960 Unclassified 1154
320 Ga0207668_10272421 3300025972 Unclassified 1384
321 Ga0207668_10290563 3300025972 Bacteria 1345
322 Ga0207668_10526178 3300025972 Bacteria 1021
323 Ga0207640_10021968 3300025981 Bacteria 3812
324 Ga0207640_10029477 3300025981 Bacteria 3369
325 Ga0207640_10665098 3300025981 Bacteria 889
326 Ga0207658_10001814 3300025986 Bacteria 15968
327 Ga0207658_10012694 3300025986 Bacteria 5753
328 Ga0207658_10384362 3300025986 Bacteria 1230
329 Ga0207677_10001036 3300026023 Bacteria 15297
330 Ga0207677_10003171 3300026023 Bacteria 8683
331 Ga0207677_10003995 3300026023 Bacteria 7868
332 Ga0207677_10007457 3300026023 Bacteria 6054
333 Ga0207677_10059125 3300026023 Bacteria 2642
334 Ga0207677_10618074 3300026023 Bacteria 953
335 Ga0207703_10001293 3300026035 Bacteria 23178
336 Ga0207703_10094024 3300026035 Bacteria 2526
337 Ga0207639_10464602 3300026041 Bacteria 1151
338 Ga0207639_10594174 3300026041 Bacteria 1020
339 Ga0207678_10006711 3300026067 Bacteria 10209
340 Ga0207702_10053883 3300026078 Bacteria 3406
341 Ga0207702_10130071 3300026078 Bacteria 2264
342 Ga0207648_10003806 3300026089 Bacteria 15770
343 Ga0207648_10010598 3300026089 Bacteria 8718
344 Ga0207676_10053689 3300026095 Bacteria 3154
345 Ga0207676_10956399 3300026095 Bacteria 842
346 Ga0207674_10739320 3300026116 Bacteria 949
347 Ga0207675_100083921 3300026118 Bacteria 2989
348 Ga0207683_10006388 3300026121 Bacteria 10095
349 Ga0207683_10011147 3300026121 Bacteria 7662
350 Ga0207683_10018134 3300026121 Bacteria 6003
351 Ga0207698_10262161 3300026142 Bacteria 1588
352 Ga0207698_10603901 3300026142 Unclassified 1082
353 Ga0268266_10044171 3300028379 Bacteria 3809
354 Ga0268266_10568149 3300028379 Bacteria 1088
355 Ga0268265_11533893 3300028380 Unclassified 670
356 Ga0268264_10418130 3300028381 Bacteria 1292
357 Ga0307410_10371931 3300031852 Bacteria 1147
358 Ga0307409_100034518 3300031995 Bacteria 3695
359 Ga0307414_10007260 3300032004 Bacteria 6225
360 Ga0307411_10047090 3300032005 Bacteria 2785
361 Ga0373938_0131098 3300034957 Bacteria 654
362 Ga0373944_0082755 3300035089 Bacteria 1062
363 Ga0373951_0190413 3300035091 Bacteria 593
364 Ga0373931_0105011 3300035691 Bacteria 1594
365 Ga0373931_0800774 3300035691 Unclassified 628
366 Ga0373935_0025493 3300035692 Bacteria 3644
367 Ga0373947_0185463 3300035725 Bacteria 1356
368 Ga0395899_0005782 3300037312 Bacteria 9597
369 Ga0395899_0014298 3300037312 Bacteria 6058
370 Ga0395899_0053690 3300037312 Bacteria 2982
371 Ga0395899_0099986 3300037312 Bacteria 2094
372 Ga0395899_0135333 3300037312 Bacteria 1757
373 Ga0395899_0350172 3300037312 Bacteria 988
374 Ga0395899_0436270 3300037312 Bacteria 860
375 Ga0395900_0013711 3300037418 Bacteria 8274
376 Ga0395900_0032868 3300037418 Bacteria 5336
377 Ga0395900_0036445 3300037418 Bacteria 5071
378 Ga0395900_0081187 3300037418 Bacteria 3331
379 Ga0395900_0144529 3300037418 Bacteria 2433
380 Ga0395900_0325865 3300037418 Bacteria 1515
381 Ga0395900_0351626 3300037418 Bacteria 1447
382 Ga0395900_0679169 3300037418 Bacteria 964
383 Ga0395900_0730860 3300037418 Unclassified 921
384 Ga0395900_1335752 3300037418 Unclassified 630
385 Ga0395898_0011825 3300037466 Bacteria 9044
386 Ga0395898_0208389 3300037466 Bacteria 1865
387 Ga0395898_0222017 3300037466 Bacteria 1802
388 Ga0395898_0466082 3300037466 Unclassified 1202
389 Ga0395898_0550673 3300037466 Bacteria 1096
390 Ga0395898_0695675 3300037466 Bacteria 958
391 Ga0395898_0775497 3300037466 Bacteria 899
392 Ga0395898_1224479 3300037466 Bacteria 681
393 Ga0395905_0008262 3300037471 Bacteria 10278
394 Ga0395905_0039430 3300037471 Bacteria 4432
395 Ga0395905_0048295 3300037471 Bacteria 3989
396 Ga0395905_0113719 3300037471 Bacteria 2543
397 Ga0395905_0245260 3300037471 Bacteria 1673
398 Ga0395905_1096081 3300037471 Bacteria 699
399 Ga0395901_0006861 3300038443 Bacteria 11503
400 Ga0395901_0041304 3300038443 Bacteria 4779
401 Ga0395901_0121458 3300038443 Bacteria 2745
402 Ga0395901_0303321 3300038443 Bacteria 1655
403 Ga0395901_0307931 3300038443 Bacteria 1641
404 Ga0395901_0501529 3300038443 Bacteria 1235
405 Ga0395901_0717559 3300038443 Unclassified 996
406 Ga0395901_1172576 3300038443 Unclassified 735
407 Ga0466969_0008227 3300044656 Bacteria 5533
408 Ga0466972_0055155 3300044658 Bacteria 1912
409 Ga0466966_0000939 3300044684 Bacteria 18614
410 Ga0466961_0014522 3300044693 Bacteria 5060
411 Ga0466963_0005605 3300044694 Bacteria 7364
412 Ga0466963_0092421 3300044694 Bacteria 2061
413 Ga0466963_0537233 3300044694 Unclassified 826
414 Ga0466971_0006574 3300044719 Bacteria 5052
415 Ga0466971_0021917 3300044719 Bacteria 2844
416 Ga0466970_0010157 3300044765 Bacteria 4771
417 Ga0466957_0001326 3300044842 Bacteria 12924
418 Ga0466957_0001949 3300044842 Bacteria 10963
419 Ga0466960_0657268 3300044901 Unclassified 626
420 Ga0466959_0009532 3300045049 Bacteria 6909
421 Ga0466959_0387610 3300045049 Bacteria 950
422 Ga0466958_0001249 3300045836 Bacteria 11903
423 Ga0466958_0004859 3300045836 Bacteria 7153
424 Ga0466967_0010261 3300045976 Bacteria 7011
425 Ga0466967_0681658 3300045976 Unclassified 1017
426 Ga0495621_0000607 3300046539 Bacteria 8971
427 Ga0495635_0293799 3300046663 Bacteria 1090
428 Ga0495669_0025601 3300046684 Bacteria 2573
429 Ga0495669_0052440 3300046684 Bacteria 1832
430 Ga0495670_0000431 3300046691 Bacteria 20088
431 Ga0495677_0073776 3300047445 Bacteria 1273
432 Ga0496101_0011745 3300048904 Bacteria 5822
433 Ga0496102_0105947 3300048905 Bacteria 2616
434 Ga0496102_0307119 3300048905 Bacteria 1495
435 Ga0496103_0324305 3300048906 Bacteria 990
436 Ga0496104_0085390 3300048907 Bacteria 3013
437 Ga0496106_0003210 3300048909 Bacteria 12244
438 Ga0496106_0489144 3300048909 Bacteria 988
439 Ga0496107_0001852 3300048910 Bacteria 13357
440 Ga0496107_0193485 3300048910 Bacteria 1511
441 Ga0496108_0000578 3300048911 Bacteria 28619
442 Ga0496109_0013232 3300048912 Bacteria 7144
443 Ga0496109_0567275 3300048912 Bacteria 1070
444 Ga0496110_0004837 3300048913 Bacteria 10498
445 Ga0496111_0000970 3300048914 Bacteria 15674
446 Ga0496111_0049549 3300048914 Bacteria 3029
447 Ga0496112_0071755 3300048915 Bacteria 3422
448 Ga0496112_0507389 3300048915 Bacteria 1141
449 Ga0496113_0000659 3300048916 Bacteria 17462
450 Ga0496114_0000006 3300048917 Bacteria 472921
451 Ga0496114_0040584 3300048917 Bacteria 3854
452 nmdc:mga05p37_645822_c1 3300050507 Bacteria 1186
453 nmdc:mga09592_405359_c1 3300050508 Bacteria 1178
454 Ga0501084_0784502 3300054114 Bacteria 803
455 Ga0466962_0036156 3300061719 Bacteria 2363
456 Ga0466962_0170875 3300061719 Bacteria 1058
457 Ga0207691_10042467
458 JGI24739J22299_10030108
459 JGI24739J22299_10039334
460 JGI24743J22301_10027434
461 JGI24744J21845_10000335
462 rootH1_10263190
463 rootH1_10304483
464 Ga0065712_10010008
465 Ga0065715_10036286
466 Ga0065715_10209356
467 Ga0070658_10005539
468 Ga0070658_10012328
469 Ga0070658_10075412
470 Ga0070658_10225022
471 Ga0070658_10623174
472 Ga0070658_10645631
473 Ga0070658_10716540
474 Ga0070676_10019947
475 Ga0070676_10165891
476 Ga0070683_100078711
477 Ga0070683_100498591
478 Ga0070690_100019496
479 Ga0070690_100163700
480 Ga0070690_100314336
481 Ga0070670_100204288
482 Ga0070670_100221014
483 Ga0070670_100550306
484 Ga0070677_10119412
485 Ga0070666_10000415
486 Ga0070666_10003290
487 Ga0070666_10010540
488 Ga0070680_100165817
489 Ga0070680_100937036
490 Ga0070682_100471475
491 Ga0068868_100000422
492 Ga0068868_100001497
493 Ga0068868_100227378
494 Ga0068868_100505509
495 Ga0070660_100013767
496 Ga0070660_100022407
497 Ga0070660_100032905
498 Ga0070660_100034524
499 Ga0070660_100257456
500 Ga0070660_100418316
501 Ga0070687_100043045
502 Ga0070661_100009699
503 Ga0070661_100037907
504 Ga0070661_100093310
505 Ga0070661_100108799
506 Ga0070661_100167077
507 Ga0070661_100453362
508 Ga0070692_10033761
509 Ga0070668_100049354
510 Ga0070668_100677296
511 Ga0070669_100046325
512 Ga0070669_100164242
513 Ga0070675_100023540
514 Ga0070675_100062506
515 Ga0070675_100069765
516 Ga0070671_100000793
517 Ga0070671_100006203
518 Ga0070671_100007657
519 Ga0070671_100366997
520 Ga0070674_100001248
521 Ga0070674_100004983
522 Ga0070674_100006134
523 Ga0070674_100079168
524 Ga0070673_100002090
525 Ga0070673_100003531
526 Ga0070673_100005150
527 Ga0070673_100050944
528 Ga0070673_100133280
529 Ga0070688_100255611
530 Ga0070659_100018789
531 Ga0070659_100023685
532 Ga0070659_100074043
533 Ga0070659_100094063
534 Ga0070659_100117176
535 Ga0070659_100372066
536 Ga0070659_100435746
537 Ga0070659_100558852
538 Ga0070667_100000839
539 Ga0070709_10030762
540 Ga0070714_100027087
541 Ga0070714_100066060
542 Ga0070714_100067014
543 Ga0070713_100028174
544 Ga0070663_100037039
545 Ga0070663_100121445
546 Ga0070663_100223860
547 Ga0070663_100552773
548 Ga0070678_100005013
549 Ga0070678_100011240
550 Ga0070678_100020268
551 Ga0070662_100002632
552 Ga0070662_100045199
553 Ga0070662_100068146
554 Ga0070662_100164318
555 Ga0070662_100329019
556 Ga0070681_10096572
557 Ga0070681_10179608
558 Ga0070681_10395603
559 Ga0068867_100006361
560 Ga0068867_100163194
561 Ga0070679_100679176
562 Ga0070679_101122968
563 Ga0070679_101180383
564 Ga0068853_100079395
565 Ga0068853_100086205
566 Ga0070672_100006621
567 Ga0070672_100101673
568 Ga0070672_100166087
569 Ga0070672_100488304
570 Ga0070686_100028133
571 Ga0070695_100687283
572 Ga0070696_100149697
573 Ga0070693_100001691
574 Ga0070665_100006465
575 Ga0070665_100016126
576 Ga0070665_100910727
577 Ga0068855_100298497
578 Ga0068855_100715327
579 Ga0068855_100756852
580 Ga0068855_100873648
581 Ga0070664_100007622
582 Ga0070664_100017531
583 Ga0070664_100031963
584 Ga0070664_100032733
585 Ga0070664_100126690
586 Ga0068857_100155923
587 Ga0068854_100019849
588 Ga0068854_100135698
589 Ga0068854_100154675
590 Ga0068854_100285959
591 Ga0068854_100361187
592 Ga0068856_100039322
593 Ga0068856_100189827
594 Ga0070702_100084843
595 Ga0070702_100520110
596 Ga0068852_100004886
597 Ga0068852_100088726
598 Ga0068852_100308007
599 Ga0068852_100626937
600 Ga0068852_100737599
601 Ga0068859_100017599
602 Ga0068864_100088193
603 Ga0068864_100814717
604 Ga0068866_10018283
605 Ga0068861_100398719
606 Ga0068851_10006186
607 Ga0068851_10169758
608 Ga0068870_10015557
609 Ga0068870_10133983
610 Ga0068863_100709362
611 Ga0068858_100002249
612 Ga0068860_100092570
613 Ga0068860_100321821
614 Ga0068860_100504794
615 Ga0070717_10178803
616 Ga0070716_100431786
617 Ga0070712_100055046
618 Ga0097621_100473082
619 Ga0075428_100067140
620 Ga0075429_100396133
621 Ga0068865_100006686
622 Ga0068865_100096480
623 Ga0068865_100370204
624 Ga0097620_100017600
625 Ga0105240_10070774
626 Ga0105240_10182065
627 Ga0105240_10527381
628 Ga0105245_10010546
629 Ga0105245_10127530
630 Ga0105245_10136962
631 Ga0105247_10063947
632 Ga0114129_10150002
633 Ga0105243_10023919
634 Ga0105243_10274823
635 Ga0105242_10009591
636 Ga0105248_10001057
637 Ga0105248_10038332
638 Ga0105248_10088941
639 Ga0105248_10438558
640 Ga0105238_10016671
641 Ga0105239_10191836
642 Ga0157373_10048666
643 Ga0157373_10055204
644 Ga0157373_10145672
645 Ga0157373_10163093
646 Ga0157373_10173697
647 Ga0157373_10376694
648 Ga0157371_10024770
649 Ga0157371_10034279
650 Ga0157371_10071430
651 Ga0157371_10195186
652 Ga0157371_10283381
653 Ga0157369_10065683
654 Ga0157369_10188149
655 Ga0157369_10475901
656 Ga0157369_10524984
657 Ga0157374_10005380
658 Ga0157374_10012445
659 Ga0157374_10022956
660 Ga0157374_10295539
661 Ga0157374_10322722
662 Ga0157374_10826642
663 Ga0157378_10012580
664 Ga0157378_10031417
665 Ga0163162_10020561
666 Ga0163162_10055919
667 Ga0157372_10221082
668 Ga0157372_10309027
669 Ga0157372_10440168
670 Ga0157375_10009954
671 Ga0157375_10044591
672 Ga0157375_10201961
673 Ga0163163_10058270
674 Ga0157380_10266337
675 Ga0157377_10026060
676 Ga0157377_10032443
677 Ga0157379_10010521
678 Ga0157376_10035069
679 Ga0157376_10100365
680 Ga0157376_10679564
681 Ga0206356_11084597
682 Ga0207697_10001678
683 Ga0207697_10038057
684 Ga0207697_10040718
685 Ga0207656_10399213
686 Ga0207682_10006519
687 Ga0207642_10035023
688 Ga0207688_10027018
689 Ga0207680_10001306
690 Ga0207680_10001418
691 Ga0207647_10003162
692 Ga0207647_10006862
693 Ga0207699_10171065
694 Ga0207645_10026652
695 Ga0207645_10300722
696 Ga0207643_10077374
697 Ga0207643_10091137
698 Ga0207705_10028881
699 Ga0207705_10047893
700 Ga0207707_10183265
701 Ga0207707_10627877
702 Ga0207695_10019656
703 Ga0207693_10165055
704 Ga0207660_10200180
705 Ga0207660_11005605
706 Ga0207662_10033128
707 Ga0207657_10004412
708 Ga0207657_10006116
709 Ga0207657_10021157
710 Ga0207657_10098195
711 Ga0207657_10299326
712 Ga0207649_10027651
713 Ga0207649_10061891
714 Ga0207649_10873356
715 Ga0207652_10174624
716 Ga0207681_10879973
717 Ga0207694_10039710
718 Ga0207650_10072856
719 Ga0207650_10159585
720 Ga0207650_10516713
721 Ga0207659_10041504
722 Ga0207659_10247323
723 Ga0207687_10014749
724 Ga0207687_10085163
725 Ga0207687_10092622
726 Ga0207687_10176028
727 Ga0207700_10058255
728 Ga0207664_10068594
729 Ga0207644_10001055
730 Ga0207644_10001701
731 Ga0207644_10002053
732 Ga0207644_10309378
733 Ga0207690_10038177
734 Ga0207690_10040408
735 Ga0207690_10102076
736 Ga0207690_10127243
737 Ga0207690_10139699
738 Ga0207690_10311939
739 Ga0207690_10316521
740 Ga0207706_10002977
741 Ga0207706_10004662
742 Ga0207706_10013884
743 Ga0207706_10045079
744 Ga0207706_10060807
745 Ga0207706_10159919
746 Ga0207686_10004481
747 Ga0207709_10095048
748 Ga0207709_10175380
749 Ga0207670_10248749
750 Ga0207670_10543190
751 Ga0207669_10002568
752 Ga0207669_10005160
753 Ga0207704_10024134
754 Ga0207704_10074184
755 Ga0207704_10083205
756 Ga0207665_10426074
757 Ga0207691_10002787
758 Ga0207691_10027583
759 Ga0207691_10043406
760 Ga0207691_10386554
761 Ga0207711_10000372
762 Ga0207711_10009940
763 Ga0207711_10323694
764 Ga0207689_10039666
765 Ga0207679_10206746
766 Ga0207667_10043092
767 Ga0207667_10241733
768 Ga0207667_10652051
769 Ga0207667_10695782
770 Ga0207651_10001542
771 Ga0207651_10019921
772 Ga0207651_10021384
773 Ga0207651_10033468
774 Ga0207651_10073751
775 Ga0207651_10410143
776 Ga0207668_10272421
777 Ga0207668_10290563
778 Ga0207668_10526178
779 Ga0207640_10021968
780 Ga0207640_10029477
781 Ga0207640_10665098
782 Ga0207658_10001814
783 Ga0207658_10012694
784 Ga0207658_10384362
785 Ga0207677_10001036
786 Ga0207677_10003171
787 Ga0207677_10003995
788 Ga0207677_10007457
789 Ga0207677_10059125
790 Ga0207677_10618074
791 Ga0207703_10001293
792 Ga0207703_10094024
793 Ga0207639_10464602
794 Ga0207639_10594174
795 Ga0207678_10006711
796 Ga0207702_10053883
797 Ga0207702_10130071
798 Ga0207648_10003806
799 Ga0207648_10010598
800 Ga0207676_10053689
801 Ga0207676_10956399
802 Ga0207674_10739320
803 Ga0207675_100083921
804 Ga0207683_10006388
805 Ga0207683_10011147
806 Ga0207683_10018134
807 Ga0207698_10262161
808 Ga0207698_10603901
809 Ga0268266_10044171
810 Ga0268266_10568149
811 Ga0268265_11533893
812 Ga0268264_10418130
813 Ga0307410_10371931
814 Ga0307409_100034518
815 Ga0307414_10007260
816 Ga0307411_10047090
817 Ga0373938_0131098
818 Ga0373944_0082755
819 Ga0373951_0190413
820 Ga0373931_0105011
821 Ga0373931_0800774
822 Ga0373935_0025493
823 Ga0373947_0185463
824 Ga0395899_0005782
825 Ga0395899_0014298
826 Ga0395899_0053690
827 Ga0395899_0099986
828 Ga0395899_0135333
829 Ga0395899_0350172
830 Ga0395899_0436270
831 Ga0395900_0013711
832 Ga0395900_0032868
833 Ga0395900_0036445
834 Ga0395900_0081187
835 Ga0395900_0144529
836 Ga0395900_0325865
837 Ga0395900_0351626
838 Ga0395900_0679169
839 Ga0395900_0730860
840 Ga0395900_1335752
841 Ga0395898_0011825
842 Ga0395898_0208389
843 Ga0395898_0222017
844 Ga0395898_0466082
845 Ga0395898_0550673
846 Ga0395898_0695675
847 Ga0395898_0775497
848 Ga0395898_1224479
849 Ga0395905_0008262
850 Ga0395905_0039430
851 Ga0395905_0048295
852 Ga0395905_0113719
853 Ga0395905_0245260
854 Ga0395905_1096081
855 Ga0395901_0006861
856 Ga0395901_0041304
857 Ga0395901_0121458
858 Ga0395901_0303321
859 Ga0395901_0307931
860 Ga0395901_0501529
861 Ga0395901_0717559
862 Ga0395901_1172576
863 Ga0466969_0008227
864 Ga0466972_0055155
865 Ga0466966_0000939
866 Ga0466961_0014522
867 Ga0466963_0005605
868 Ga0466963_0092421
869 Ga0466963_0537233
870 Ga0466971_0006574
871 Ga0466971_0021917
872 Ga0466970_0010157
873 Ga0466957_0001326
874 Ga0466957_0001949
875 Ga0466960_0657268
876 Ga0466959_0009532
877 Ga0466959_0387610
878 Ga0466958_0001249
879 Ga0466958_0004859
880 Ga0466967_0010261
881 Ga0466967_0681658
882 Ga0495621_0000607
883 Ga0495635_0293799
884 Ga0495669_0025601
885 Ga0495669_0052440
886 Ga0495670_0000431
887 Ga0495677_0073776
888 Ga0496101_0011745
889 Ga0496102_0105947
890 Ga0496102_0307119
891 Ga0496103_0324305
892 Ga0496104_0085390
893 Ga0496106_0003210
894 Ga0496106_0489144
895 Ga0496107_0001852
896 Ga0496107_0193485
897 Ga0496108_0000578
898 Ga0496109_0013232
899 Ga0496109_0567275
900 Ga0496110_0004837
901 Ga0496111_0000970
902 Ga0496111_0049549
903 Ga0496112_0071755
904 Ga0496112_0507389
905 Ga0496113_0000659
906 Ga0496114_0000006
907 Ga0496114_0040584
908 nmdc:mga05p37_645822_c1
909 nmdc:mga09592_405359_c1
910 Ga0501084_0784502
911 Ga0466962_0036156
912 Ga0466962_0170875

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08445

FR47

FR47-like protein

63

137

0.9

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

13

126

0.86

PF13673

Acetyltransf_10

Acetyltransferase (GNAT) domain

15

138

0.83

PF13508

Acetyltransf_7

Acetyltransferase (GNAT) domain

45

128

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
5isv-assembly2.cif.gz_B crystal structure of the ribosomal-protein-s18-alanine n-acetyltransferase from escherichia coli 0.9273 9 157
2cnt-assembly4.cif.gz_D rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with coenzymea. 0.9081 9 157
5kf1-assembly1.cif.gz_B x-ray structure of a glucosamine n-acetyltransferase from clostridium acetobutylicum, apo form, ph 5 0.8649 9 135
5kgh-assembly1.cif.gz_B x-ray structure of a glucosamine n-acetyltransferase from clostridium acetobutylicum, mutant y297f 0.8641 9 135
5kga-assembly1.cif.gz_B x-ray structure of a glucosamine n-acetyltransferase from clostridium acetobutylicum, mutant d287n, in complex with n-acetylglucosamine 0.864 9 135
ID Description Score Start End Superfamily
af_I1MSW7_129_252_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.943 74 134 3.40.630.30
2cntA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9077 9 157 3.40.630.30
af_A0A1D6QIS1_205_278_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8962 94 157 3.40.630.30
af_Q2FWL1_1_136_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8933 18 156 3.40.630.30
af_C7IYZ1_1_59_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.8902 109 157 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A6G7ZM18-F1-model_v4 GNAT family N-acetyltransferase 0.9746 8 157 GO:0016747
AF-A0A7W7AKH5-F1-model_v4 Ribosomal-protein-alanine N-acetyltransferase (EC 2.3.1.267) 0.9684 8 157 GO:0008999
AF-A0A430DSB9-F1-model_v4 [Ribosomal protein bS18]-alanine N-acetyltransferase (EC 2.3.1.266) 0.9683 8 156 GO:0005737
GO:0008999
AF-A0A3D0W8Y0-F1-model_v4 [Ribosomal protein bS18]-alanine N-acetyltransferase (EC 2.3.1.266) 0.9673 24 156 GO:0005737
GO:0008999
AF-A0A013VTF6-F1-model_v4 Ribosomal-protein-alanine acetyltransferase 0.9671 70 157 GO:0016747

Map