F447809

General Info

Members Datasets Scaffolds Average Seq Length
456 221 450 320

Family's Representative Sequence

Representative Sequence 3300031090|Ga0265760_10001456|Ga0265760_100014568
Length 398
Sequence MGPQKSRGLYRLRVRGSNQHRLRPRGPKGPFLCDLQRHFHNLGGSAVARHQPMACFPGHRPSPTDLRYHGVLFGRGMTLEQIRGLVTADFEAVDRVVKQRLHSKVALVDQVATYIIYAGGKRLRPLLVLLAARACGHSGERHIDAAAIIEFIHTATLLHDDVVDESSLRRGRDTANEVFGNATSVLVGDFLYSRAFQMMVTLDRMRIMQILADATNAIAEGEVLQLMNARDPNTTEARYIDVIRRKTARLFEAGAQIAAVLSDATPAMEESLALYGRHIGTAFQLVDDALDYQADEASLGKHLGADLAEGKPTLPLIYAMQHGNETQRTMIRHAIEHGGLDHLAEITRAVASLGGLAYTARLAQCEADQALAALAPLPESAFKEGLSELAKFAVARKN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2690315857 Rheinheimera sp. EpRS3 Isolate Unclassified
3 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
4 2887630918 Psychrosphaera haliotis UCD-MCMsp1aY Isolate Unclassified
5 2919534386 Rheinheimera pacifica 3879 Isolate Unclassified
6 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
146 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
147 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
151 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
152 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
153 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
160 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
161 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
172 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
178 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
182 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
187 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
188 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
189 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
190 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
191 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
209 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 8054357960 Idiomarina rhizosphaerae M1R2S28 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.05
Metatranscriptomes 2.63
Isolates 1.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.14
Rhizosphere 90.57
Stem 0
Stem Tuber 0
Unclassified 3.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2695764 2162886007 Bacteria 1942
2 JGI25406J46586_10004003 3300003203 Bacteria 6893
3 rootL2_10005201 3300003322 Bacteria 4801
4 rootH1_10069177 3300003323 Bacteria 1641
5 Ga0070676_10115836 3300005328 Bacteria 1675
6 Ga0070676_10136938 3300005328 Bacteria 1554
7 Ga0070690_100049433 3300005330 Bacteria 2681
8 Ga0070690_100073158 3300005330 Bacteria 2230
9 Ga0070670_100003085 3300005331 Bacteria 13778
10 Ga0070670_100030232 3300005331 Bacteria 4664
11 Ga0070670_100093327 3300005331 Bacteria 2589
12 Ga0070670_100187211 3300005331 Bacteria 1797
13 Ga0070677_10033492 3300005333 Bacteria 1978
14 Ga0070677_10039105 3300005333 Bacteria 1860
15 Ga0068869_100007226 3300005334 Bacteria 7080
16 Ga0068869_100039470 3300005334 Bacteria 3370
17 Ga0070666_10013586 3300005335 Bacteria 5170
18 Ga0070666_10050030 3300005335 Bacteria 2810
19 Ga0070680_100010358 3300005336 Bacteria 7187
20 Ga0070680_100113236 3300005336 Bacteria 2259
21 Ga0068868_100037165 3300005338 Bacteria 3774
22 Ga0068868_100113483 3300005338 Bacteria 2203
23 Ga0070660_100411488 3300005339 Bacteria 1119
24 Ga0070689_100263594 3300005340 Bacteria 1425
25 Ga0070661_100178545 3300005344 Bacteria 1615
26 Ga0070661_100225695 3300005344 Bacteria 1438
27 Ga0070668_100007189 3300005347 Bacteria 8253
28 Ga0070668_100021811 3300005347 Bacteria 4839
29 Ga0070668_100252068 3300005347 Bacteria 1466
30 Ga0070669_100112420 3300005353 Bacteria 2068
31 Ga0070675_100016364 3300005354 Bacteria 5885
32 Ga0070675_100189087 3300005354 Bacteria 1783
33 Ga0070671_100003444 3300005355 Bacteria 12344
34 Ga0070671_100045856 3300005355 Bacteria 3634
35 Ga0070671_100083792 3300005355 Bacteria 2666
36 Ga0070671_100211141 3300005355 Bacteria 1646
37 Ga0070674_100076494 3300005356 Bacteria 2380
38 Ga0070674_100292597 3300005356 Bacteria 1295
39 Ga0070673_100002156 3300005364 Bacteria 11928
40 Ga0070673_100119396 3300005364 Bacteria 2197
41 Ga0070673_100150950 3300005364 Bacteria 1968
42 Ga0070673_100198075 3300005364 Bacteria 1729
43 Ga0070667_100000506 3300005367 Bacteria 39414
44 Ga0070667_100006038 3300005367 Bacteria 10063
45 Ga0070667_100014220 3300005367 Bacteria 6575
46 Ga0070667_100065881 3300005367 Bacteria 3076
47 Ga0070667_100289089 3300005367 Bacteria 1473
48 Ga0070709_10165355 3300005434 Bacteria 1542
49 Ga0070713_100006790 3300005436 Bacteria 7976
50 Ga0070713_100100351 3300005436 Bacteria 2506
51 Ga0070710_10003950 3300005437 Bacteria 7027
52 Ga0070711_100010223 3300005439 Bacteria 5800
53 Ga0070711_100148433 3300005439 Bacteria 1766
54 Ga0070705_100032801 3300005440 Bacteria 2889
55 Ga0070700_100342991 3300005441 Bacteria 1105
56 Ga0070678_100003428 3300005456 Bacteria 8843
57 Ga0070678_100120430 3300005456 Bacteria 2068
58 Ga0070662_100084683 3300005457 Bacteria 2368
59 Ga0070681_10064439 3300005458 Bacteria 3635
60 Ga0070681_10140328 3300005458 Bacteria 2347
61 Ga0068867_100033568 3300005459 Bacteria 3717
62 Ga0068867_100049981 3300005459 Bacteria 3080
63 Ga0070679_100073727 3300005530 Bacteria 3404
64 Ga0070679_100087568 3300005530 Bacteria 3101
65 Ga0070679_100284743 3300005530 Bacteria 1605
66 Ga0068853_100089297 3300005539 Bacteria 2706
67 Ga0068853_100466514 3300005539 Bacteria 1189
68 Ga0070672_100000491 3300005543 Bacteria 23038
69 Ga0070672_100208354 3300005543 Bacteria 1637
70 Ga0070695_100050009 3300005545 Bacteria 2677
71 Ga0070696_100003474 3300005546 Bacteria 10471
72 Ga0070696_100022415 3300005546 Bacteria 4290
73 Ga0070696_100139954 3300005546 Bacteria 1768
74 Ga0070693_100200058 3300005547 Bacteria 1297
75 Ga0070665_100004871 3300005548 Bacteria 13946
76 Ga0070665_100210388 3300005548 Bacteria 1945
77 Ga0070704_100043084 3300005549 Bacteria 3126
78 Ga0068855_100068106 3300005563 Bacteria 4144
79 Ga0068855_100095789 3300005563 Bacteria 3420
80 Ga0068855_100097091 3300005563 Bacteria 3394
81 Ga0068855_100194400 3300005563 Bacteria 2286
82 Ga0068856_100063545 3300005614 Bacteria 3647
83 Ga0068856_100554988 3300005614 Bacteria 1170
84 Ga0068859_100020904 3300005617 Bacteria 6570
85 Ga0068859_100026542 3300005617 Bacteria 5808
86 Ga0068859_100112422 3300005617 Bacteria 2787
87 Ga0068859_100244808 3300005617 Bacteria 1883
88 Ga0068864_100017173 3300005618 Bacteria 6035
89 Ga0068864_100020675 3300005618 Bacteria 5509
90 Ga0068864_100058877 3300005618 Bacteria 3322
91 Ga0068861_100014499 3300005719 Bacteria 5532
92 Ga0068861_100044140 3300005719 Bacteria 3351
93 Ga0068861_100101009 3300005719 Bacteria 2294
94 Ga0068870_10026601 3300005840 Bacteria 2885
95 Ga0068863_100024954 3300005841 Bacteria 5702
96 Ga0068863_100041528 3300005841 Bacteria 4374
97 Ga0068863_100068228 3300005841 Bacteria 3364
98 Ga0068858_100012257 3300005842 Bacteria 8083
99 Ga0068858_100019666 3300005842 Bacteria 6314
100 Ga0068858_100055111 3300005842 Bacteria 3675
101 Ga0068858_100111255 3300005842 Bacteria 2558
102 Ga0068860_100000086 3300005843 Bacteria 165786
103 Ga0068860_100011176 3300005843 Bacteria 8848
104 Ga0068860_100037681 3300005843 Bacteria 4628
105 Ga0068860_100038403 3300005843 Bacteria 4579
106 Ga0068862_100034702 3300005844 Bacteria 4270
107 Ga0068862_100059738 3300005844 Bacteria 3274
108 Ga0068862_100146384 3300005844 Bacteria 2100
109 Ga0068862_100301721 3300005844 Bacteria 1474
110 Ga0068862_100473226 3300005844 Bacteria 1185
111 Ga0081539_10000160 3300005985 Bacteria 157504
112 Ga0070715_10002439 3300006163 Bacteria 5706
113 Ga0070716_100005892 3300006173 Bacteria 5961
114 Ga0070712_100030975 3300006175 Bacteria 3600
115 Ga0070712_100080373 3300006175 Bacteria 2360
116 Ga0097621_100009827 3300006237 Bacteria 6966
117 Ga0097621_100074563 3300006237 Bacteria 2811
118 Ga0097621_100220556 3300006237 Bacteria 1652
119 Ga0097621_100244897 3300006237 Bacteria 1568
120 Ga0068871_100004650 3300006358 Bacteria 9587
121 Ga0068871_100035236 3300006358 Bacteria 3975
122 Ga0068871_100398796 3300006358 Bacteria 1225
123 Ga0075428_100067494 3300006844 Bacteria 3914
124 Ga0075430_100331313 3300006846 Bacteria 1258
125 Ga0075431_100032927 3300006847 Bacteria 5342
126 Ga0075429_100394576 3300006880 Bacteria 1212
127 Ga0068865_100103256 3300006881 Bacteria 2090
128 Ga0068865_100161091 3300006881 Bacteria 1711
129 Ga0068865_100296368 3300006881 Bacteria 1293
130 Ga0097620_100020904 3300006931 Bacteria 6570
131 Ga0097620_100026543 3300006931 Bacteria 5808
132 Ga0097620_100112429 3300006931 Bacteria 2787
133 Ga0097620_100244821 3300006931 Bacteria 1883
134 Ga0097620_100546427 3300006931 Bacteria 1253
135 Ga0105240_10016413 3300009093 Bacteria 10026
136 Ga0105240_10020430 3300009093 Bacteria 8833
137 Ga0105240_10047325 3300009093 Bacteria 5443
138 Ga0105240_10104214 3300009093 Bacteria 3445
139 Ga0105240_10106439 3300009093 Bacteria 3401
140 Ga0105240_10321093 3300009093 Bacteria 1765
141 Ga0105240_10483701 3300009093 Bacteria 1379
142 Ga0105240_10538637 3300009093 Bacteria 1293
143 Ga0111539_10009387 3300009094 Bacteria 12348
144 Ga0111539_10175542 3300009094 Bacteria 2503
145 Ga0105245_10016229 3300009098 Bacteria 6492
146 Ga0105245_10035377 3300009098 Bacteria 4432
147 Ga0105247_10001619 3300009101 Bacteria 15943
148 Ga0105247_10037501 3300009101 Bacteria 2958
149 Ga0105247_10053051 3300009101 Bacteria 2500
150 Ga0105247_10075592 3300009101 Bacteria 2114
151 Ga0105243_10183486 3300009148 Bacteria 1822
152 Ga0105241_10016951 3300009174 Bacteria 5347
153 Ga0105242_10024010 3300009176 Bacteria 4812
154 Ga0105242_10116331 3300009176 Bacteria 2287
155 Ga0105248_10006186 3300009177 Bacteria 13120
156 Ga0105248_10025370 3300009177 Bacteria 6590
157 Ga0105248_10139556 3300009177 Bacteria 2734
158 Ga0105248_10202065 3300009177 Bacteria 2239
159 Ga0105248_10504392 3300009177 Bacteria 1364
160 Ga0105248_10524433 3300009177 Bacteria 1336
161 Ga0105237_10240195 3300009545 Bacteria 1813
162 Ga0105238_10142138 3300009551 Bacteria 2376
163 Ga0105249_10052207 3300009553 Bacteria 3733
164 Ga0105249_10157012 3300009553 Bacteria 2195
165 Ga0105249_10366918 3300009553 Bacteria 1462
166 Ga0105239_10041139 3300010375 Bacteria 5064
167 Ga0105239_10241618 3300010375 Bacteria 2027
168 Ga0105246_10040183 3300011119 Bacteria 3155
169 Ga0157373_10018375 3300013100 Bacteria 5092
170 Ga0157369_10037254 3300013105 Bacteria 5325
171 Ga0157369_10317110 3300013105 Bacteria 1621
172 Ga0157374_10043947 3300013296 Bacteria 4128
173 Ga0157378_10004170 3300013297 Bacteria 12760
174 Ga0157378_10018715 3300013297 Bacteria 6088
175 Ga0157378_10120554 3300013297 Bacteria 2417
176 Ga0157378_10233954 3300013297 Bacteria 1752
177 Ga0163162_10013722 3300013306 Bacteria 7913
178 Ga0163162_10028264 3300013306 Bacteria 5547
179 Ga0163162_10061299 3300013306 Bacteria 3799
180 Ga0163162_10067993 3300013306 Bacteria 3613
181 Ga0163162_10235442 3300013306 Bacteria 1962
182 Ga0157375_10001843 3300013308 Bacteria 18224
183 Ga0157375_10065112 3300013308 Bacteria 3632
184 Ga0157375_10116734 3300013308 Bacteria 2773
185 Ga0157375_10194732 3300013308 Bacteria 2182
186 Ga0163163_10028972 3300014325 Bacteria 5323
187 Ga0163163_10077367 3300014325 Bacteria 3322
188 Ga0163163_10166862 3300014325 Bacteria 2248
189 Ga0163163_10216055 3300014325 Bacteria 1966
190 Ga0157380_10031513 3300014326 Bacteria 4070
191 Ga0157380_10115522 3300014326 Bacteria 2263
192 Ga0157380_10376104 3300014326 Bacteria 1339
193 Ga0157379_10004682 3300014968 Bacteria 11742
194 Ga0157379_10111799 3300014968 Bacteria 2454
195 Ga0157379_10338276 3300014968 Bacteria 1376
196 Ga0157376_10009069 3300014969 Bacteria 7207
197 Ga0157376_10338908 3300014969 Bacteria 1435
198 Ga0163161_10021214 3300017792 Bacteria 4566
199 Ga0163161_10309567 3300017792 Bacteria 1246
200 Ga0207692_10012890 3300025898 Bacteria 3606
201 Ga0207710_10029645 3300025900 Bacteria 2382
202 Ga0207680_10109826 3300025903 Bacteria 1786
203 Ga0207699_10006696 3300025906 Bacteria 5592
204 Ga0207699_10142572 3300025906 Bacteria 1576
205 Ga0207645_10097826 3300025907 Bacteria 1891
206 Ga0207645_10098622 3300025907 Bacteria 1884
207 Ga0207643_10006821 3300025908 Bacteria 6128
208 Ga0207643_10020177 3300025908 Bacteria 3656
209 Ga0207654_10074592 3300025911 Bacteria 2025
210 Ga0207707_10038762 3300025912 Bacteria 4164
211 Ga0207707_10063322 3300025912 Bacteria 3219
212 Ga0207707_10064152 3300025912 Bacteria 3197
213 Ga0207707_10066297 3300025912 Bacteria 3144
214 Ga0207707_10402987 3300025912 Bacteria 1174
215 Ga0207695_10003170 3300025913 Bacteria 23437
216 Ga0207695_10023762 3300025913 Bacteria 6917
217 Ga0207695_10082369 3300025913 Bacteria 3253
218 Ga0207695_10115487 3300025913 Bacteria 2659
219 Ga0207695_10230519 3300025913 Bacteria 1757
220 Ga0207671_10062646 3300025914 Bacteria 2762
221 Ga0207693_10001234 3300025915 Bacteria 22783
222 Ga0207663_10006531 3300025916 Bacteria 5977
223 Ga0207663_10117890 3300025916 Bacteria 1812
224 Ga0207660_10168812 3300025917 Bacteria 1692
225 Ga0207657_10055502 3300025919 Bacteria 3421
226 Ga0207652_10052782 3300025921 Bacteria 3491
227 Ga0207652_10057102 3300025921 Bacteria 3361
228 Ga0207652_10204081 3300025921 Bacteria 1779
229 Ga0207652_10293729 3300025921 Bacteria 1466
230 Ga0207681_10046061 3300025923 Bacteria 2932
231 Ga0207681_10094474 3300025923 Bacteria 2143
232 Ga0207694_10146747 3300025924 Bacteria 1899
233 Ga0207650_10003745 3300025925 Bacteria 10405
234 Ga0207650_10011754 3300025925 Bacteria 6037
235 Ga0207650_10046810 3300025925 Bacteria 3186
236 Ga0207650_10070938 3300025925 Bacteria 2620
237 Ga0207659_10117858 3300025926 Bacteria 2030
238 Ga0207687_10211478 3300025927 Bacteria 1522
239 Ga0207700_10054744 3300025928 Bacteria 2996
240 Ga0207700_10435057 3300025928 Bacteria 1154
241 Ga0207644_10015950 3300025931 Bacteria 5051
242 Ga0207644_10220146 3300025931 Bacteria 1504
243 Ga0207706_10002897 3300025933 Bacteria 16598
244 Ga0207706_10058422 3300025933 Bacteria 3397
245 Ga0207686_10146386 3300025934 Bacteria 1639
246 Ga0207704_10010809 3300025938 Bacteria 4468
247 Ga0207704_10037899 3300025938 Bacteria 2789
248 Ga0207704_10070279 3300025938 Bacteria 2216
249 Ga0207691_10003327 3300025940 Bacteria 15648
250 Ga0207691_10003782 3300025940 Bacteria 14698
251 Ga0207691_10250750 3300025940 Bacteria 1528
252 Ga0207711_10004539 3300025941 Bacteria 11818
253 Ga0207711_10022509 3300025941 Bacteria 5271
254 Ga0207711_10091677 3300025941 Bacteria 2673
255 Ga0207711_10119829 3300025941 Bacteria 2348
256 Ga0207689_10002522 3300025942 Bacteria 17012
257 Ga0207689_10004890 3300025942 Bacteria 12082
258 Ga0207667_10041325 3300025949 Bacteria 4905
259 Ga0207667_10102787 3300025949 Bacteria 2947
260 Ga0207651_10018662 3300025960 Bacteria 4135
261 Ga0207712_10067832 3300025961 Bacteria 2554
262 Ga0207712_10289281 3300025961 Bacteria 1340
263 Ga0207668_10056653 3300025972 Bacteria 2730
264 Ga0207668_10098998 3300025972 Bacteria 2162
265 Ga0207658_10000537 3300025986 Bacteria 34554
266 Ga0207658_10050970 3300025986 Bacteria 3048
267 Ga0207658_10284589 3300025986 Bacteria 1418
268 Ga0207677_10016205 3300026023 Bacteria 4406
269 Ga0207677_10149974 3300026023 Bacteria 1797
270 Ga0207703_10001045 3300026035 Bacteria 26367
271 Ga0207703_10025491 3300026035 Bacteria 4651
272 Ga0207703_10052811 3300026035 Bacteria 3302
273 Ga0207703_10143532 3300026035 Bacteria 2074
274 Ga0207703_10171783 3300026035 Bacteria 1907
275 Ga0207703_10234614 3300026035 Bacteria 1646
276 Ga0207639_10025171 3300026041 Bacteria 4315
277 Ga0207678_10008217 3300026067 Bacteria 9198
278 Ga0207708_10036622 3300026075 Bacteria 3736
279 Ga0207708_10217723 3300026075 Bacteria 1529
280 Ga0207702_10175164 3300026078 Bacteria 1970
281 Ga0207641_10000411 3300026088 Bacteria 50003
282 Ga0207641_10256547 3300026088 Bacteria 1635
283 Ga0207641_10310534 3300026088 Bacteria 1492
284 Ga0207641_10334908 3300026088 Bacteria 1438
285 Ga0207648_10007413 3300026089 Bacteria 10795
286 Ga0207648_10012603 3300026089 Bacteria 7910
287 Ga0207648_10033114 3300026089 Bacteria 4559
288 Ga0207648_10095857 3300026089 Bacteria 2596
289 Ga0207676_10134635 3300026095 Bacteria 2106
290 Ga0207676_10201148 3300026095 Bacteria 1760
291 Ga0207675_100010449 3300026118 Bacteria 8692
292 Ga0207675_100017408 3300026118 Bacteria 6709
293 Ga0207675_100028393 3300026118 Bacteria 5210
294 Ga0207675_100041297 3300026118 Bacteria 4308
295 Ga0207675_100052317 3300026118 Bacteria 3811
296 Ga0207683_10007349 3300026121 Bacteria 9441
297 Ga0207698_10183605 3300026142 Bacteria 1856
298 Ga0210002_1001515 3300027617 Bacteria 3296
299 Ga0209983_1004621 3300027665 Bacteria 2888
300 Ga0209998_10000543 3300027717 Bacteria 10181
301 Ga0209974_10002288 3300027876 Bacteria 6958
302 Ga0207428_10314727 3300027907 Bacteria 1157
303 Ga0268266_10022688 3300028379 Bacteria 5344
304 Ga0268266_10049351 3300028379 Bacteria 3610
305 Ga0268266_10229532 3300028379 Bacteria 1709
306 Ga0268265_10023801 3300028380 Bacteria 4323
307 Ga0268265_10227270 3300028380 Bacteria 1637
308 Ga0268264_10000044 3300028381 Bacteria 368079
309 Ga0268264_10062141 3300028381 Bacteria 3135
310 Ga0268264_10103428 3300028381 Bacteria 2480
311 Ga0265334_10000295 3300028573 Bacteria 27889
312 Ga0265770_1000245 3300030878 Bacteria 7207
313 Ga0265760_10001456 3300031090 Bacteria 6965
314 Ga0265340_10021798 3300031247 Bacteria 3282
315 Ga0307408_100285961 3300031548 Bacteria 1375
316 Ga0316575_10010821 3300031665 Bacteria 3364
317 Ga0316579_10079534 3300031691 Bacteria 1560
318 Ga0316579_10091910 3300031691 Bacteria 1449
319 Ga0316576_10001138 3300031727 Bacteria 13960
320 Ga0316576_10001697 3300031727 Bacteria 12072
321 Ga0316576_10012083 3300031727 Bacteria 5693
322 Ga0316576_10033460 3300031727 Bacteria 3659
323 Ga0316576_10036207 3300031727 Bacteria 3527
324 Ga0316576_10060184 3300031727 Bacteria 2781
325 Ga0316576_10105730 3300031727 Bacteria 2107
326 Ga0316576_10117756 3300031727 Bacteria 1993
327 Ga0316576_10232853 3300031727 Bacteria 1385
328 Ga0316576_10316982 3300031727 Bacteria 1163
329 Ga0316578_10004070 3300031728 Bacteria 6837
330 Ga0307516_10000192 3300031730 Bacteria 79076
331 Ga0316577_10005308 3300031733 Bacteria 6751
332 Ga0316577_10056760 3300031733 Bacteria 2186
333 Ga0316577_10127383 3300031733 Bacteria 1432
334 Ga0316577_10150741 3300031733 Bacteria 1310
335 Ga0307406_10093084 3300031901 Bacteria 2034
336 Ga0307416_100183266 3300032002 Bacteria 1965
337 Ga0307415_100023683 3300032126 Bacteria 3818
338 Ga0316585_10007703 3300032137 Bacteria 3111
339 Ga0316585_10014801 3300032137 Bacteria 2334
340 Ga0316580_10001419 3300032139 Bacteria 6242
341 Ga0316580_10032035 3300032139 Bacteria 1627
342 Ga0316593_10003203 3300032168 Bacteria 4023
343 Ga0316593_10017888 3300032168 Bacteria 2169
344 Ga0316593_10025404 3300032168 Bacteria 1886
345 Ga0316592_1000643 3300033524 Bacteria 5074
346 Ga0316586_1000900 3300033527 Bacteria 3143
347 Ga0316588_1004255 3300033528 Bacteria 2693
348 Ga0316588_1035382 3300033528 Bacteria 1183
349 Ga0316596_1000326 3300033541 Bacteria 7727
350 Ga0316596_1001983 3300033541 Bacteria 4291
351 Ga0316596_1022874 3300033541 Bacteria 1598
352 Ga0373939_0000049 3300035114 Bacteria 42693
353 Ga0373954_0012268 3300035118 Bacteria 3810
354 Ga0373954_0111101 3300035118 Bacteria 1326
355 Ga0373956_0030548 3300035119 Bacteria 2356
356 Ga0373960_0028971 3300035121 Bacteria 1531
357 Ga0373955_0114472 3300035172 Bacteria 1562
358 Ga0373942_0036908 3300035207 Bacteria 1318
359 Ga0316574_0004484 3300035398 Bacteria 7326
360 Ga0316574_0005552 3300035398 Bacteria 6734
361 Ga0316574_0013010 3300035398 Bacteria 4774
362 Ga0316574_0015255 3300035398 Bacteria 4457
363 Ga0316574_0023565 3300035398 Bacteria 3676
364 Ga0316574_0024393 3300035398 Bacteria 3618
365 Ga0316574_0026337 3300035398 Bacteria 3496
366 Ga0316574_0028676 3300035398 Bacteria 3358
367 Ga0316574_0099706 3300035398 Bacteria 1858
368 Ga0316574_0138353 3300035398 Bacteria 1568
369 Ga0316574_0161403 3300035398 Bacteria 1443
370 Ga0373931_0032818 3300035691 Bacteria 2688
371 Ga0373935_0290758 3300035692 Bacteria 1153
372 Ga0373933_0049783 3300035724 Bacteria 2499
373 Ga0373937_0041733 3300036401 Bacteria 4185
374 Ga0373937_0181504 3300036401 Bacteria 1976
375 Ga0316582_0006462 3300036647 Bacteria 6155
376 Ga0316582_0008198 3300036647 Bacteria 5604
377 Ga0316582_0009363 3300036647 Bacteria 5314
378 Ga0316582_0012819 3300036647 Bacteria 4695
379 Ga0316582_0017164 3300036647 Bacteria 4180
380 Ga0316582_0024601 3300036647 Bacteria 3605
381 Ga0316582_0028998 3300036647 Bacteria 3357
382 Ga0316582_0035598 3300036647 Bacteria 3076
383 Ga0316582_0049441 3300036647 Bacteria 2660
384 Ga0316582_0087636 3300036647 Bacteria 2044
385 Ga0316584_0000874 3300036712 Bacteria 17108
386 Ga0316584_0006333 3300036712 Bacteria 8017
387 Ga0316584_0014390 3300036712 Bacteria 5630
388 Ga0316584_0016626 3300036712 Bacteria 5277
389 Ga0316584_0022953 3300036712 Bacteria 4555
390 Ga0316584_0024836 3300036712 Bacteria 4390
391 Ga0316584_0146981 3300036712 Bacteria 1756
392 Ga0316584_0190236 3300036712 Bacteria 1517
393 Ga0316584_0203701 3300036712 Bacteria 1459
394 Ga0373925_0122502 3300037068 Bacteria 2020
395 Ga0395898_0006120 3300037466 Bacteria 12900
396 Ga0316581_0041692 3300037588 Bacteria 1399
397 Ga0316581_0061549 3300037588 Bacteria 1152
398 Ga0400487_09541 3300039110 Bacteria 1401
399 Ga0451577_0045489 3300042876 Bacteria 3929
400 Ga0451577_0105454 3300042876 Bacteria 2519
401 Ga0495580_0004037 3300046472 Bacteria 12388
402 Ga0495618_0071963 3300046514 Bacteria 2200
403 Ga0495630_0199654 3300046517 Bacteria 1526
404 Ga0495632_0126876 3300046519 Bacteria 1189
405 Ga0495647_0025687 3300046681 Bacteria 2154
406 Ga0495647_0025742 3300046681 Bacteria 2152
407 Ga0495674_0178645 3300047319 Bacteria 1769
408 Ga0496100_0051687 3300048903 Bacteria 2669
409 Ga0496100_0053077 3300048903 Bacteria 2638
410 Ga0496101_0039210 3300048904 Bacteria 3367
411 Ga0496102_0238112 3300048905 Bacteria 1716
412 Ga0496103_0043015 3300048906 Bacteria 2781
413 Ga0496104_0017591 3300048907 Bacteria 6513
414 Ga0496104_0042194 3300048907 Bacteria 4280
415 Ga0496105_0009915 3300048908 Bacteria 7471
416 Ga0496105_0011289 3300048908 Bacteria 7051
417 Ga0496106_0014237 3300048909 Bacteria 5875
418 Ga0496106_0106525 3300048909 Bacteria 2179
419 Ga0496107_0073989 3300048910 Bacteria 2479
420 Ga0496108_0075858 3300048911 Bacteria 2841
421 Ga0496109_0008587 3300048912 Bacteria 8694
422 Ga0496109_0025134 3300048912 Bacteria 5304
423 Ga0496110_0003769 3300048913 Bacteria 11681
424 Ga0496110_0050580 3300048913 Bacteria 3649
425 Ga0496111_0013485 3300048914 Bacteria 5564
426 Ga0496111_0019260 3300048914 Bacteria 4738
427 Ga0496112_0031109 3300048915 Bacteria 5173
428 Ga0496112_0398966 3300048915 Bacteria 1315
429 Ga0496112_0552494 3300048915 Bacteria 1085
430 Ga0496113_0114120 3300048916 Bacteria 2106
431 Ga0496114_0005168 3300048917 Bacteria 10186
432 Ga0496114_0006907 3300048917 Bacteria 8943
433 Ga0496115_0030854 3300048918 Bacteria 4219
434 Ga0496115_0096678 3300048918 Bacteria 2418
435 Ga0496115_0129568 3300048918 Bacteria 2079
436 Ga0496117_0000373 3300048920 Bacteria 77595
437 Ga0496118_0000021 3300048921 Bacteria 444988
438 Ga0496119_0152177 3300048922 Bacteria 1238
439 Ga0496120_0022135 3300048923 Bacteria 4002
440 Ga0496121_0002740 3300048924 Bacteria 26193
441 Ga0496124_0154568 3300048927 Bacteria 1795
442 Ga0496125_0000112 3300048928 Bacteria 188192
443 Ga0501046_0053374 3300049580 Bacteria 3184
444 Ga0501047_0004958 3300049581 Bacteria 12500
445 Ga0501080_0054775 3300049742 Bacteria 3714
446 Ga0501035_0086616 3300049822 Bacteria 2760
447 Ga0501044_0002082 3300049823 Bacteria 23049
448 nmdc:mga09592_363528_c1 3300050508 Bacteria 1252
449 nmdc:mga0qj67_157329_c1 3300050509 Bacteria 1845
450 nmdc:mga08y16_34404_c1 3300050511 Bacteria 5322

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005334 Ga0068869_100007226 Ga0068869_1000072264 265
2 3300005338 Ga0068868_100037165 Ga0068868_1000371654 265
3 3300005340 Ga0070689_100263594 Ga0070689_1002635941 265
4 3300005364 Ga0070673_100119396 Ga0070673_1001193964 265
5 3300005617 Ga0068859_100020904 Ga0068859_1000209049 265
6 3300005618 Ga0068864_100058877 Ga0068864_1000588774 265
7 3300005719 Ga0068861_100101009 Ga0068861_1001010094 265
8 3300005842 Ga0068858_100019666 Ga0068858_1000196668 265
9 3300005843 Ga0068860_100038403 Ga0068860_1000384034 265
10 3300005844 Ga0068862_100034702 Ga0068862_1000347024 265
11 3300006237 Ga0097621_100009827 Ga0097621_1000098277 265
12 3300006358 Ga0068871_100398796 Ga0068871_1003987961 265
13 3300006931 Ga0097620_100020904 Ga0097620_1000209049 265
14 3300009101 Ga0105247_10075592 Ga0105247_100755923 265
15 3300009177 Ga0105248_10006186 Ga0105248_100061866 265
16 3300009553 Ga0105249_10366918 Ga0105249_103669181 265
17 3300011119 Ga0105246_10040183 Ga0105246_100401832 265
18 3300013297 Ga0157378_10120554 Ga0157378_101205544 265
19 3300013306 Ga0163162_10061299 Ga0163162_100612995 265
20 3300013308 Ga0157375_10194732 Ga0157375_101947322 265
21 3300014325 Ga0163163_10216055 Ga0163163_102160551 265
22 3300014969 Ga0157376_10009069 Ga0157376_100090695 265
23 3300025942 Ga0207689_10002522 Ga0207689_100025225 265
24 3300026023 Ga0207677_10016205 Ga0207677_100162054 265
25 3300026088 Ga0207641_10310534 Ga0207641_103105342 265
26 3300026089 Ga0207648_10095857 Ga0207648_100958574 265
27 3300026095 Ga0207676_10201148 Ga0207676_102011482 265
28 3300026118 Ga0207675_100028393 Ga0207675_1000283935 265
29 3300028379 Ga0268266_10022688 Ga0268266_100226885 265
30 3300028380 Ga0268265_10023801 Ga0268265_100238015 265
31 3300028381 Ga0268264_10062141 Ga0268264_100621414 265
32 3300048909 Ga0496106_0106525 Ga0496106_0106525_514_1662 280
33 3300009098 Ga0105245_10035377 Ga0105245_100353771 285
34 3300013296 Ga0157374_10043947 Ga0157374_100439472 285
35 3300026035 Ga0207703_10171783 Ga0207703_101717832 289
36 3300025941 Ga0207711_10004539 Ga0207711_100045392 295
37 3300025986 Ga0207658_10050970 Ga0207658_100509704 295
38 3300026035 Ga0207703_10234614 Ga0207703_102346142 295
39 3300048907 Ga0496104_0042194 Ga0496104_0042194_2628_3773 295
40 3300048912 Ga0496109_0025134 Ga0496109_0025134_3437_4582 295
41 3300048913 Ga0496110_0050580 Ga0496110_0050580_1006_2151 295
42 3300048914 Ga0496111_0013485 Ga0496111_0013485_207_1352 295
43 3300005331 Ga0070670_100030232 Ga0070670_1000302325 299
44 3300005333 Ga0070677_10033492 Ga0070677_100334922 299
45 3300005344 Ga0070661_100225695 Ga0070661_1002256951 299
46 3300005347 Ga0070668_100007189 Ga0070668_1000071898 299
47 3300005353 Ga0070669_100112420 Ga0070669_1001124203 299
48 3300005354 Ga0070675_100189087 Ga0070675_1001890872 299
49 3300005355 Ga0070671_100083792 Ga0070671_1000837923 299
50 3300005364 Ga0070673_100198075 Ga0070673_1001980752 299
51 3300005367 Ga0070667_100014220 Ga0070667_1000142206 299
52 3300005459 Ga0068867_100049981 Ga0068867_1000499814 299
53 3300005543 Ga0070672_100000491 Ga0070672_10000049118 299
54 3300005548 Ga0070665_100210388 Ga0070665_1002103882 299
55 3300005844 Ga0068862_100301721 Ga0068862_1003017212 299
56 3300017792 Ga0163161_10021214 Ga0163161_100212145 299
57 3300025907 Ga0207645_10097826 Ga0207645_100978263 299
58 3300025923 Ga0207681_10046061 Ga0207681_100460614 299
59 3300025926 Ga0207659_10117858 Ga0207659_101178582 299
60 3300025933 Ga0207706_10058422 Ga0207706_100584224 299
61 3300025940 Ga0207691_10003782 Ga0207691_100037825 299
62 3300025941 Ga0207711_10022509 Ga0207711_100225091 299
63 3300025960 Ga0207651_10018662 Ga0207651_100186622 299
64 3300025972 Ga0207668_10056653 Ga0207668_100566533 299
65 3300026023 Ga0207677_10149974 Ga0207677_101499742 299
66 3300026089 Ga0207648_10033114 Ga0207648_100331146 299
67 3300028379 Ga0268266_10049351 Ga0268266_100493512 299
68 3300025921 Ga0207652_10052782 Ga0207652_100527823 306
69 3300009093 Ga0105240_10016413 Ga0105240_100164136 307
70 3300009101 Ga0105247_10053051 Ga0105247_100530513 307
71 3300013100 Ga0157373_10018375 Ga0157373_100183754 307
72 3300014968 Ga0157379_10004682 Ga0157379_1000468210 307
73 3300026035 Ga0207703_10025491 Ga0207703_100254914 307
74 3300048906 Ga0496103_0043015 Ga0496103_0043015_1358_2362 308
75 3300048918 Ga0496115_0129568 Ga0496115_0129568_859_1863 308
76 3300048920 Ga0496117_0000373 Ga0496117_0000373_28701_29705 308
77 3300048921 Ga0496118_0000021 Ga0496118_0000021_33523_34527 308
78 3300048922 Ga0496119_0152177 Ga0496119_0152177_202_1206 308
79 3300048923 Ga0496120_0022135 Ga0496120_0022135_202_1206 308
80 3300048924 Ga0496121_0002740 Ga0496121_0002740_2364_3368 308
81 3300048927 Ga0496124_0154568 Ga0496124_0154568_100_1104 308
82 3300005328 Ga0070676_10115836 Ga0070676_101158361 309
83 3300005330 Ga0070690_100049433 Ga0070690_1000494334 309
84 3300005331 Ga0070670_100003085 Ga0070670_1000030856 309
85 3300005331 Ga0070670_100187211 Ga0070670_1001872112 309
86 3300005333 Ga0070677_10039105 Ga0070677_100391052 309
87 3300005334 Ga0068869_100039470 Ga0068869_1000394704 309
88 3300005347 Ga0070668_100021811 Ga0070668_1000218116 309
89 3300005347 Ga0070668_100252068 Ga0070668_1002520681 309
90 3300005354 Ga0070675_100016364 Ga0070675_1000163642 309
91 3300005355 Ga0070671_100211141 Ga0070671_1002111411 309
92 3300005356 Ga0070674_100076494 Ga0070674_1000764943 309
93 3300005356 Ga0070674_100292597 Ga0070674_1002925972 309
94 3300005441 Ga0070700_100342991 Ga0070700_1003429911 309
95 3300005456 Ga0070678_100120430 Ga0070678_1001204303 309
96 3300005618 Ga0068864_100017173 Ga0068864_1000171737 309
97 3300005841 Ga0068863_100041528 Ga0068863_1000415284 309
98 3300005841 Ga0068863_100068228 Ga0068863_1000682283 309
99 3300014326 Ga0157380_10376104 Ga0157380_103761041 309
100 3300017792 Ga0163161_10309567 Ga0163161_103095671 309
101 3300025923 Ga0207681_10094474 Ga0207681_100944743 309
102 3300025925 Ga0207650_10003745 Ga0207650_100037455 309
103 3300025925 Ga0207650_10070938 Ga0207650_100709384 309
104 3300025931 Ga0207644_10220146 Ga0207644_102201461 309
105 3300025972 Ga0207668_10098998 Ga0207668_100989981 309
106 3300026075 Ga0207708_10217723 Ga0207708_102177232 309
107 3300026088 Ga0207641_10256547 Ga0207641_102565472 309
108 3300026088 Ga0207641_10334908 Ga0207641_103349082 309
109 3300026089 Ga0207648_10012603 Ga0207648_100126039 309
110 3300026095 Ga0207676_10134635 Ga0207676_101346352 309
111 3300035114 Ga0373939_0000049 Ga0373939_0000049_34781_35710 309
112 3300035121 Ga0373960_0028971 Ga0373960_0028971_303_1232 309
113 3300035691 Ga0373931_0032818 Ga0373931_0032818_207_1136 309
114 3300009177 Ga0105248_10202065 Ga0105248_102020652 312
115 3300013306 Ga0163162_10013722 Ga0163162_100137223 312
116 3300013308 Ga0157375_10001843 Ga0157375_1000184312 312
117 3300014325 Ga0163163_10077367 Ga0163163_100773673 312
118 3300014326 Ga0157380_10031513 Ga0157380_100315132 312
119 3300014969 Ga0157376_10338908 Ga0157376_103389081 312
120 3300036647 Ga0316582_0035598 Ga0316582_0035598_56_1057 313
121 3300026118 Ga0207675_100052317 Ga0207675_1000523172 317
122 iso_pu_bacteria 2690315857 2691331535 318
123 iso_pu_bacteria 2881714928 2881715935 318
124 iso_pu_bacteria 2887630918 2887632789 318
125 iso_pu_bacteria 2919534386 2919535105 318
126 iso_pu_bacteria 2919688452 2919689415 318
127 iso_pu_bacteria 8054357960 8054358634 319
128 3300031691 Ga0316579_10091910 Ga0316579_100919101 320
129 3300035207 Ga0373942_0036908 Ga0373942_0036908_30_1010 320
130 3300036647 Ga0316582_0012819 Ga0316582_0012819_1362_2330 320
131 3300031727 Ga0316576_10117756 Ga0316576_101177562 321
132 3300031727 Ga0316576_10316982 Ga0316576_103169821 321
133 3300035398 Ga0316574_0013010 Ga0316574_0013010_1136_2140 321
134 2162886007 SwRhRL2b_contig_2695764 SwRhRL2b_0903.00005670 322
135 3300003203 JGI25406J46586_10004003 JGI25406J46586_100040032 322
136 3300003322 rootL2_10005201 rootL2_100052017 322
137 3300003323 rootH1_10069177 rootH1_100691772 322
138 3300005328 Ga0070676_10136938 Ga0070676_101369382 322
139 3300005330 Ga0070690_100073158 Ga0070690_1000731582 322
140 3300005331 Ga0070670_100093327 Ga0070670_1000933272 322
141 3300005335 Ga0070666_10013586 Ga0070666_100135864 322
142 3300005335 Ga0070666_10050030 Ga0070666_100500304 322
143 3300005336 Ga0070680_100010358 Ga0070680_1000103585 322
144 3300005336 Ga0070680_100113236 Ga0070680_1001132362 322
145 3300005338 Ga0068868_100113483 Ga0068868_1001134833 322
146 3300005339 Ga0070660_100411488 Ga0070660_1004114881 322
147 3300005344 Ga0070661_100178545 Ga0070661_1001785452 322
148 3300005355 Ga0070671_100003444 Ga0070671_1000034442 322
149 3300005355 Ga0070671_100045856 Ga0070671_1000458563 322
150 3300005364 Ga0070673_100002156 Ga0070673_10000215610 322
151 3300005364 Ga0070673_100150950 Ga0070673_1001509503 322
152 3300005367 Ga0070667_100000506 Ga0070667_10000050613 322
153 3300005367 Ga0070667_100006038 Ga0070667_1000060386 322
154 3300005367 Ga0070667_100065881 Ga0070667_1000658813 322
155 3300005367 Ga0070667_100289089 Ga0070667_1002890893 322
156 3300005434 Ga0070709_10165355 Ga0070709_101653551 322
157 3300005436 Ga0070713_100006790 Ga0070713_1000067904 322
158 3300005436 Ga0070713_100100351 Ga0070713_1001003512 322
159 3300005437 Ga0070710_10003950 Ga0070710_100039505 322
160 3300005439 Ga0070711_100010223 Ga0070711_1000102233 322
161 3300005439 Ga0070711_100148433 Ga0070711_1001484332 322
162 3300005440 Ga0070705_100032801 Ga0070705_1000328014 322
163 3300005456 Ga0070678_100003428 Ga0070678_1000034281 322
164 3300005457 Ga0070662_100084683 Ga0070662_1000846833 322
165 3300005458 Ga0070681_10064439 Ga0070681_100644394 322
166 3300005458 Ga0070681_10140328 Ga0070681_101403283 322
167 3300005459 Ga0068867_100033568 Ga0068867_1000335685 322
168 3300005530 Ga0070679_100073727 Ga0070679_1000737274 322
169 3300005530 Ga0070679_100087568 Ga0070679_1000875683 322
170 3300005530 Ga0070679_100284743 Ga0070679_1002847431 322
171 3300005539 Ga0068853_100089297 Ga0068853_1000892974 322
172 3300005539 Ga0068853_100466514 Ga0068853_1004665141 322
173 3300005543 Ga0070672_100208354 Ga0070672_1002083542 322
174 3300005545 Ga0070695_100050009 Ga0070695_1000500092 322
175 3300005546 Ga0070696_100003474 Ga0070696_1000034747 322
176 3300005546 Ga0070696_100022415 Ga0070696_1000224152 322
177 3300005546 Ga0070696_100139954 Ga0070696_1001399541 322
178 3300005547 Ga0070693_100200058 Ga0070693_1002000581 322
179 3300005548 Ga0070665_100004871 Ga0070665_10000487112 322
180 3300005549 Ga0070704_100043084 Ga0070704_1000430844 322
181 3300005563 Ga0068855_100068106 Ga0068855_1000681062 322
182 3300005563 Ga0068855_100095789 Ga0068855_1000957892 322
183 3300005563 Ga0068855_100097091 Ga0068855_1000970912 322
184 3300005563 Ga0068855_100194400 Ga0068855_1001944002 322
185 3300005614 Ga0068856_100063545 Ga0068856_1000635452 322
186 3300005614 Ga0068856_100554988 Ga0068856_1005549881 322
187 3300005617 Ga0068859_100026542 Ga0068859_1000265421 322
188 3300005617 Ga0068859_100112422 Ga0068859_1001124222 322
189 3300005617 Ga0068859_100244808 Ga0068859_1002448082 322
190 3300005618 Ga0068864_100020675 Ga0068864_1000206755 322
191 3300005719 Ga0068861_100014499 Ga0068861_1000144996 322
192 3300005719 Ga0068861_100044140 Ga0068861_1000441405 322
193 3300005840 Ga0068870_10026601 Ga0068870_100266014 322
194 3300005841 Ga0068863_100024954 Ga0068863_1000249543 322
195 3300005842 Ga0068858_100012257 Ga0068858_1000122572 322
196 3300005842 Ga0068858_100055111 Ga0068858_1000551114 322
197 3300005842 Ga0068858_100111255 Ga0068858_1001112554 322
198 3300005843 Ga0068860_100000086 Ga0068860_10000008647 322
199 3300005843 Ga0068860_100011176 Ga0068860_1000111761 322
200 3300005843 Ga0068860_100037681 Ga0068860_1000376814 322
201 3300005844 Ga0068862_100059738 Ga0068862_1000597382 322
202 3300005844 Ga0068862_100146384 Ga0068862_1001463844 322
203 3300005844 Ga0068862_100473226 Ga0068862_1004732262 322
204 3300005985 Ga0081539_10000160 Ga0081539_10000160118 322
205 3300006163 Ga0070715_10002439 Ga0070715_100024395 322
206 3300006173 Ga0070716_100005892 Ga0070716_1000058924 322
207 3300006175 Ga0070712_100030975 Ga0070712_1000309753 322
208 3300006175 Ga0070712_100080373 Ga0070712_1000803733 322
209 3300006237 Ga0097621_100074563 Ga0097621_1000745633 322
210 3300006237 Ga0097621_100220556 Ga0097621_1002205562 322
211 3300006237 Ga0097621_100244897 Ga0097621_1002448971 322
212 3300006358 Ga0068871_100004650 Ga0068871_1000046508 322
213 3300006358 Ga0068871_100035236 Ga0068871_1000352366 322
214 3300006844 Ga0075428_100067494 Ga0075428_1000674942 322
215 3300006846 Ga0075430_100331313 Ga0075430_1003313131 322
216 3300006847 Ga0075431_100032927 Ga0075431_1000329277 322
217 3300006880 Ga0075429_100394576 Ga0075429_1003945762 322
218 3300006881 Ga0068865_100103256 Ga0068865_1001032563 322
219 3300006881 Ga0068865_100161091 Ga0068865_1001610912 322
220 3300006881 Ga0068865_100296368 Ga0068865_1002963681 322
221 3300006931 Ga0097620_100026543 Ga0097620_1000265431 322
222 3300006931 Ga0097620_100112429 Ga0097620_1001124292 322
223 3300006931 Ga0097620_100244821 Ga0097620_1002448212 322
224 3300006931 Ga0097620_100546427 Ga0097620_1005464271 322
225 3300009093 Ga0105240_10020430 Ga0105240_100204304 322
226 3300009093 Ga0105240_10047325 Ga0105240_100473257 322
227 3300009093 Ga0105240_10104214 Ga0105240_101042143 322
228 3300009093 Ga0105240_10106439 Ga0105240_101064394 322
229 3300009093 Ga0105240_10321093 Ga0105240_103210932 322
230 3300009093 Ga0105240_10483701 Ga0105240_104837011 322
231 3300009093 Ga0105240_10538637 Ga0105240_105386372 322
232 3300009094 Ga0111539_10009387 Ga0111539_100093874 322
233 3300009094 Ga0111539_10175542 Ga0111539_101755424 322
234 3300009098 Ga0105245_10016229 Ga0105245_100162297 322
235 3300009101 Ga0105247_10001619 Ga0105247_100016196 322
236 3300009101 Ga0105247_10037501 Ga0105247_100375014 322
237 3300009148 Ga0105243_10183486 Ga0105243_101834863 322
238 3300009174 Ga0105241_10016951 Ga0105241_100169515 322
239 3300009176 Ga0105242_10024010 Ga0105242_100240104 322
240 3300009176 Ga0105242_10116331 Ga0105242_101163313 322
241 3300009177 Ga0105248_10025370 Ga0105248_100253704 322
242 3300009177 Ga0105248_10139556 Ga0105248_101395562 322
243 3300009177 Ga0105248_10504392 Ga0105248_105043922 322
244 3300009177 Ga0105248_10524433 Ga0105248_105244332 322
245 3300009545 Ga0105237_10240195 Ga0105237_102401952 322
246 3300009551 Ga0105238_10142138 Ga0105238_101421384 322
247 3300009553 Ga0105249_10052207 Ga0105249_100522074 322
248 3300009553 Ga0105249_10157012 Ga0105249_101570121 322
249 3300010375 Ga0105239_10041139 Ga0105239_100411392 322
250 3300010375 Ga0105239_10241618 Ga0105239_102416183 322
251 3300013105 Ga0157369_10037254 Ga0157369_100372544 322
252 3300013105 Ga0157369_10317110 Ga0157369_103171101 322
253 3300013297 Ga0157378_10004170 Ga0157378_100041705 322
254 3300013297 Ga0157378_10018715 Ga0157378_100187154 322
255 3300013297 Ga0157378_10233954 Ga0157378_102339542 322
256 3300013306 Ga0163162_10028264 Ga0163162_100282643 322
257 3300013306 Ga0163162_10067993 Ga0163162_100679934 322
258 3300013306 Ga0163162_10235442 Ga0163162_102354423 322
259 3300013308 Ga0157375_10065112 Ga0157375_100651123 322
260 3300013308 Ga0157375_10116734 Ga0157375_101167342 322
261 3300014325 Ga0163163_10028972 Ga0163163_100289724 322
262 3300014325 Ga0163163_10166862 Ga0163163_101668624 322
263 3300014326 Ga0157380_10115522 Ga0157380_101155223 322
264 3300014968 Ga0157379_10111799 Ga0157379_101117993 322
265 3300014968 Ga0157379_10338276 Ga0157379_103382762 322
266 3300025898 Ga0207692_10012890 Ga0207692_100128902 322
267 3300025900 Ga0207710_10029645 Ga0207710_100296453 322
268 3300025903 Ga0207680_10109826 Ga0207680_101098262 322
269 3300025906 Ga0207699_10006696 Ga0207699_100066967 322
270 3300025906 Ga0207699_10142572 Ga0207699_101425722 322
271 3300025907 Ga0207645_10098622 Ga0207645_100986223 322
272 3300025908 Ga0207643_10006821 Ga0207643_100068216 322
273 3300025908 Ga0207643_10020177 Ga0207643_100201773 322
274 3300025911 Ga0207654_10074592 Ga0207654_100745923 322
275 3300025912 Ga0207707_10038762 Ga0207707_100387626 322
276 3300025912 Ga0207707_10063322 Ga0207707_100633222 322
277 3300025912 Ga0207707_10064152 Ga0207707_100641521 322
278 3300025912 Ga0207707_10066297 Ga0207707_100662971 322
279 3300025912 Ga0207707_10402987 Ga0207707_104029872 322
280 3300025913 Ga0207695_10003170 Ga0207695_100031702 322
281 3300025913 Ga0207695_10023762 Ga0207695_100237627 322
282 3300025913 Ga0207695_10082369 Ga0207695_100823694 322
283 3300025913 Ga0207695_10115487 Ga0207695_101154872 322
284 3300025913 Ga0207695_10230519 Ga0207695_102305192 322
285 3300025914 Ga0207671_10062646 Ga0207671_100626462 322
286 3300025915 Ga0207693_10001234 Ga0207693_1000123415 322
287 3300025916 Ga0207663_10006531 Ga0207663_100065316 322
288 3300025916 Ga0207663_10117890 Ga0207663_101178901 322
289 3300025917 Ga0207660_10168812 Ga0207660_101688122 322
290 3300025919 Ga0207657_10055502 Ga0207657_100555025 322
291 3300025921 Ga0207652_10057102 Ga0207652_100571024 322
292 3300025921 Ga0207652_10204081 Ga0207652_102040812 322
293 3300025921 Ga0207652_10293729 Ga0207652_102937291 322
294 3300025924 Ga0207694_10146747 Ga0207694_101467473 322
295 3300025925 Ga0207650_10011754 Ga0207650_100117542 322
296 3300025925 Ga0207650_10046810 Ga0207650_100468103 322
297 3300025927 Ga0207687_10211478 Ga0207687_102114781 322
298 3300025928 Ga0207700_10054744 Ga0207700_100547442 322
299 3300025928 Ga0207700_10435057 Ga0207700_104350571 322
300 3300025931 Ga0207644_10015950 Ga0207644_100159502 322
301 3300025933 Ga0207706_10002897 Ga0207706_1000289718 322
302 3300025934 Ga0207686_10146386 Ga0207686_101463862 322
303 3300025938 Ga0207704_10010809 Ga0207704_100108095 322
304 3300025938 Ga0207704_10037899 Ga0207704_100378993 322
305 3300025938 Ga0207704_10070279 Ga0207704_100702791 322
306 3300025940 Ga0207691_10003327 Ga0207691_1000332717 322
307 3300025940 Ga0207691_10250750 Ga0207691_102507501 322
308 3300025941 Ga0207711_10091677 Ga0207711_100916774 322
309 3300025941 Ga0207711_10119829 Ga0207711_101198292 322
310 3300025942 Ga0207689_10004890 Ga0207689_100048907 322
311 3300025949 Ga0207667_10041325 Ga0207667_100413253 322
312 3300025949 Ga0207667_10102787 Ga0207667_101027874 322
313 3300025961 Ga0207712_10067832 Ga0207712_100678321 322
314 3300025961 Ga0207712_10289281 Ga0207712_102892812 322
315 3300025986 Ga0207658_10000537 Ga0207658_1000053724 322
316 3300025986 Ga0207658_10284589 Ga0207658_102845892 322
317 3300026035 Ga0207703_10001045 Ga0207703_1000104515 322
318 3300026035 Ga0207703_10052811 Ga0207703_100528114 322
319 3300026035 Ga0207703_10143532 Ga0207703_101435323 322
320 3300026041 Ga0207639_10025171 Ga0207639_100251714 322
321 3300026067 Ga0207678_10008217 Ga0207678_100082174 322
322 3300026075 Ga0207708_10036622 Ga0207708_100366222 322
323 3300026078 Ga0207702_10175164 Ga0207702_101751643 322
324 3300026088 Ga0207641_10000411 Ga0207641_1000041143 322
325 3300026089 Ga0207648_10007413 Ga0207648_1000741310 322
326 3300026118 Ga0207675_100010449 Ga0207675_1000104496 322
327 3300026118 Ga0207675_100017408 Ga0207675_1000174088 322
328 3300026118 Ga0207675_100041297 Ga0207675_1000412974 322
329 3300026121 Ga0207683_10007349 Ga0207683_100073495 322
330 3300026142 Ga0207698_10183605 Ga0207698_101836051 322
331 3300027617 Ga0210002_1001515 Ga0210002_10015154 322
332 3300027665 Ga0209983_1004621 Ga0209983_10046214 322
333 3300027717 Ga0209998_10000543 Ga0209998_1000054310 322
334 3300027876 Ga0209974_10002288 Ga0209974_100022888 322
335 3300027907 Ga0207428_10314727 Ga0207428_103147272 322
336 3300028379 Ga0268266_10229532 Ga0268266_102295322 322
337 3300028380 Ga0268265_10227270 Ga0268265_102272701 322
338 3300028381 Ga0268264_10000044 Ga0268264_1000004442 322
339 3300028381 Ga0268264_10103428 Ga0268264_101034281 322
340 3300028573 Ga0265334_10000295 Ga0265334_1000029518 322
341 3300030878 Ga0265770_1000245 Ga0265770_10002457 322
342 3300031090 Ga0265760_10001456 Ga0265760_100014568 322
343 3300031247 Ga0265340_10021798 Ga0265340_100217983 322
344 3300031548 Ga0307408_100285961 Ga0307408_1002859611 322
345 3300031665 Ga0316575_10010821 Ga0316575_100108212 322
346 3300031691 Ga0316579_10079534 Ga0316579_100795342 322
347 3300031727 Ga0316576_10001138 Ga0316576_100011386 322
348 3300031727 Ga0316576_10001697 Ga0316576_100016976 322
349 3300031727 Ga0316576_10012083 Ga0316576_100120833 322
350 3300031727 Ga0316576_10033460 Ga0316576_100334605 322
351 3300031727 Ga0316576_10036207 Ga0316576_100362074 322
352 3300031727 Ga0316576_10060184 Ga0316576_100601843 322
353 3300031727 Ga0316576_10105730 Ga0316576_101057301 322
354 3300031727 Ga0316576_10232853 Ga0316576_102328532 322
355 3300031728 Ga0316578_10004070 Ga0316578_100040708 322
356 3300031730 Ga0307516_10000192 Ga0307516_1000019260 322
357 3300031733 Ga0316577_10005308 Ga0316577_100053083 322
358 3300031733 Ga0316577_10056760 Ga0316577_100567601 322
359 3300031733 Ga0316577_10127383 Ga0316577_101273832 322
360 3300031733 Ga0316577_10150741 Ga0316577_101507411 322
361 3300031901 Ga0307406_10093084 Ga0307406_100930842 322
362 3300032002 Ga0307416_100183266 Ga0307416_1001832663 322
363 3300032126 Ga0307415_100023683 Ga0307415_1000236834 322
364 3300032137 Ga0316585_10007703 Ga0316585_100077034 322
365 3300032137 Ga0316585_10014801 Ga0316585_100148012 322
366 3300032139 Ga0316580_10001419 Ga0316580_100014197 322
367 3300032139 Ga0316580_10032035 Ga0316580_100320351 322
368 3300032168 Ga0316593_10003203 Ga0316593_100032035 322
369 3300032168 Ga0316593_10017888 Ga0316593_100178885 322
370 3300032168 Ga0316593_10025404 Ga0316593_100254042 322
371 3300033524 Ga0316592_1000643 Ga0316592_10006433 322
372 3300033527 Ga0316586_1000900 Ga0316586_10009004 322
373 3300033528 Ga0316588_1004255 Ga0316588_10042552 322
374 3300033528 Ga0316588_1035382 Ga0316588_10353821 322
375 3300033541 Ga0316596_1000326 Ga0316596_10003265 322
376 3300033541 Ga0316596_1001983 Ga0316596_10019832 322
377 3300033541 Ga0316596_1022874 Ga0316596_10228741 322
378 3300035118 Ga0373954_0012268 Ga0373954_0012268_300_1307 322
379 3300035118 Ga0373954_0111101 Ga0373954_0111101_11_979 322
380 3300035119 Ga0373956_0030548 Ga0373956_0030548_204_1211 322
381 3300035172 Ga0373955_0114472 Ga0373955_0114472_361_1368 322
382 3300035398 Ga0316574_0004484 Ga0316574_0004484_4938_5906 322
383 3300035398 Ga0316574_0005552 Ga0316574_0005552_5587_6555 322
384 3300035398 Ga0316574_0015255 Ga0316574_0015255_479_1477 322
385 3300035398 Ga0316574_0023565 Ga0316574_0023565_1184_2182 322
386 3300035398 Ga0316574_0024393 Ga0316574_0024393_276_1244 322
387 3300035398 Ga0316574_0026337 Ga0316574_0026337_597_1595 322
388 3300035398 Ga0316574_0028676 Ga0316574_0028676_1800_2768 322
389 3300035398 Ga0316574_0099706 Ga0316574_0099706_624_1592 322
390 3300035398 Ga0316574_0138353 Ga0316574_0138353_276_1244 322
391 3300035398 Ga0316574_0161403 Ga0316574_0161403_93_1130 322
392 3300035692 Ga0373935_0290758 Ga0373935_0290758_58_1026 322
393 3300035724 Ga0373933_0049783 Ga0373933_0049783_722_1690 322
394 3300036401 Ga0373937_0041733 Ga0373937_0041733_1542_2510 322
395 3300036401 Ga0373937_0181504 Ga0373937_0181504_821_1789 322
396 3300036647 Ga0316582_0006462 Ga0316582_0006462_2191_3228 322
397 3300036647 Ga0316582_0008198 Ga0316582_0008198_1190_2158 322
398 3300036647 Ga0316582_0009363 Ga0316582_0009363_982_1950 322
399 3300036647 Ga0316582_0017164 Ga0316582_0017164_1855_2934 322
400 3300036647 Ga0316582_0024601 Ga0316582_0024601_739_1707 322
401 3300036647 Ga0316582_0028998 Ga0316582_0028998_807_1808 322
402 3300036647 Ga0316582_0049441 Ga0316582_0049441_1476_2444 322
403 3300036647 Ga0316582_0087636 Ga0316582_0087636_217_1185 322
404 3300036712 Ga0316584_0000874 Ga0316584_0000874_9117_10085 322
405 3300036712 Ga0316584_0006333 Ga0316584_0006333_1580_2548 322
406 3300036712 Ga0316584_0014390 Ga0316584_0014390_258_1226 322
407 3300036712 Ga0316584_0016626 Ga0316584_0016626_3991_5070 322
408 3300036712 Ga0316584_0022953 Ga0316584_0022953_2549_3517 322
409 3300036712 Ga0316584_0024836 Ga0316584_0024836_347_1384 322
410 3300036712 Ga0316584_0146981 Ga0316584_0146981_227_1225 322
411 3300036712 Ga0316584_0190236 Ga0316584_0190236_215_1183 322
412 3300036712 Ga0316584_0203701 Ga0316584_0203701_352_1320 322
413 3300037068 Ga0373925_0122502 Ga0373925_0122502_88_1095 322
414 3300037466 Ga0395898_0006120 Ga0395898_0006120_9276_10244 322
415 3300037588 Ga0316581_0041692 Ga0316581_0041692_271_1239 322
416 3300037588 Ga0316581_0061549 Ga0316581_0061549_149_1117 322
417 3300039110 Ga0400487_09541 Ga0400487_09541_199_1167 322
418 3300042876 Ga0451577_0045489 Ga0451577_0045489_1067_2035 322
419 3300042876 Ga0451577_0105454 Ga0451577_0105454_735_1703 322
420 3300046472 Ga0495580_0004037 Ga0495580_0004037_523_1530 322
421 3300046514 Ga0495618_0071963 Ga0495618_0071963_70_1077 322
422 3300046517 Ga0495630_0199654 Ga0495630_0199654_217_1224 322
423 3300046519 Ga0495632_0126876 Ga0495632_0126876_80_1048 322
424 3300046681 Ga0495647_0025687 Ga0495647_0025687_1068_2075 322
425 3300046681 Ga0495647_0025742 Ga0495647_0025742_928_1920 322
426 3300047319 Ga0495674_0178645 Ga0495674_0178645_702_1709 322
427 3300048903 Ga0496100_0051687 Ga0496100_0051687_91_1059 322
428 3300048903 Ga0496100_0053077 Ga0496100_0053077_1367_2374 322
429 3300048904 Ga0496101_0039210 Ga0496101_0039210_682_1689 322
430 3300048905 Ga0496102_0238112 Ga0496102_0238112_27_1034 322
431 3300048907 Ga0496104_0017591 Ga0496104_0017591_2107_3099 322
432 3300048908 Ga0496105_0009915 Ga0496105_0009915_196_1203 322
433 3300048908 Ga0496105_0011289 Ga0496105_0011289_2645_3637 322
434 3300048909 Ga0496106_0014237 Ga0496106_0014237_3390_4397 322
435 3300048910 Ga0496107_0073989 Ga0496107_0073989_127_1134 322
436 3300048911 Ga0496108_0075858 Ga0496108_0075858_1469_2476 322
437 3300048912 Ga0496109_0008587 Ga0496109_0008587_383_1390 322
438 3300048913 Ga0496110_0003769 Ga0496110_0003769_1502_2509 322
439 3300048914 Ga0496111_0019260 Ga0496111_0019260_3313_4320 322
440 3300048915 Ga0496112_0031109 Ga0496112_0031109_758_1765 322
441 3300048915 Ga0496112_0398966 Ga0496112_0398966_140_1117 322
442 3300048915 Ga0496112_0552494 Ga0496112_0552494_15_983 322
443 3300048916 Ga0496113_0114120 Ga0496113_0114120_194_1201 322
444 3300048917 Ga0496114_0005168 Ga0496114_0005168_6604_7611 322
445 3300048917 Ga0496114_0006907 Ga0496114_0006907_7795_8787 322
446 3300048918 Ga0496115_0030854 Ga0496115_0030854_386_1378 322
447 3300048918 Ga0496115_0096678 Ga0496115_0096678_729_1736 322
448 3300048928 Ga0496125_0000112 Ga0496125_0000112_177370_178338 322
449 3300049580 Ga0501046_0053374 Ga0501046_0053374_499_1467 322
450 3300049581 Ga0501047_0004958 Ga0501047_0004958_9760_10728 322
451 3300049742 Ga0501080_0054775 Ga0501080_0054775_2245_3213 322
452 3300049822 Ga0501035_0086616 Ga0501035_0086616_777_1745 322
453 3300049823 Ga0501044_0002082 Ga0501044_0002082_19436_20404 322
454 3300050508 nmdc:mga09592_363528_c1 nmdc:mga09592_363528_c1_166_1134 322
455 3300050509 nmdc:mga0qj67_157329_c1 nmdc:mga0qj67_157329_c1_819_1787 322
456 3300050511 nmdc:mga08y16_34404_c1 nmdc:mga08y16_34404_c1_2779_3747 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00348

polyprenyl_synt

Polyprenyl synthetase

105

353

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4jyx-assembly1.cif.gz_G-2 crystal structure of polyprenyl synthase patl_3739 (target efi-509195) from pseudoalteromonas atlantica, complex with inorganic phosphate and an unknown ligand 0.9726 1 318
3wjn-assembly1.cif.gz_B crystal structure of octaprenyl pyrophosphate synthase from escherichia coli with farnesyl s-thiol-pyrophosphate (fspp) 0.9726 1 320
3wjk-assembly1.cif.gz_B crystal structure of octaprenyl pyrophosphate synthase from escherichia coli 0.97 1 320
4jxy-assembly1.cif.gz_A crystal structure of polyprenyl synthase patl_3739 (target efi-509195) from pseudoalteromonas atlantica 0.9699 1 318
3wjn-assembly1.cif.gz_B crystal structure of octaprenyl pyrophosphate synthase from escherichia coli with farnesyl s-thiol-pyrophosphate (fspp) 0.9694 1 320
ID Description Score Start End Superfamily
af_P0AD57_1_323_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9829 1 318 1.10.600.10
af_P0AD57_1_323_1.10.600.10 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9679 1 318 1.10.600.10
3oyrB00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9646 2 322 1.10.600.10
3oyrB00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.9588 2 322 1.10.600.10
4lobA00 Mainly Alpha;Orthogonal Bundle;Farnesyl Diphosphate Synthase;Farnesyl Diphosphate Synthase 0.951 7 318 1.10.600.10
ID Description Score Start End GO Terms
AF-A0A848QII3-F1-model_v4 deleted 0.9937 48 280
AF-A0A1W1DC72-F1-model_v4 Octaprenyl diphosphate synthase / Dimethylallyltransferase / (2E,6E)-farnesyl diphosphate synthase / Geranylgeranyl pyrophosphate synthetase (EC 2.5.1.1, EC 2.5.1.10, EC 2.5.1.29, EC 2.5.1.90) 0.992 72 322 GO:0004161
GO:0004311
GO:0004337
GO:0008299
GO:0106350
AF-A0A340YEE5-F1-model_v4 deleted 0.9902 116 318
AF-A0A2S5LC44-F1-model_v4 Octaprenyl diphosphate synthase 0.9891 123 322 GO:0004659
GO:0008299
AF-A0A4Q6CVP5-F1-model_v4 deleted 0.989 76 322

Feature Viewer

pLDDT pTM Quality
90.91 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map