F447801

General Info

Members Datasets Scaffolds Average Seq Length
456 208 456 189

Family's Representative Sequence

Representative Sequence 3300026041|Ga0207639_11263496|Ga0207639_112634961
Length 175
Sequence MNIPYTIEERPDTGLTNGKLGIWLFLASEVMLFGALFSTYIILRVGAPEWPSVTMVMAWASLKLNDFGKHRMYLALTVALSVFFLINKYFEYAAHWAHGELPDKSTFLAIYFTLTGLHGLHILGGIVVMLYFLGPGAGLYKKSPEQFTNRIEYTGLYWHFVDLVWIFLFPVLYLL

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
141 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
142 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
143 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
147 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
148 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
151 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
164 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
165 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
166 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
167 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
168 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
171 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
190 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
191 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.61
Rhizosphere 95.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10068138 3300005290 Bacteria 14057
2 Ga0065712_10238358 3300005290 Bacteria 991
3 Ga0065715_10127942 3300005293 Bacteria 2076
4 Ga0065715_10349488 3300005293 Bacteria 953
5 Ga0065715_10481925 3300005293 Bacteria 794
6 Ga0065707_10018539 3300005295 Bacteria 2200
7 Ga0065707_10197348 3300005295 Bacteria 1328
8 Ga0065707_10202499 3300005295 Bacteria 1304
9 Ga0065707_10218237 3300005295 Bacteria 1236
10 Ga0065707_10253268 3300005295 Bacteria 1118
11 Ga0065707_10355005 3300005295 Bacteria 912
12 Ga0065707_10358328 3300005295 Bacteria 908
13 Ga0070676_10058633 3300005328 Bacteria 2282
14 Ga0070690_100163110 3300005330 Bacteria 1529
15 Ga0070690_100187289 3300005330 Bacteria 1433
16 Ga0070670_100047786 3300005331 Bacteria 3683
17 Ga0070666_10167721 3300005335 Bacteria 1537
18 Ga0070666_10216993 3300005335 Bacteria 1348
19 Ga0070666_10327178 3300005335 Bacteria 1094
20 Ga0068868_100548013 3300005338 Bacteria 1019
21 Ga0070691_10001728 3300005341 Bacteria 9485
22 Ga0070687_100033473 3300005343 Bacteria 2538
23 Ga0070661_100180735 3300005344 Bacteria 1605
24 Ga0070668_100086888 3300005347 Bacteria 2460
25 Ga0070668_100098733 3300005347 Bacteria 2311
26 Ga0070668_100983280 3300005347 Bacteria 758
27 Ga0070669_100053128 3300005353 Bacteria 2965
28 Ga0070669_100273405 3300005353 Bacteria 1352
29 Ga0070669_100305012 3300005353 Bacteria 1282
30 Ga0070675_100001537 3300005354 Bacteria 17074
31 Ga0070675_100150617 3300005354 Bacteria 1994
32 Ga0070674_100226570 3300005356 Bacteria 1457
33 Ga0070674_100740955 3300005356 Bacteria 844
34 Ga0070673_100071637 3300005364 Bacteria 2785
35 Ga0070673_100155466 3300005364 Bacteria 1941
36 Ga0070688_100197736 3300005365 Bacteria 1405
37 Ga0070667_100374434 3300005367 Bacteria 1292
38 Ga0070714_100016015 3300005435 Bacteria 6044
39 Ga0070713_100071573 3300005436 Bacteria 2930
40 Ga0070705_100016790 3300005440 Bacteria 3810
41 Ga0070705_100160351 3300005440 Bacteria 1503
42 Ga0070700_100010175 3300005441 Bacteria 5185
43 Ga0070700_100075101 3300005441 Bacteria 2167
44 Ga0070694_100002597 3300005444 Bacteria 10676
45 Ga0070694_100010066 3300005444 Bacteria 5815
46 Ga0070694_101158020 3300005444 Unclassified 647
47 Ga0070708_100064269 3300005445 Bacteria 3287
48 Ga0070708_100192176 3300005445 Bacteria 1909
49 Ga0070663_100739635 3300005455 Bacteria 839
50 Ga0070678_100062516 3300005456 Bacteria 2750
51 Ga0070678_100542369 3300005456 Bacteria 1031
52 Ga0070662_100854840 3300005457 Bacteria 775
53 Ga0070681_10123352 3300005458 Bacteria 2523
54 Ga0068867_100232644 3300005459 Bacteria 1490
55 Ga0068867_100361262 3300005459 Bacteria 1215
56 Ga0070685_10080661 3300005466 Bacteria 1950
57 Ga0070706_100274232 3300005467 Bacteria 1574
58 Ga0070698_100026990 3300005471 Bacteria 5972
59 Ga0070698_100810984 3300005471 Bacteria 880
60 Ga0070699_100102408 3300005518 Bacteria 2510
61 Ga0070699_100437654 3300005518 Bacteria 1185
62 Ga0070679_100015797 3300005530 Bacteria 7262
63 Ga0070679_100037637 3300005530 Bacteria 4807
64 Ga0070697_100030202 3300005536 Bacteria 4352
65 Ga0070697_100118603 3300005536 Bacteria 2211
66 Ga0070697_100296401 3300005536 Bacteria 1390
67 Ga0070672_100117000 3300005543 Bacteria 2178
68 Ga0070686_100002486 3300005544 Bacteria 10150
69 Ga0070695_100003699 3300005545 Bacteria 8913
70 Ga0070695_100013076 3300005545 Bacteria 4986
71 Ga0070695_100180733 3300005545 Bacteria 1494
72 Ga0070695_100552726 3300005545 Bacteria 898
73 Ga0070696_100059950 3300005546 Bacteria 2660
74 Ga0070693_100145854 3300005547 Bacteria 1495
75 Ga0070693_100302282 3300005547 Bacteria 1079
76 Ga0070665_100024772 3300005548 Bacteria 6045
77 Ga0070704_100010915 3300005549 Bacteria 5540
78 Ga0070704_100020400 3300005549 Bacteria 4272
79 Ga0070704_100421699 3300005549 Bacteria 1143
80 Ga0070704_100452722 3300005549 Bacteria 1105
81 Ga0068855_100331808 3300005563 Bacteria 1679
82 Ga0068854_100021646 3300005578 Bacteria 4365
83 Ga0070702_100001638 3300005615 Bacteria 9276
84 Ga0070702_100422269 3300005615 Bacteria 960
85 Ga0068852_100496899 3300005616 Bacteria 1214
86 Ga0068859_100116866 3300005617 Bacteria 2732
87 Ga0068859_100157505 3300005617 Bacteria 2349
88 Ga0068859_100341050 3300005617 Bacteria 1593
89 Ga0068859_100442464 3300005617 Bacteria 1396
90 Ga0068864_100076036 3300005618 Bacteria 2933
91 Ga0068866_10090411 3300005718 Bacteria 1666
92 Ga0068861_100930837 3300005719 Bacteria 825
93 Ga0068861_101185374 3300005719 Bacteria 738
94 Ga0068870_10088927 3300005840 Bacteria 1723
95 Ga0068863_100317690 3300005841 Bacteria 1512
96 Ga0068863_100518591 3300005841 Bacteria 1175
97 Ga0068858_100040173 3300005842 Bacteria 4337
98 Ga0068858_100426469 3300005842 Bacteria 1276
99 Ga0068858_100755110 3300005842 Bacteria 948
100 Ga0068860_100413546 3300005843 Bacteria 1336
101 Ga0068860_100557139 3300005843 Bacteria 1149
102 Ga0068862_100143380 3300005844 Bacteria 2121
103 Ga0081455_10307835 3300005937 Bacteria 1134
104 Ga0081539_10109090 3300005985 Bacteria 1397
105 Ga0070715_10133751 3300006163 Bacteria 1196
106 Ga0097621_100005116 3300006237 Bacteria 9213
107 Ga0097621_100156739 3300006237 Bacteria 1955
108 Ga0097621_101112596 3300006237 Bacteria 742
109 Ga0068871_100000337 3300006358 Bacteria 32470
110 Ga0068871_100043722 3300006358 Bacteria 3599
111 Ga0068871_100064303 3300006358 Bacteria 3004
112 Ga0068871_100310232 3300006358 Bacteria 1387
113 Ga0068871_100439195 3300006358 Bacteria 1168
114 Ga0075428_100116199 3300006844 Bacteria 2914
115 Ga0075428_100339739 3300006844 Bacteria 1613
116 Ga0075428_100965276 3300006844 Bacteria 903
117 Ga0075431_100247931 3300006847 Bacteria 1810
118 Ga0075433_10004207 3300006852 Bacteria 11171
119 Ga0075433_10067266 3300006852 Bacteria 3145
120 Ga0075433_10110067 3300006852 Bacteria 2444
121 Ga0075433_10130741 3300006852 Bacteria 2230
122 Ga0075433_10261212 3300006852 Unclassified 1535
123 Ga0075433_10335229 3300006852 Unclassified 1337
124 Ga0075433_10617715 3300006852 Bacteria 951
125 Ga0075434_100004066 3300006871 Bacteria 13112
126 Ga0075434_100021223 3300006871 Bacteria 6312
127 Ga0075434_100060975 3300006871 Bacteria 3752
128 Ga0075434_100092379 3300006871 Bacteria 3029
129 Ga0075434_100131782 3300006871 Bacteria 2519
130 Ga0075434_100136236 3300006871 Bacteria 2474
131 Ga0075434_100261210 3300006871 Bacteria 1750
132 Ga0075434_100291108 3300006871 Bacteria 1653
133 Ga0075429_100129856 3300006880 Bacteria 2204
134 Ga0075429_100240843 3300006880 Bacteria 1585
135 Ga0075436_100010393 3300006914 Bacteria 6379
136 Ga0075436_100010413 3300006914 Bacteria 6374
137 Ga0075436_100046055 3300006914 Bacteria 3008
138 Ga0075436_100104940 3300006914 Bacteria 1970
139 Ga0075436_100110552 3300006914 Bacteria 1918
140 Ga0075436_100189233 3300006914 Bacteria 1456
141 Ga0097620_100116871 3300006931 Bacteria 2732
142 Ga0097620_100157512 3300006931 Bacteria 2349
143 Ga0097620_100341035 3300006931 Bacteria 1593
144 Ga0097620_100442529 3300006931 Bacteria 1396
145 Ga0075435_100001499 3300007076 Bacteria 14991
146 Ga0075435_100011704 3300007076 Bacteria 6469
147 Ga0075435_100020280 3300007076 Bacteria 5090
148 Ga0075435_100022377 3300007076 Bacteria 4877
149 Ga0075435_100052494 3300007076 Bacteria 3286
150 Ga0075435_100053991 3300007076 Bacteria 3242
151 Ga0075435_100190312 3300007076 Bacteria 1737
152 Ga0075435_100199361 3300007076 Bacteria 1696
153 Ga0075435_100729463 3300007076 Bacteria 862
154 Ga0075435_100809915 3300007076 Bacteria 816
155 Ga0099794_10105575 3300007265 Bacteria 1409
156 Ga0099795_10090211 3300007788 Bacteria 1187
157 Ga0105240_10501759 3300009093 Bacteria 1349
158 Ga0105240_10648353 3300009093 Bacteria 1158
159 Ga0111539_10005974 3300009094 Bacteria 15726
160 Ga0111539_10013059 3300009094 Bacteria 10392
161 Ga0111539_10026076 3300009094 Bacteria 7155
162 Ga0111539_10235779 3300009094 Bacteria 2130
163 Ga0111539_10600332 3300009094 Bacteria 1282
164 Ga0111539_11464950 3300009094 Bacteria 792
165 Ga0105245_10008265 3300009098 Bacteria 9099
166 Ga0105245_10059584 3300009098 Bacteria 3438
167 Ga0105245_10608680 3300009098 Bacteria 1120
168 Ga0105245_11026038 3300009098 Bacteria 870
169 Ga0105247_10017382 3300009101 Bacteria 4319
170 Ga0105247_10072546 3300009101 Bacteria 2155
171 Ga0105247_10340909 3300009101 Bacteria 1051
172 Ga0114129_10001435 3300009147 Bacteria 32173
173 Ga0114129_10021065 3300009147 Bacteria 9258
174 Ga0114129_10022782 3300009147 Bacteria 8880
175 Ga0114129_10042408 3300009147 Bacteria 6408
176 Ga0114129_10045015 3300009147 Bacteria 6206
177 Ga0114129_10111924 3300009147 Bacteria 3766
178 Ga0114129_10113164 3300009147 Bacteria 3742
179 Ga0114129_10114829 3300009147 Bacteria 3712
180 Ga0114129_10133655 3300009147 Bacteria 3406
181 Ga0114129_10323649 3300009147 Bacteria 2049
182 Ga0114129_10501753 3300009147 Bacteria 1585
183 Ga0114129_10735970 3300009147 Bacteria 1264
184 Ga0105243_10009374 3300009148 Bacteria 7459
185 Ga0105243_10447806 3300009148 Bacteria 1211
186 Ga0105243_10504362 3300009148 Bacteria 1147
187 Ga0105243_10515006 3300009148 Bacteria 1136
188 Ga0105243_10660852 3300009148 Bacteria 1014
189 Ga0105243_10733078 3300009148 Bacteria 967
190 Ga0105241_10037687 3300009174 Bacteria 3642
191 Ga0105241_11316765 3300009174 Bacteria 689
192 Ga0105242_10848085 3300009176 Bacteria 909
193 Ga0105242_11176019 3300009176 Bacteria 785
194 Ga0105248_10024770 3300009177 Bacteria 6674
195 Ga0105248_10085283 3300009177 Bacteria 3554
196 Ga0105248_10089169 3300009177 Bacteria 3472
197 Ga0105248_10134937 3300009177 Bacteria 2784
198 Ga0105248_10855010 3300009177 Bacteria 1027
199 Ga0105248_10866317 3300009177 Bacteria 1020
200 Ga0105238_10392931 3300009551 Bacteria 1379
201 Ga0105249_10281932 3300009553 Bacteria 1660
202 Ga0157374_10260802 3300013296 Bacteria 1707
203 Ga0157378_10012898 3300013297 Bacteria 7317
204 Ga0157378_11719164 3300013297 Bacteria 675
205 Ga0157375_10524508 3300013308 Bacteria 1347
206 Ga0157375_10795803 3300013308 Bacteria 1094
207 Ga0163163_10029543 3300014325 Bacteria 5274
208 Ga0163163_11114005 3300014325 Bacteria 852
209 Ga0157380_10046940 3300014326 Bacteria 3394
210 Ga0157380_10114317 3300014326 Bacteria 2274
211 Ga0157380_10167118 3300014326 Bacteria 1918
212 Ga0157380_10467095 3300014326 Bacteria 1216
213 Ga0157380_10663393 3300014326 Bacteria 1042
214 Ga0157377_10348821 3300014745 Bacteria 992
215 Ga0157379_10043440 3300014968 Bacteria 4012
216 Ga0157379_10046157 3300014968 Bacteria 3888
217 Ga0157379_10299413 3300014968 Bacteria 1466
218 Ga0157379_10700037 3300014968 Bacteria 951
219 Ga0157376_10033860 3300014969 Bacteria 4118
220 Ga0157376_10104160 3300014969 Bacteria 2486
221 Ga0157376_10164451 3300014969 Bacteria 2015
222 Ga0157376_10166563 3300014969 Bacteria 2003
223 Ga0157376_10255235 3300014969 Bacteria 1640
224 Ga0157376_10879764 3300014969 Bacteria 913
225 Ga0163161_10338465 3300017792 Bacteria 1193
226 Ga0207682_10069088 3300025893 Bacteria 1493
227 Ga0207642_10231599 3300025899 Bacteria 1038
228 Ga0207710_10036292 3300025900 Bacteria 2172
229 Ga0207710_10124866 3300025900 Bacteria 1232
230 Ga0207680_10304915 3300025903 Bacteria 1111
231 Ga0207680_10391309 3300025903 Bacteria 981
232 Ga0207699_10195621 3300025906 Bacteria 1367
233 Ga0207699_10528987 3300025906 Bacteria 853
234 Ga0207645_10002542 3300025907 Bacteria 14280
235 Ga0207643_10206901 3300025908 Bacteria 1197
236 Ga0207643_10313121 3300025908 Bacteria 979
237 Ga0207654_10012257 3300025911 Bacteria 4389
238 Ga0207695_10389347 3300025913 Bacteria 1279
239 Ga0207695_10565257 3300025913 Bacteria 1019
240 Ga0207695_10661560 3300025913 Bacteria 925
241 Ga0207663_10181456 3300025916 Bacteria 1504
242 Ga0207663_10714100 3300025916 Bacteria 794
243 Ga0207662_10003313 3300025918 Bacteria 8263
244 Ga0207662_10427631 3300025918 Bacteria 902
245 Ga0207652_10041513 3300025921 Bacteria 3911
246 Ga0207652_10215250 3300025921 Bacteria 1730
247 Ga0207646_10328103 3300025922 Bacteria 1383
248 Ga0207681_10009213 3300025923 Bacteria 6033
249 Ga0207694_10205150 3300025924 Bacteria 1605
250 Ga0207650_10027153 3300025925 Bacteria 4094
251 Ga0207650_10397682 3300025925 Bacteria 1140
252 Ga0207659_10001294 3300025926 Bacteria 14955
253 Ga0207687_10005201 3300025927 Bacteria 8632
254 Ga0207687_10315362 3300025927 Bacteria 1264
255 Ga0207700_10015627 3300025928 Bacteria 5015
256 Ga0207664_10026169 3300025929 Bacteria 4406
257 Ga0207644_10856927 3300025931 Bacteria 761
258 Ga0207690_10540001 3300025932 Bacteria 947
259 Ga0207706_10130847 3300025933 Bacteria 2207
260 Ga0207706_10965241 3300025933 Bacteria 717
261 Ga0207686_10067071 3300025934 Bacteria 2294
262 Ga0207709_10087319 3300025935 Bacteria 2027
263 Ga0207709_10807372 3300025935 Bacteria 758
264 Ga0207709_11032921 3300025935 Bacteria 673
265 Ga0207670_10848985 3300025936 Bacteria 763
266 Ga0207691_10218420 3300025940 Bacteria 1654
267 Ga0207711_10040651 3300025941 Bacteria 3956
268 Ga0207711_10327526 3300025941 Bacteria 1416
269 Ga0207711_10343687 3300025941 Bacteria 1381
270 Ga0207711_10347297 3300025941 Bacteria 1374
271 Ga0207689_10178380 3300025942 Bacteria 1752
272 Ga0207689_10190367 3300025942 Bacteria 1693
273 Ga0207661_10830127 3300025944 Bacteria 851
274 Ga0207679_10219615 3300025945 Bacteria 1599
275 Ga0207667_10559530 3300025949 Bacteria 1156
276 Ga0207651_10045410 3300025960 Bacteria 2947
277 Ga0207651_10205573 3300025960 Bacteria 1581
278 Ga0207651_10718361 3300025960 Bacteria 881
279 Ga0207712_10168098 3300025961 Bacteria 1711
280 Ga0207712_10267499 3300025961 Bacteria 1389
281 Ga0207668_10176247 3300025972 Bacteria 1682
282 Ga0207668_10381742 3300025972 Bacteria 1186
283 Ga0207640_10015460 3300025981 Bacteria 4418
284 Ga0207658_10659131 3300025986 Bacteria 944
285 Ga0207677_10108020 3300026023 Bacteria 2065
286 Ga0207677_10134912 3300026023 Bacteria 1880
287 Ga0207677_10141395 3300026023 Bacteria 1843
288 Ga0207703_10002242 3300026035 Bacteria 16903
289 Ga0207703_10088300 3300026035 Bacteria 2602
290 Ga0207703_10236312 3300026035 Bacteria 1641
291 Ga0207639_10219335 3300026041 Bacteria 1642
292 Ga0207639_11263496 3300026041 Bacteria 693
293 Ga0207708_10016993 3300026075 Bacteria 5477
294 Ga0207708_10067854 3300026075 Bacteria 2729
295 Ga0207641_10150847 3300026088 Bacteria 2105
296 Ga0207641_10458969 3300026088 Bacteria 1232
297 Ga0207648_10014508 3300026089 Bacteria 7276
298 Ga0207648_10018889 3300026089 Bacteria 6227
299 Ga0207648_10214864 3300026089 Bacteria 1708
300 Ga0207648_11079430 3300026089 Bacteria 753
301 Ga0207675_100015362 3300026118 Bacteria 7141
302 Ga0207675_100070825 3300026118 Bacteria 3259
303 Ga0207675_100316772 3300026118 Bacteria 1522
304 Ga0207675_101078933 3300026118 Bacteria 822
305 Ga0207675_101129427 3300026118 Bacteria 804
306 Ga0207675_101291684 3300026118 Bacteria 750
307 Ga0207683_10067435 3300026121 Bacteria 3157
308 Ga0207683_10108486 3300026121 Bacteria 2484
309 Ga0207698_10687876 3300026142 Bacteria 1017
310 Ga0207428_10018632 3300027907 Bacteria 5926
311 Ga0207428_10020412 3300027907 Bacteria 5630
312 Ga0207428_10064026 3300027907 Bacteria 2904
313 Ga0268266_10057208 3300028379 Bacteria 3355
314 Ga0268264_10273484 3300028381 Bacteria 1579
315 Ga0268264_10702424 3300028381 Bacteria 1004
316 Ga0265332_10058879 3300031238 Bacteria 1644
317 Ga0265328_10127741 3300031239 Bacteria 950
318 Ga0265320_10076098 3300031240 Bacteria 1573
319 Ga0265314_10038728 3300031711 Bacteria 3442
320 Ga0307416_100352947 3300032002 Bacteria 1489
321 Ga0373936_0020647 3300035113 Bacteria 2560
322 Ga0373945_0013482 3300035116 Bacteria 2729
323 Ga0373945_0104709 3300035116 Bacteria 1111
324 Ga0373956_0005850 3300035119 Bacteria 4920
325 Ga0373956_0455920 3300035119 Bacteria 610
326 Ga0373957_0157043 3300035120 Bacteria 936
327 Ga0373943_0045540 3300035170 Bacteria 2138
328 Ga0373942_0004245 3300035207 Bacteria 3337
329 Ga0373924_0010839 3300035410 Bacteria 3373
330 Ga0373935_0122192 3300035692 Bacteria 1741
331 Ga0373927_0030205 3300035695 Bacteria 3536
332 Ga0373947_0045052 3300035725 Bacteria 2639
333 Ga0373937_0193210 3300036401 Bacteria 1913
334 Ga0373925_0050984 3300037068 Bacteria 3088
335 Ga0373925_0684883 3300037068 Bacteria 845
336 Ga0395901_0257773 3300038443 Bacteria 1816
337 Ga0451576_0594104 3300045051 Bacteria 1163
338 Ga0451576_0915940 3300045051 Bacteria 920
339 Ga0466967_0571471 3300045976 Bacteria 1114
340 Ga0495651_0246670 3300046462 Bacteria 1222
341 Ga0495580_0166124 3300046472 Bacteria 1527
342 Ga0495582_0447184 3300046473 Bacteria 746
343 Ga0495608_0078353 3300046511 Bacteria 2150
344 Ga0495618_0018865 3300046514 Bacteria 4238
345 Ga0495630_0048370 3300046517 Bacteria 3182
346 Ga0495652_0095036 3300046529 Bacteria 2430
347 Ga0495652_0214228 3300046529 Bacteria 1452
348 Ga0495586_0280804 3300046535 Bacteria 953
349 Ga0495621_0070067 3300046539 Bacteria 1290
350 Ga0495645_0010834 3300046543 Bacteria 6405
351 Ga0495667_0042050 3300046559 Bacteria 3030
352 Ga0495656_0384316 3300046615 Bacteria 732
353 Ga0495634_0399006 3300046642 Bacteria 817
354 Ga0495635_0623604 3300046663 Bacteria 703
355 Ga0495659_0023176 3300046664 Bacteria 2108
356 Ga0495657_0052151 3300046675 Bacteria 2744
357 Ga0495599_0137889 3300046678 Bacteria 1514
358 Ga0495647_0048055 3300046681 Bacteria 1649
359 Ga0495658_0669017 3300046683 Unclassified 665
360 Ga0495669_0007907 3300046684 Bacteria 4465
361 Ga0495669_0157397 3300046684 Bacteria 1077
362 Ga0495613_0000927 3300046689 Bacteria 22499
363 Ga0495604_0144947 3300047317 Bacteria 1693
364 Ga0495604_0226647 3300047317 Bacteria 1284
365 Ga0495674_0005735 3300047319 Bacteria 11901
366 Ga0495684_0000048 3300047471 Bacteria 89243
367 Ga0496100_0074296 3300048903 Bacteria 2277
368 Ga0496101_0000685 3300048904 Bacteria 20428
369 Ga0496101_0554222 3300048904 Bacteria 909
370 Ga0496101_0750528 3300048904 Bacteria 770
371 Ga0496102_0963200 3300048905 Bacteria 774
372 Ga0496103_0523490 3300048906 Bacteria 758
373 Ga0496104_0425663 3300048907 Bacteria 1239
374 Ga0496106_0066523 3300048909 Bacteria 2745
375 Ga0496106_0395966 3300048909 Bacteria 1110
376 Ga0496107_0229358 3300048910 Bacteria 1382
377 Ga0496107_0309762 3300048910 Bacteria 1175
378 Ga0496109_0056363 3300048912 Bacteria 3587
379 Ga0496109_0103797 3300048912 Bacteria 2639
380 Ga0496109_0738703 3300048912 Bacteria 922
381 Ga0496109_1006231 3300048912 Bacteria 771
382 Ga0496110_0151334 3300048913 Bacteria 2101
383 Ga0496112_0327414 3300048915 Bacteria 1476
384 Ga0496112_0624195 3300048915 Bacteria 1009
385 Ga0496114_0127885 3300048917 Bacteria 2192
386 Ga0496114_1024244 3300048917 Bacteria 709
387 Ga0496115_0368111 3300048918 Bacteria 1170
388 Ga0501073_0245065 3300049589 Bacteria 1237
389 Ga0501075_0480165 3300049591 Bacteria 948
390 Ga0501079_0105874 3300049741 Bacteria 2183
391 nmdc:mga05p37_105535_c1 3300050507 Bacteria 3466
392 nmdc:mga05p37_11606_c1 3300050507 Bacteria 10499
393 nmdc:mga05p37_16703_c1 3300050507 Bacteria 8845
394 nmdc:mga05p37_22241_c1 3300050507 Bacteria 7687
395 nmdc:mga05p37_247875_c1 3300050507 Bacteria 2138
396 nmdc:mga05p37_29063_c1 3300050507 Bacteria 6746
397 nmdc:mga05p37_31186_c1 3300050507 Bacteria 6511
398 nmdc:mga05p37_331516_c1 3300050507 Bacteria 1797
399 nmdc:mga05p37_355127_c1 3300050507 Bacteria 1725
400 nmdc:mga05p37_46505_c1 3300050507 Bacteria 5336
401 nmdc:mga05p37_78239_c1 3300050507 Bacteria 4072
402 nmdc:mga05p37_9103_c1 3300050507 Bacteria 11737
403 nmdc:mga09592_145268_c1 3300050508 Bacteria 2045
404 nmdc:mga09592_283915_c1 3300050508 Bacteria 1435
405 nmdc:mga09592_493806_c1 3300050508 Bacteria 1054
406 nmdc:mga09592_75613_c1 3300050508 Bacteria 2863
407 nmdc:mga06r32_208009_c1 3300050510 Bacteria 1945
408 nmdc:mga08y16_1071_c1 3300050511 Bacteria 26933
409 nmdc:mga08y16_1343325_c1 3300050511 Bacteria 680
410 nmdc:mga08y16_164463_c1 3300050511 Bacteria 2305
411 nmdc:mga08y16_282672_c1 3300050511 Bacteria 1711
412 nmdc:mga08y16_324085_c1 3300050511 Bacteria 1586
413 nmdc:mga08y16_52037_c1 3300050511 Bacteria 4285
414 nmdc:mga08y16_6656_c1 3300050511 Bacteria 12122
415 nmdc:mga08y16_7157_c1 3300050511 Bacteria 11711
416 nmdc:mga08y16_814938_c1 3300050511 Bacteria 925
417 nmdc:mga0n895_101608_c1 3300050512 Bacteria 2885
418 nmdc:mga0n895_108320_c1 3300050512 Bacteria 2793
419 nmdc:mga0n895_1149484_c1 3300050512 Bacteria 752
420 nmdc:mga0n895_1370028_c1 3300050512 Bacteria 676
421 nmdc:mga0n895_16763_c1 3300050512 Bacteria 6733
422 nmdc:mga0n895_186332_c1 3300050512 Bacteria 2106
423 nmdc:mga0n895_195187_c1 3300050512 Bacteria 2055
424 nmdc:mga0n895_21226_c1 3300050512 Bacteria 6068
425 nmdc:mga0n895_224257_c1 3300050512 Bacteria 1908
426 nmdc:mga0n895_742066_c1 3300050512 Bacteria 975
427 nmdc:mga0n895_859_c1 3300050512 Bacteria 21838
428 nmdc:mga0rr50_109_c1 3300050513 Bacteria 46163
429 nmdc:mga0rr50_131597_c1 3300050513 Bacteria 2004
430 nmdc:mga0rr50_22625_c1 3300050513 Bacteria 4318
431 nmdc:mga0rr50_273682_c1 3300050513 Bacteria 1408
432 nmdc:mga0rr50_411669_c1 3300050513 Bacteria 1143
433 nmdc:mga0rr50_44843_c1 3300050513 Bacteria 3246
434 nmdc:mga0rr50_736655_c1 3300050513 Bacteria 841
435 nmdc:mga0rr50_803937_c1 3300050513 Bacteria 802
436 nmdc:mga08x19_102996_c1 3300050514 Bacteria 1896
437 nmdc:mga08x19_17643_c1 3300050514 Bacteria 4371
438 nmdc:mga08x19_24050_c1 3300050514 Bacteria 3783
439 nmdc:mga08x19_296219_c1 3300050514 Bacteria 1123
440 nmdc:mga08x19_65294_c1 3300050514 Bacteria 2363
441 nmdc:mga08x19_945422_c1 3300050514 Bacteria 612
442 nmdc:mga08x19_9879_c1 3300050514 Bacteria 5721
443 nmdc:mga0a205_1077219_c1 3300050515 Bacteria 651
444 nmdc:mga0a205_122842_c1 3300050515 Bacteria 2496
445 nmdc:mga0a205_162208_c1 3300050515 Bacteria 2131
446 nmdc:mga0a205_220261_c1 3300050515 Unclassified 1783
447 nmdc:mga0a205_355884_c1 3300050515 Bacteria 1331
448 nmdc:mga0a205_44544_c1 3300050515 Bacteria 4278
449 nmdc:mga0a205_59591_c1 3300050515 Bacteria 3687
450 nmdc:mga0a205_66090_c1 3300050515 Bacteria 3494
451 Ga0495601_0046119 3300053077 Bacteria 2743
452 Ga0495601_0079414 3300053077 Bacteria 2104
453 Ga0495619_0001582 3300053085 Bacteria 14969
454 Ga0495619_0028066 3300053085 Bacteria 3629
455 Ga0495619_0130958 3300053085 Bacteria 1724
456 Ga0495619_0263236 3300053085 Bacteria 1195

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300038443 Ga0395901_0257773 Ga0395901_0257773_615_1157 160
2 3300048910 Ga0496107_0229358 Ga0496107_0229358_697_1254 165
3 3300005440 Ga0070705_100160351 Ga0070705_1001603512 173
4 3300025916 Ga0207663_10714100 Ga0207663_107141001 173
5 3300005290 Ga0065712_10068138 Ga0065712_100681382 174
6 3300005290 Ga0065712_10238358 Ga0065712_102383581 174
7 3300005293 Ga0065715_10127942 Ga0065715_101279424 174
8 3300005293 Ga0065715_10349488 Ga0065715_103494882 174
9 3300005293 Ga0065715_10481925 Ga0065715_104819251 174
10 3300005295 Ga0065707_10018539 Ga0065707_100185394 174
11 3300005295 Ga0065707_10197348 Ga0065707_101973482 174
12 3300005295 Ga0065707_10202499 Ga0065707_102024993 174
13 3300005295 Ga0065707_10218237 Ga0065707_102182372 174
14 3300005295 Ga0065707_10253268 Ga0065707_102532682 174
15 3300005295 Ga0065707_10355005 Ga0065707_103550051 174
16 3300005295 Ga0065707_10358328 Ga0065707_103583281 174
17 3300005328 Ga0070676_10058633 Ga0070676_100586331 174
18 3300005330 Ga0070690_100163110 Ga0070690_1001631102 174
19 3300005330 Ga0070690_100187289 Ga0070690_1001872891 174
20 3300005331 Ga0070670_100047786 Ga0070670_1000477864 174
21 3300005335 Ga0070666_10167721 Ga0070666_101677212 174
22 3300005335 Ga0070666_10216993 Ga0070666_102169931 174
23 3300005335 Ga0070666_10327178 Ga0070666_103271782 174
24 3300005338 Ga0068868_100548013 Ga0068868_1005480131 174
25 3300005341 Ga0070691_10001728 Ga0070691_100017283 174
26 3300005343 Ga0070687_100033473 Ga0070687_1000334732 174
27 3300005344 Ga0070661_100180735 Ga0070661_1001807354 174
28 3300005347 Ga0070668_100086888 Ga0070668_1000868882 174
29 3300005347 Ga0070668_100098733 Ga0070668_1000987334 174
30 3300005347 Ga0070668_100983280 Ga0070668_1009832801 174
31 3300005353 Ga0070669_100053128 Ga0070669_1000531285 174
32 3300005353 Ga0070669_100273405 Ga0070669_1002734052 174
33 3300005353 Ga0070669_100305012 Ga0070669_1003050121 174
34 3300005354 Ga0070675_100001537 Ga0070675_10000153717 174
35 3300005354 Ga0070675_100150617 Ga0070675_1001506171 174
36 3300005356 Ga0070674_100226570 Ga0070674_1002265702 174
37 3300005356 Ga0070674_100740955 Ga0070674_1007409552 174
38 3300005364 Ga0070673_100071637 Ga0070673_1000716376 174
39 3300005364 Ga0070673_100155466 Ga0070673_1001554662 174
40 3300005365 Ga0070688_100197736 Ga0070688_1001977362 174
41 3300005367 Ga0070667_100374434 Ga0070667_1003744342 174
42 3300005435 Ga0070714_100016015 Ga0070714_1000160158 174
43 3300005436 Ga0070713_100071573 Ga0070713_1000715732 174
44 3300005440 Ga0070705_100016790 Ga0070705_1000167902 174
45 3300005441 Ga0070700_100010175 Ga0070700_1000101758 174
46 3300005441 Ga0070700_100075101 Ga0070700_1000751012 174
47 3300005444 Ga0070694_100002597 Ga0070694_10000259710 174
48 3300005444 Ga0070694_100010066 Ga0070694_1000100662 174
49 3300005444 Ga0070694_101158020 Ga0070694_1011580201 174
50 3300005445 Ga0070708_100064269 Ga0070708_1000642694 174
51 3300005445 Ga0070708_100192176 Ga0070708_1001921761 174
52 3300005455 Ga0070663_100739635 Ga0070663_1007396352 174
53 3300005456 Ga0070678_100062516 Ga0070678_1000625163 174
54 3300005456 Ga0070678_100542369 Ga0070678_1005423692 174
55 3300005457 Ga0070662_100854840 Ga0070662_1008548401 174
56 3300005458 Ga0070681_10123352 Ga0070681_101233521 174
57 3300005459 Ga0068867_100232644 Ga0068867_1002326442 174
58 3300005459 Ga0068867_100361262 Ga0068867_1003612621 174
59 3300005466 Ga0070685_10080661 Ga0070685_100806612 174
60 3300005467 Ga0070706_100274232 Ga0070706_1002742321 174
61 3300005471 Ga0070698_100026990 Ga0070698_1000269903 174
62 3300005471 Ga0070698_100810984 Ga0070698_1008109842 174
63 3300005518 Ga0070699_100102408 Ga0070699_1001024083 174
64 3300005518 Ga0070699_100437654 Ga0070699_1004376542 174
65 3300005530 Ga0070679_100015797 Ga0070679_1000157975 174
66 3300005530 Ga0070679_100037637 Ga0070679_1000376378 174
67 3300005536 Ga0070697_100030202 Ga0070697_1000302022 174
68 3300005536 Ga0070697_100118603 Ga0070697_1001186032 174
69 3300005536 Ga0070697_100296401 Ga0070697_1002964012 174
70 3300005543 Ga0070672_100117000 Ga0070672_1001170002 174
71 3300005544 Ga0070686_100002486 Ga0070686_10000248614 174
72 3300005545 Ga0070695_100003699 Ga0070695_1000036996 174
73 3300005545 Ga0070695_100013076 Ga0070695_1000130762 174
74 3300005545 Ga0070695_100180733 Ga0070695_1001807333 174
75 3300005545 Ga0070695_100552726 Ga0070695_1005527262 174
76 3300005546 Ga0070696_100059950 Ga0070696_1000599505 174
77 3300005547 Ga0070693_100145854 Ga0070693_1001458542 174
78 3300005547 Ga0070693_100302282 Ga0070693_1003022822 174
79 3300005548 Ga0070665_100024772 Ga0070665_1000247726 174
80 3300005549 Ga0070704_100010915 Ga0070704_1000109158 174
81 3300005549 Ga0070704_100020400 Ga0070704_1000204002 174
82 3300005549 Ga0070704_100421699 Ga0070704_1004216992 174
83 3300005549 Ga0070704_100452722 Ga0070704_1004527221 174
84 3300005563 Ga0068855_100331808 Ga0068855_1003318084 174
85 3300005578 Ga0068854_100021646 Ga0068854_1000216462 174
86 3300005615 Ga0070702_100001638 Ga0070702_10000163813 174
87 3300005615 Ga0070702_100422269 Ga0070702_1004222692 174
88 3300005616 Ga0068852_100496899 Ga0068852_1004968993 174
89 3300005617 Ga0068859_100116866 Ga0068859_1001168666 174
90 3300005617 Ga0068859_100157505 Ga0068859_1001575052 174
91 3300005617 Ga0068859_100341050 Ga0068859_1003410502 174
92 3300005617 Ga0068859_100442464 Ga0068859_1004424643 174
93 3300005618 Ga0068864_100076036 Ga0068864_1000760362 174
94 3300005718 Ga0068866_10090411 Ga0068866_100904112 174
95 3300005719 Ga0068861_100930837 Ga0068861_1009308371 174
96 3300005719 Ga0068861_101185374 Ga0068861_1011853741 174
97 3300005840 Ga0068870_10088927 Ga0068870_100889273 174
98 3300005841 Ga0068863_100317690 Ga0068863_1003176902 174
99 3300005841 Ga0068863_100518591 Ga0068863_1005185912 174
100 3300005842 Ga0068858_100040173 Ga0068858_1000401732 174
101 3300005842 Ga0068858_100426469 Ga0068858_1004264692 174
102 3300005842 Ga0068858_100755110 Ga0068858_1007551101 174
103 3300005843 Ga0068860_100413546 Ga0068860_1004135462 174
104 3300005843 Ga0068860_100557139 Ga0068860_1005571392 174
105 3300005844 Ga0068862_100143380 Ga0068862_1001433802 174
106 3300005937 Ga0081455_10307835 Ga0081455_103078352 174
107 3300005985 Ga0081539_10109090 Ga0081539_101090902 174
108 3300006163 Ga0070715_10133751 Ga0070715_101337512 174
109 3300006237 Ga0097621_100005116 Ga0097621_10000511613 174
110 3300006237 Ga0097621_100156739 Ga0097621_1001567392 174
111 3300006237 Ga0097621_101112596 Ga0097621_1011125962 174
112 3300006358 Ga0068871_100000337 Ga0068871_1000003372 174
113 3300006358 Ga0068871_100043722 Ga0068871_1000437223 174
114 3300006358 Ga0068871_100064303 Ga0068871_1000643035 174
115 3300006358 Ga0068871_100310232 Ga0068871_1003102322 174
116 3300006358 Ga0068871_100439195 Ga0068871_1004391952 174
117 3300006844 Ga0075428_100116199 Ga0075428_1001161992 174
118 3300006844 Ga0075428_100339739 Ga0075428_1003397392 174
119 3300006844 Ga0075428_100965276 Ga0075428_1009652762 174
120 3300006847 Ga0075431_100247931 Ga0075431_1002479312 174
121 3300006852 Ga0075433_10004207 Ga0075433_100042078 174
122 3300006852 Ga0075433_10067266 Ga0075433_100672662 174
123 3300006852 Ga0075433_10110067 Ga0075433_101100672 174
124 3300006852 Ga0075433_10130741 Ga0075433_101307412 174
125 3300006852 Ga0075433_10261212 Ga0075433_102612123 174
126 3300006852 Ga0075433_10335229 Ga0075433_103352292 174
127 3300006852 Ga0075433_10617715 Ga0075433_106177151 174
128 3300006871 Ga0075434_100004066 Ga0075434_1000040662 174
129 3300006871 Ga0075434_100021223 Ga0075434_1000212235 174
130 3300006871 Ga0075434_100060975 Ga0075434_1000609755 174
131 3300006871 Ga0075434_100092379 Ga0075434_1000923795 174
132 3300006871 Ga0075434_100131782 Ga0075434_1001317822 174
133 3300006871 Ga0075434_100136236 Ga0075434_1001362362 174
134 3300006871 Ga0075434_100261210 Ga0075434_1002612102 174
135 3300006871 Ga0075434_100291108 Ga0075434_1002911082 174
136 3300006880 Ga0075429_100129856 Ga0075429_1001298562 174
137 3300006880 Ga0075429_100240843 Ga0075429_1002408432 174
138 3300006914 Ga0075436_100010393 Ga0075436_1000103935 174
139 3300006914 Ga0075436_100010413 Ga0075436_1000104138 174
140 3300006914 Ga0075436_100046055 Ga0075436_1000460552 174
141 3300006914 Ga0075436_100104940 Ga0075436_1001049402 174
142 3300006914 Ga0075436_100110552 Ga0075436_1001105522 174
143 3300006914 Ga0075436_100189233 Ga0075436_1001892332 174
144 3300006931 Ga0097620_100116871 Ga0097620_1001168716 174
145 3300006931 Ga0097620_100157512 Ga0097620_1001575122 174
146 3300006931 Ga0097620_100341035 Ga0097620_1003410352 174
147 3300006931 Ga0097620_100442529 Ga0097620_1004425292 174
148 3300007076 Ga0075435_100001499 Ga0075435_1000014993 174
149 3300007076 Ga0075435_100011704 Ga0075435_1000117048 174
150 3300007076 Ga0075435_100020280 Ga0075435_1000202802 174
151 3300007076 Ga0075435_100022377 Ga0075435_1000223773 174
152 3300007076 Ga0075435_100052494 Ga0075435_1000524942 174
153 3300007076 Ga0075435_100053991 Ga0075435_1000539912 174
154 3300007076 Ga0075435_100190312 Ga0075435_1001903122 174
155 3300007076 Ga0075435_100199361 Ga0075435_1001993614 174
156 3300007076 Ga0075435_100729463 Ga0075435_1007294632 174
157 3300007076 Ga0075435_100809915 Ga0075435_1008099152 174
158 3300007265 Ga0099794_10105575 Ga0099794_101055752 174
159 3300007788 Ga0099795_10090211 Ga0099795_100902112 174
160 3300009093 Ga0105240_10501759 Ga0105240_105017593 174
161 3300009093 Ga0105240_10648353 Ga0105240_106483532 174
162 3300009094 Ga0111539_10005974 Ga0111539_1000597418 174
163 3300009094 Ga0111539_10013059 Ga0111539_100130597 174
164 3300009094 Ga0111539_10026076 Ga0111539_100260762 174
165 3300009094 Ga0111539_10235779 Ga0111539_102357792 174
166 3300009094 Ga0111539_10600332 Ga0111539_106003322 174
167 3300009094 Ga0111539_11464950 Ga0111539_114649502 174
168 3300009098 Ga0105245_10008265 Ga0105245_100082653 174
169 3300009098 Ga0105245_10059584 Ga0105245_100595846 174
170 3300009098 Ga0105245_10608680 Ga0105245_106086802 174
171 3300009098 Ga0105245_11026038 Ga0105245_110260381 174
172 3300009101 Ga0105247_10017382 Ga0105247_100173826 174
173 3300009101 Ga0105247_10072546 Ga0105247_100725462 174
174 3300009101 Ga0105247_10340909 Ga0105247_103409092 174
175 3300009147 Ga0114129_10001435 Ga0114129_100014357 174
176 3300009147 Ga0114129_10021065 Ga0114129_100210652 174
177 3300009147 Ga0114129_10022782 Ga0114129_1002278210 174
178 3300009147 Ga0114129_10042408 Ga0114129_100424089 174
179 3300009147 Ga0114129_10045015 Ga0114129_100450154 174
180 3300009147 Ga0114129_10111924 Ga0114129_101119246 174
181 3300009147 Ga0114129_10113164 Ga0114129_101131642 174
182 3300009147 Ga0114129_10114829 Ga0114129_101148292 174
183 3300009147 Ga0114129_10133655 Ga0114129_101336552 174
184 3300009147 Ga0114129_10323649 Ga0114129_103236492 174
185 3300009147 Ga0114129_10501753 Ga0114129_105017532 174
186 3300009147 Ga0114129_10735970 Ga0114129_107359701 174
187 3300009148 Ga0105243_10009374 Ga0105243_1000937412 174
188 3300009148 Ga0105243_10447806 Ga0105243_104478063 174
189 3300009148 Ga0105243_10504362 Ga0105243_105043622 174
190 3300009148 Ga0105243_10515006 Ga0105243_105150062 174
191 3300009148 Ga0105243_10660852 Ga0105243_106608521 174
192 3300009148 Ga0105243_10733078 Ga0105243_107330782 174
193 3300009174 Ga0105241_10037687 Ga0105241_100376872 174
194 3300009174 Ga0105241_11316765 Ga0105241_113167651 174
195 3300009176 Ga0105242_10848085 Ga0105242_108480852 174
196 3300009176 Ga0105242_11176019 Ga0105242_111760191 174
197 3300009177 Ga0105248_10024770 Ga0105248_100247709 174
198 3300009177 Ga0105248_10085283 Ga0105248_100852837 174
199 3300009177 Ga0105248_10089169 Ga0105248_100891696 174
200 3300009177 Ga0105248_10134937 Ga0105248_101349372 174
201 3300009177 Ga0105248_10855010 Ga0105248_108550101 174
202 3300009177 Ga0105248_10866317 Ga0105248_108663172 174
203 3300009551 Ga0105238_10392931 Ga0105238_103929313 174
204 3300009553 Ga0105249_10281932 Ga0105249_102819324 174
205 3300013296 Ga0157374_10260802 Ga0157374_102608022 174
206 3300013297 Ga0157378_10012898 Ga0157378_1001289811 174
207 3300013297 Ga0157378_11719164 Ga0157378_117191641 174
208 3300013308 Ga0157375_10524508 Ga0157375_105245082 174
209 3300013308 Ga0157375_10795803 Ga0157375_107958032 174
210 3300014325 Ga0163163_10029543 Ga0163163_100295434 174
211 3300014325 Ga0163163_11114005 Ga0163163_111140052 174
212 3300014326 Ga0157380_10046940 Ga0157380_100469402 174
213 3300014326 Ga0157380_10114317 Ga0157380_101143175 174
214 3300014326 Ga0157380_10167118 Ga0157380_101671182 174
215 3300014326 Ga0157380_10467095 Ga0157380_104670952 174
216 3300014326 Ga0157380_10663393 Ga0157380_106633931 174
217 3300014745 Ga0157377_10348821 Ga0157377_103488211 174
218 3300014968 Ga0157379_10043440 Ga0157379_100434405 174
219 3300014968 Ga0157379_10046157 Ga0157379_100461572 174
220 3300014968 Ga0157379_10299413 Ga0157379_102994132 174
221 3300014968 Ga0157379_10700037 Ga0157379_107000372 174
222 3300014969 Ga0157376_10033860 Ga0157376_100338607 174
223 3300014969 Ga0157376_10104160 Ga0157376_101041602 174
224 3300014969 Ga0157376_10164451 Ga0157376_101644515 174
225 3300014969 Ga0157376_10166563 Ga0157376_101665632 174
226 3300014969 Ga0157376_10255235 Ga0157376_102552352 174
227 3300014969 Ga0157376_10879764 Ga0157376_108797642 174
228 3300017792 Ga0163161_10338465 Ga0163161_103384652 174
229 3300025893 Ga0207682_10069088 Ga0207682_100690882 174
230 3300025899 Ga0207642_10231599 Ga0207642_102315992 174
231 3300025900 Ga0207710_10036292 Ga0207710_100362922 174
232 3300025900 Ga0207710_10124866 Ga0207710_101248661 174
233 3300025903 Ga0207680_10304915 Ga0207680_103049151 174
234 3300025903 Ga0207680_10391309 Ga0207680_103913092 174
235 3300025906 Ga0207699_10195621 Ga0207699_101956212 174
236 3300025906 Ga0207699_10528987 Ga0207699_105289871 174
237 3300025907 Ga0207645_10002542 Ga0207645_100025422 174
238 3300025908 Ga0207643_10206901 Ga0207643_102069012 174
239 3300025908 Ga0207643_10313121 Ga0207643_103131212 174
240 3300025911 Ga0207654_10012257 Ga0207654_100122572 174
241 3300025913 Ga0207695_10389347 Ga0207695_103893472 174
242 3300025913 Ga0207695_10565257 Ga0207695_105652571 174
243 3300025913 Ga0207695_10661560 Ga0207695_106615602 174
244 3300025916 Ga0207663_10181456 Ga0207663_101814562 174
245 3300025918 Ga0207662_10003313 Ga0207662_100033132 174
246 3300025918 Ga0207662_10427631 Ga0207662_104276312 174
247 3300025921 Ga0207652_10041513 Ga0207652_100415132 174
248 3300025921 Ga0207652_10215250 Ga0207652_102152502 174
249 3300025922 Ga0207646_10328103 Ga0207646_103281031 174
250 3300025923 Ga0207681_10009213 Ga0207681_100092132 174
251 3300025924 Ga0207694_10205150 Ga0207694_102051504 174
252 3300025925 Ga0207650_10027153 Ga0207650_100271532 174
253 3300025925 Ga0207650_10397682 Ga0207650_103976822 174
254 3300025926 Ga0207659_10001294 Ga0207659_100012946 174
255 3300025927 Ga0207687_10005201 Ga0207687_100052015 174
256 3300025927 Ga0207687_10315362 Ga0207687_103153622 174
257 3300025928 Ga0207700_10015627 Ga0207700_100156276 174
258 3300025929 Ga0207664_10026169 Ga0207664_100261696 174
259 3300025931 Ga0207644_10856927 Ga0207644_108569271 174
260 3300025932 Ga0207690_10540001 Ga0207690_105400011 174
261 3300025933 Ga0207706_10130847 Ga0207706_101308474 174
262 3300025933 Ga0207706_10965241 Ga0207706_109652411 174
263 3300025934 Ga0207686_10067071 Ga0207686_100670715 174
264 3300025935 Ga0207709_10087319 Ga0207709_100873195 174
265 3300025935 Ga0207709_10807372 Ga0207709_108073721 174
266 3300025935 Ga0207709_11032921 Ga0207709_110329211 174
267 3300025936 Ga0207670_10848985 Ga0207670_108489852 174
268 3300025940 Ga0207691_10218420 Ga0207691_102184203 174
269 3300025941 Ga0207711_10040651 Ga0207711_100406515 174
270 3300025941 Ga0207711_10327526 Ga0207711_103275261 174
271 3300025941 Ga0207711_10343687 Ga0207711_103436872 174
272 3300025941 Ga0207711_10347297 Ga0207711_103472972 174
273 3300025942 Ga0207689_10178380 Ga0207689_101783801 174
274 3300025942 Ga0207689_10190367 Ga0207689_101903672 174
275 3300025944 Ga0207661_10830127 Ga0207661_108301272 174
276 3300025945 Ga0207679_10219615 Ga0207679_102196152 174
277 3300025949 Ga0207667_10559530 Ga0207667_105595302 174
278 3300025960 Ga0207651_10045410 Ga0207651_100454102 174
279 3300025960 Ga0207651_10205573 Ga0207651_102055735 174
280 3300025960 Ga0207651_10718361 Ga0207651_107183611 174
281 3300025961 Ga0207712_10168098 Ga0207712_101680982 174
282 3300025961 Ga0207712_10267499 Ga0207712_102674991 174
283 3300025972 Ga0207668_10176247 Ga0207668_101762472 174
284 3300025972 Ga0207668_10381742 Ga0207668_103817422 174
285 3300025981 Ga0207640_10015460 Ga0207640_100154602 174
286 3300025986 Ga0207658_10659131 Ga0207658_106591312 174
287 3300026023 Ga0207677_10108020 Ga0207677_101080205 174
288 3300026023 Ga0207677_10134912 Ga0207677_101349122 174
289 3300026023 Ga0207677_10141395 Ga0207677_101413952 174
290 3300026035 Ga0207703_10002242 Ga0207703_100022425 174
291 3300026035 Ga0207703_10088300 Ga0207703_100883002 174
292 3300026035 Ga0207703_10236312 Ga0207703_102363122 174
293 3300026041 Ga0207639_10219335 Ga0207639_102193354 174
294 3300026041 Ga0207639_11263496 Ga0207639_112634961 174
295 3300026075 Ga0207708_10016993 Ga0207708_100169938 174
296 3300026075 Ga0207708_10067854 Ga0207708_100678541 174
297 3300026088 Ga0207641_10150847 Ga0207641_101508472 174
298 3300026088 Ga0207641_10458969 Ga0207641_104589692 174
299 3300026089 Ga0207648_10014508 Ga0207648_100145082 174
300 3300026089 Ga0207648_10018889 Ga0207648_100188892 174
301 3300026089 Ga0207648_10214864 Ga0207648_102148642 174
302 3300026089 Ga0207648_11079430 Ga0207648_110794301 174
303 3300026118 Ga0207675_100015362 Ga0207675_1000153628 174
304 3300026118 Ga0207675_100070825 Ga0207675_1000708252 174
305 3300026118 Ga0207675_100316772 Ga0207675_1003167724 174
306 3300026118 Ga0207675_101078933 Ga0207675_1010789331 174
307 3300026118 Ga0207675_101129427 Ga0207675_1011294271 174
308 3300026118 Ga0207675_101291684 Ga0207675_1012916841 174
309 3300026121 Ga0207683_10067435 Ga0207683_100674352 174
310 3300026121 Ga0207683_10108486 Ga0207683_101084862 174
311 3300026142 Ga0207698_10687876 Ga0207698_106878762 174
312 3300027907 Ga0207428_10018632 Ga0207428_100186322 174
313 3300027907 Ga0207428_10020412 Ga0207428_100204124 174
314 3300027907 Ga0207428_10064026 Ga0207428_100640262 174
315 3300028379 Ga0268266_10057208 Ga0268266_100572086 174
316 3300028381 Ga0268264_10273484 Ga0268264_102734842 174
317 3300028381 Ga0268264_10702424 Ga0268264_107024241 174
318 3300031238 Ga0265332_10058879 Ga0265332_100588792 174
319 3300031239 Ga0265328_10127741 Ga0265328_101277412 174
320 3300031240 Ga0265320_10076098 Ga0265320_100760982 174
321 3300031711 Ga0265314_10038728 Ga0265314_100387286 174
322 3300032002 Ga0307416_100352947 Ga0307416_1003529474 174
323 3300035113 Ga0373936_0020647 Ga0373936_0020647_1682_2266 174
324 3300035116 Ga0373945_0013482 Ga0373945_0013482_1173_1757 174
325 3300035116 Ga0373945_0104709 Ga0373945_0104709_483_1067 174
326 3300035119 Ga0373956_0005850 Ga0373956_0005850_115_699 174
327 3300035119 Ga0373956_0455920 Ga0373956_0455920_12_596 174
328 3300035120 Ga0373957_0157043 Ga0373957_0157043_99_683 174
329 3300035170 Ga0373943_0045540 Ga0373943_0045540_318_902 174
330 3300035207 Ga0373942_0004245 Ga0373942_0004245_829_1413 174
331 3300035410 Ga0373924_0010839 Ga0373924_0010839_2412_2996 174
332 3300035692 Ga0373935_0122192 Ga0373935_0122192_372_956 174
333 3300035695 Ga0373927_0030205 Ga0373927_0030205_678_1262 174
334 3300035725 Ga0373947_0045052 Ga0373947_0045052_1667_2251 174
335 3300036401 Ga0373937_0193210 Ga0373937_0193210_125_709 174
336 3300037068 Ga0373925_0050984 Ga0373925_0050984_378_962 174
337 3300037068 Ga0373925_0684883 Ga0373925_0684883_35_619 174
338 3300045051 Ga0451576_0594104 Ga0451576_0594104_438_1022 174
339 3300045051 Ga0451576_0915940 Ga0451576_0915940_108_692 174
340 3300045976 Ga0466967_0571471 Ga0466967_0571471_383_967 174
341 3300046462 Ga0495651_0246670 Ga0495651_0246670_82_666 174
342 3300046472 Ga0495580_0166124 Ga0495580_0166124_420_1004 174
343 3300046473 Ga0495582_0447184 Ga0495582_0447184_41_625 174
344 3300046511 Ga0495608_0078353 Ga0495608_0078353_615_1199 174
345 3300046514 Ga0495618_0018865 Ga0495618_0018865_82_666 174
346 3300046517 Ga0495630_0048370 Ga0495630_0048370_2143_2727 174
347 3300046529 Ga0495652_0095036 Ga0495652_0095036_92_676 174
348 3300046529 Ga0495652_0214228 Ga0495652_0214228_395_979 174
349 3300046535 Ga0495586_0280804 Ga0495586_0280804_222_806 174
350 3300046539 Ga0495621_0070067 Ga0495621_0070067_513_1097 174
351 3300046543 Ga0495645_0010834 Ga0495645_0010834_828_1412 174
352 3300046559 Ga0495667_0042050 Ga0495667_0042050_1360_1944 174
353 3300046615 Ga0495656_0384316 Ga0495656_0384316_135_719 174
354 3300046642 Ga0495634_0399006 Ga0495634_0399006_150_734 174
355 3300046663 Ga0495635_0623604 Ga0495635_0623604_48_632 174
356 3300046664 Ga0495659_0023176 Ga0495659_0023176_1454_2038 174
357 3300046675 Ga0495657_0052151 Ga0495657_0052151_1690_2274 174
358 3300046678 Ga0495599_0137889 Ga0495599_0137889_343_927 174
359 3300046681 Ga0495647_0048055 Ga0495647_0048055_314_898 174
360 3300046683 Ga0495658_0669017 Ga0495658_0669017_16_600 174
361 3300046684 Ga0495669_0007907 Ga0495669_0007907_1061_1645 174
362 3300046684 Ga0495669_0157397 Ga0495669_0157397_40_624 174
363 3300046689 Ga0495613_0000927 Ga0495613_0000927_6168_6752 174
364 3300047317 Ga0495604_0144947 Ga0495604_0144947_809_1393 174
365 3300047317 Ga0495604_0226647 Ga0495604_0226647_115_699 174
366 3300047319 Ga0495674_0005735 Ga0495674_0005735_9745_10329 174
367 3300047471 Ga0495684_0000048 Ga0495684_0000048_41618_42202 174
368 3300048903 Ga0496100_0074296 Ga0496100_0074296_583_1167 174
369 3300048904 Ga0496101_0000685 Ga0496101_0000685_17353_17937 174
370 3300048904 Ga0496101_0554222 Ga0496101_0554222_287_871 174
371 3300048904 Ga0496101_0750528 Ga0496101_0750528_115_699 174
372 3300048905 Ga0496102_0963200 Ga0496102_0963200_138_722 174
373 3300048906 Ga0496103_0523490 Ga0496103_0523490_65_649 174
374 3300048907 Ga0496104_0425663 Ga0496104_0425663_419_1003 174
375 3300048909 Ga0496106_0066523 Ga0496106_0066523_206_790 174
376 3300048909 Ga0496106_0395966 Ga0496106_0395966_255_839 174
377 3300048910 Ga0496107_0309762 Ga0496107_0309762_569_1153 174
378 3300048912 Ga0496109_0056363 Ga0496109_0056363_2035_2619 174
379 3300048912 Ga0496109_0103797 Ga0496109_0103797_742_1326 174
380 3300048912 Ga0496109_0738703 Ga0496109_0738703_195_779 174
381 3300048912 Ga0496109_1006231 Ga0496109_1006231_14_598 174
382 3300048913 Ga0496110_0151334 Ga0496110_0151334_571_1155 174
383 3300048915 Ga0496112_0327414 Ga0496112_0327414_441_1025 174
384 3300048915 Ga0496112_0624195 Ga0496112_0624195_112_696 174
385 3300048917 Ga0496114_0127885 Ga0496114_0127885_448_1032 174
386 3300048917 Ga0496114_1024244 Ga0496114_1024244_35_619 174
387 3300048918 Ga0496115_0368111 Ga0496115_0368111_420_1004 174
388 3300049589 Ga0501073_0245065 Ga0501073_0245065_274_858 174
389 3300049591 Ga0501075_0480165 Ga0501075_0480165_51_641 174
390 3300049741 Ga0501079_0105874 Ga0501079_0105874_1518_2102 174
391 3300050507 nmdc:mga05p37_105535_c1 nmdc:mga05p37_105535_c1_2448_3032 174
392 3300050507 nmdc:mga05p37_11606_c1 nmdc:mga05p37_11606_c1_4428_5012 174
393 3300050507 nmdc:mga05p37_16703_c1 nmdc:mga05p37_16703_c1_6978_7562 174
394 3300050507 nmdc:mga05p37_22241_c1 nmdc:mga05p37_22241_c1_3731_4315 174
395 3300050507 nmdc:mga05p37_247875_c1 nmdc:mga05p37_247875_c1_449_1033 174
396 3300050507 nmdc:mga05p37_29063_c1 nmdc:mga05p37_29063_c1_4030_4614 174
397 3300050507 nmdc:mga05p37_31186_c1 nmdc:mga05p37_31186_c1_2195_2779 174
398 3300050507 nmdc:mga05p37_331516_c1 nmdc:mga05p37_331516_c1_1044_1628 174
399 3300050507 nmdc:mga05p37_355127_c1 nmdc:mga05p37_355127_c1_69_653 174
400 3300050507 nmdc:mga05p37_46505_c1 nmdc:mga05p37_46505_c1_3983_4567 174
401 3300050507 nmdc:mga05p37_78239_c1 nmdc:mga05p37_78239_c1_2992_3576 174
402 3300050507 nmdc:mga05p37_9103_c1 nmdc:mga05p37_9103_c1_6610_7194 174
403 3300050508 nmdc:mga09592_145268_c1 nmdc:mga09592_145268_c1_881_1465 174
404 3300050508 nmdc:mga09592_283915_c1 nmdc:mga09592_283915_c1_577_1161 174
405 3300050508 nmdc:mga09592_493806_c1 nmdc:mga09592_493806_c1_378_962 174
406 3300050508 nmdc:mga09592_75613_c1 nmdc:mga09592_75613_c1_1747_2331 174
407 3300050510 nmdc:mga06r32_208009_c1 nmdc:mga06r32_208009_c1_880_1464 174
408 3300050511 nmdc:mga08y16_1071_c1 nmdc:mga08y16_1071_c1_13360_13944 174
409 3300050511 nmdc:mga08y16_1343325_c1 nmdc:mga08y16_1343325_c1_20_604 174
410 3300050511 nmdc:mga08y16_164463_c1 nmdc:mga08y16_164463_c1_207_791 174
411 3300050511 nmdc:mga08y16_282672_c1 nmdc:mga08y16_282672_c1_440_1024 174
412 3300050511 nmdc:mga08y16_324085_c1 nmdc:mga08y16_324085_c1_86_670 174
413 3300050511 nmdc:mga08y16_52037_c1 nmdc:mga08y16_52037_c1_2439_3023 174
414 3300050511 nmdc:mga08y16_6656_c1 nmdc:mga08y16_6656_c1_9844_10428 174
415 3300050511 nmdc:mga08y16_7157_c1 nmdc:mga08y16_7157_c1_5920_6504 174
416 3300050511 nmdc:mga08y16_814938_c1 nmdc:mga08y16_814938_c1_215_799 174
417 3300050512 nmdc:mga0n895_101608_c1 nmdc:mga0n895_101608_c1_1038_1622 174
418 3300050512 nmdc:mga0n895_108320_c1 nmdc:mga0n895_108320_c1_535_1119 174
419 3300050512 nmdc:mga0n895_1149484_c1 nmdc:mga0n895_1149484_c1_137_721 174
420 3300050512 nmdc:mga0n895_1370028_c1 nmdc:mga0n895_1370028_c1_13_597 174
421 3300050512 nmdc:mga0n895_16763_c1 nmdc:mga0n895_16763_c1_1309_1893 174
422 3300050512 nmdc:mga0n895_186332_c1 nmdc:mga0n895_186332_c1_543_1127 174
423 3300050512 nmdc:mga0n895_195187_c1 nmdc:mga0n895_195187_c1_803_1387 174
424 3300050512 nmdc:mga0n895_21226_c1 nmdc:mga0n895_21226_c1_1737_2321 174
425 3300050512 nmdc:mga0n895_224257_c1 nmdc:mga0n895_224257_c1_997_1581 174
426 3300050512 nmdc:mga0n895_742066_c1 nmdc:mga0n895_742066_c1_305_889 174
427 3300050512 nmdc:mga0n895_859_c1 nmdc:mga0n895_859_c1_20112_20696 174
428 3300050513 nmdc:mga0rr50_109_c1 nmdc:mga0rr50_109_c1_3156_3740 174
429 3300050513 nmdc:mga0rr50_131597_c1 nmdc:mga0rr50_131597_c1_1241_1825 174
430 3300050513 nmdc:mga0rr50_22625_c1 nmdc:mga0rr50_22625_c1_641_1225 174
431 3300050513 nmdc:mga0rr50_273682_c1 nmdc:mga0rr50_273682_c1_147_731 174
432 3300050513 nmdc:mga0rr50_411669_c1 nmdc:mga0rr50_411669_c1_195_779 174
433 3300050513 nmdc:mga0rr50_44843_c1 nmdc:mga0rr50_44843_c1_1229_1813 174
434 3300050513 nmdc:mga0rr50_736655_c1 nmdc:mga0rr50_736655_c1_149_733 174
435 3300050513 nmdc:mga0rr50_803937_c1 nmdc:mga0rr50_803937_c1_102_686 174
436 3300050514 nmdc:mga08x19_102996_c1 nmdc:mga08x19_102996_c1_639_1223 174
437 3300050514 nmdc:mga08x19_17643_c1 nmdc:mga08x19_17643_c1_2194_2778 174
438 3300050514 nmdc:mga08x19_24050_c1 nmdc:mga08x19_24050_c1_1079_1663 174
439 3300050514 nmdc:mga08x19_296219_c1 nmdc:mga08x19_296219_c1_358_942 174
440 3300050514 nmdc:mga08x19_65294_c1 nmdc:mga08x19_65294_c1_1759_2343 174
441 3300050514 nmdc:mga08x19_945422_c1 nmdc:mga08x19_945422_c1_17_601 174
442 3300050514 nmdc:mga08x19_9879_c1 nmdc:mga08x19_9879_c1_3508_4092 174
443 3300050515 nmdc:mga0a205_1077219_c1 nmdc:mga0a205_1077219_c1_34_618 174
444 3300050515 nmdc:mga0a205_122842_c1 nmdc:mga0a205_122842_c1_26_610 174
445 3300050515 nmdc:mga0a205_162208_c1 nmdc:mga0a205_162208_c1_139_723 174
446 3300050515 nmdc:mga0a205_220261_c1 nmdc:mga0a205_220261_c1_902_1486 174
447 3300050515 nmdc:mga0a205_355884_c1 nmdc:mga0a205_355884_c1_258_842 174
448 3300050515 nmdc:mga0a205_44544_c1 nmdc:mga0a205_44544_c1_426_1010 174
449 3300050515 nmdc:mga0a205_59591_c1 nmdc:mga0a205_59591_c1_723_1307 174
450 3300050515 nmdc:mga0a205_66090_c1 nmdc:mga0a205_66090_c1_2098_2682 174
451 3300053077 Ga0495601_0046119 Ga0495601_0046119_462_1046 174
452 3300053077 Ga0495601_0079414 Ga0495601_0079414_1474_2058 174
453 3300053085 Ga0495619_0001582 Ga0495619_0001582_9127_9711 174
454 3300053085 Ga0495619_0028066 Ga0495619_0028066_2560_3144 174
455 3300053085 Ga0495619_0130958 Ga0495619_0130958_748_1332 174
456 3300053085 Ga0495619_0263236 Ga0495619_0263236_11_595 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

51

175

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
8dh6-assembly1.cif.gz_c cryo-em structure of saccharomyces cerevisiae cytochrome c oxidase (complex iv) extracted in lipid nanodiscs 0.7043 19 168
5gpn-assembly1.cif.gz_0 architecture of mammalian respirasome 0.6748 19 169
5luf-assembly1.cif.gz_z cryo-em of bovine respirasome 0.6748 19 169
1occ-assembly1.cif.gz_C structure of bovine heart cytochrome c oxidase at the fully oxidized state 0.6748 19 169
1occ-assembly1.cif.gz_P structure of bovine heart cytochrome c oxidase at the fully oxidized state 0.6748 19 169
ID Description Score Start End Superfamily
af_Q2FZK1_13_198_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.6691 17 173 1.20.120.80
af_P9WP67_20_203_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.667 22 172 1.20.120.80
af_A0A0R0H600_74_264_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.6637 24 168 1.20.120.80
2yevD03 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.6303 13 170 1.20.120.80
af_Q1G3V3_33_182_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.6199 19 81 1.20.140.40
ID Description Score Start End GO Terms
AF-A0A4S0PZ50-F1-model_v4 deleted 0.852 19 136
AF-A0A800IS62-F1-model_v4 Heme-copper oxidase subunit III 0.8425 50 173 GO:0004129
GO:0005886
GO:0019646
AF-X8DTB9-F1-model_v4 Probable cytochrome c oxidase subunit 3 (EC 7.1.1.9) (Cytochrome aa3 subunit 3) (Cytochrome c oxidase polypeptide III) 0.824 48 168 GO:0004129
GO:0005886
GO:0019646
AF-A0A800IS62-F1-model_v4 Heme-copper oxidase subunit III 0.8 50 173 GO:0004129
GO:0005886
GO:0019646
AF-A0A3C1F483-F1-model_v4 Protein translocase subunit SecA (EC 7.4.2.8) 0.7996 62 173 GO:0004129
GO:0005524
GO:0005829
GO:0005886
GO:0006605
GO:0017038
GO:0022904
GO:0031522
GO:0043952
GO:0065002

Feature Viewer

pLDDT pTM Quality
72.22 0.67 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map