F447963

General Info

Members Datasets Scaffolds Average Seq Length
457 238 914 265

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100015549|Ga0070665_1000155497
Length 285
Sequence MTGEGENASLLRRVRRAASADGTAQNHIIRIRGLVNGFGDKIIHDHIDLDVCRGEVLGVVGGSGSGKSVLMRSIIGLIHPKEGDVRVFGEPTCGDIEGSAMRRLEMRWGVLFQEGALFSSQTVAENIQVPLREYTKMSQTLMDEIAAMKIAMVGLPPDTCNKYPSELSGGMKKRAGLARALALDPELLFLDEPTAGLDPISANQFDELINQLQESLGLTVMMVTHDIDTLHAVTDRIAVLVNKKLVIGTIDELRKNQDPWIKDYFSGVRGRAALSAMDLASQEAH

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
52 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
82 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
83 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
84 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
85 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
86 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
130 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
133 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
134 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
135 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
150 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
151 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
162 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
163 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
170 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
171 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
172 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
173 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
174 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
175 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
176 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
180 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
181 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
182 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
203 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
204 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
214 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
219 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
220 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
221 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
222 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
223 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
224 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
225 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
226 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
229 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
233 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
234 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
235 2842694124 Methylopila sp. R-72369 Isolate Unclassified
236 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
237 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
238 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.69
Metatranscriptomes 0
Isolates 1.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.6
Nodule 0.22
Rhizoplane 0.66
Rhizosphere 91.03
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100015549 3300005548 Bacteria 7643
2 JGI25151J46595_10001012 3300003187 Bacteria 21230
3 JGI25153J46596_10001304 3300003215 Bacteria 14944
4 JGI25160J50197_1022236 3300003354 Bacteria 1863
5 Ga0065707_10082983 3300005295 Bacteria 11043
6 Ga0065707_10220948 3300005295 Bacteria 1225
7 Ga0070658_10018547 3300005327 Bacteria 5571
8 Ga0070658_10213339 3300005327 Bacteria 1631
9 Ga0070658_10221903 3300005327 Bacteria 1599
10 Ga0070683_100618244 3300005329 Bacteria 1037
11 Ga0068869_100095935 3300005334 Bacteria 2238
12 Ga0070666_10032582 3300005335 Bacteria 3443
13 Ga0070680_100365866 3300005336 Bacteria 1227
14 Ga0068868_100348562 3300005338 Bacteria 1268
15 Ga0070661_100001122 3300005344 Bacteria 18807
16 Ga0070661_100286740 3300005344 Bacteria 1279
17 Ga0070669_100017193 3300005353 Bacteria 5160
18 Ga0070674_100079587 3300005356 Bacteria 2338
19 Ga0070659_100022636 3300005366 Bacteria 4798
20 Ga0070659_100541302 3300005366 Bacteria 996
21 Ga0070667_100133922 3300005367 Bacteria 2165
22 Ga0070709_10000178 3300005434 Bacteria 40284
23 Ga0070710_10084176 3300005437 Bacteria 1863
24 Ga0070711_100013345 3300005439 Bacteria 5158
25 Ga0070711_100142632 3300005439 Bacteria 1798
26 Ga0070705_100227084 3300005440 Bacteria 1296
27 Ga0070678_100029987 3300005456 Bacteria 3732
28 Ga0070681_10000021 3300005458 Bacteria 116877
29 Ga0070681_10042836 3300005458 Bacteria 4536
30 Ga0070681_10149357 3300005458 Bacteria 2264
31 Ga0070681_10370413 3300005458 Bacteria 1343
32 Ga0068867_100025132 3300005459 Bacteria 4272
33 Ga0070698_100128726 3300005471 Bacteria 2488
34 Ga0070699_100084393 3300005518 Bacteria 2772
35 Ga0070679_100000298 3300005530 Bacteria 42304
36 Ga0070679_100063581 3300005530 Bacteria 3678
37 Ga0070679_100455277 3300005530 Bacteria 1224
38 Ga0070684_100160171 3300005535 Bacteria 2041
39 Ga0070697_100193861 3300005536 Bacteria 1725
40 Ga0068853_100002435 3300005539 Bacteria 13925
41 Ga0068853_100029250 3300005539 Bacteria 4643
42 Ga0068853_100722662 3300005539 Bacteria 951
43 Ga0070672_100088542 3300005543 Bacteria 2493
44 Ga0070696_100061224 3300005546 Bacteria 2633
45 Ga0070696_100187913 3300005546 Bacteria 1536
46 Ga0070696_100193195 3300005546 Bacteria 1516
47 Ga0070665_100028487 3300005548 Bacteria 5624
48 Ga0070665_100033362 3300005548 Bacteria 5180
49 Ga0070665_100276682 3300005548 Bacteria 1680
50 Ga0070665_100305193 3300005548 Bacteria 1595
51 Ga0070665_100560768 3300005548 Bacteria 1155
52 Ga0068855_100000010 3300005563 Bacteria 246022
53 Ga0068855_100041788 3300005563 Bacteria 5433
54 Ga0070664_100194752 3300005564 Bacteria 1807
55 Ga0068857_100035745 3300005577 Bacteria 4401
56 Ga0068857_100655922 3300005577 Bacteria 995
57 Ga0068856_100000460 3300005614 Bacteria 44894
58 Ga0068852_100033092 3300005616 Bacteria 4288
59 Ga0068852_100043727 3300005616 Bacteria 3800
60 Ga0068864_100188444 3300005618 Bacteria 1889
61 Ga0068866_10040570 3300005718 Bacteria 2305
62 Ga0068866_10063599 3300005718 Bacteria 1924
63 Ga0068861_100158084 3300005719 Bacteria 1867
64 Ga0068863_100019194 3300005841 Bacteria 6544
65 Ga0068858_100137048 3300005842 Bacteria 2297
66 Ga0068860_100126911 3300005843 Bacteria 2445
67 Ga0081538_10001311 3300005981 Bacteria 25698
68 Ga0081540_1014990 3300005983 Bacteria 4926
69 Ga0081539_10066835 3300005985 Bacteria 1947
70 Ga0070716_100033515 3300006173 Bacteria 2810
71 Ga0070712_100001600 3300006175 Bacteria 13842
72 Ga0070712_100002867 3300006175 Bacteria 10680
73 Ga0097621_100000693 3300006237 Bacteria 23626
74 Ga0097621_100006007 3300006237 Bacteria 8580
75 Ga0097621_100056985 3300006237 Bacteria 3193
76 Ga0097621_100058996 3300006237 Bacteria 3141
77 Ga0068871_100000385 3300006358 Bacteria 31027
78 Ga0068871_100007249 3300006358 Bacteria 7909
79 Ga0068871_100023375 3300006358 Bacteria 4780
80 Ga0068871_100151738 3300006358 Bacteria 1976
81 Ga0075428_100168090 3300006844 Bacteria 2379
82 Ga0075430_100139643 3300006846 Bacteria 2018
83 Ga0075431_100163961 3300006847 Bacteria 2285
84 Ga0075431_100444660 3300006847 Bacteria 1293
85 Ga0075434_100128878 3300006871 Bacteria 2548
86 Ga0068865_100014874 3300006881 Bacteria 4952
87 Ga0068865_100104501 3300006881 Bacteria 2079
88 Ga0075436_100000327 3300006914 Bacteria 30470
89 Ga0105250_10000010 3300009092 Bacteria 298384
90 Ga0105240_10000675 3300009093 Bacteria 62663
91 Ga0105240_10055789 3300009093 Bacteria 4946
92 Ga0105240_10141303 3300009093 Bacteria 2878
93 Ga0105240_10166144 3300009093 Bacteria 2617
94 Ga0105240_10216515 3300009093 Bacteria 2234
95 Ga0111539_10000097 3300009094 Bacteria 91946
96 Ga0111539_10029470 3300009094 Bacteria 6685
97 Ga0105241_10060420 3300009174 Bacteria 2916
98 Ga0105241_10138379 3300009174 Bacteria 1979
99 Ga0105241_10308760 3300009174 Bacteria 1360
100 Ga0105242_10004594 3300009176 Bacteria 10703
101 Ga0105242_10048968 3300009176 Bacteria 3437
102 Ga0105242_10273544 3300009176 Bacteria 1531
103 Ga0105242_10309813 3300009176 Bacteria 1444
104 Ga0105248_10000009 3300009177 Bacteria 403549
105 Ga0105248_10013067 3300009177 Bacteria 9147
106 Ga0105248_10784978 3300009177 Bacteria 1075
107 Ga0105237_10053669 3300009545 Bacteria 4042
108 Ga0105237_10181238 3300009545 Bacteria 2106
109 Ga0105238_10013230 3300009551 Bacteria 8325
110 Ga0105238_10014297 3300009551 Bacteria 8024
111 Ga0105238_10028247 3300009551 Bacteria 5716
112 Ga0105238_10061746 3300009551 Bacteria 3749
113 Ga0105238_10451340 3300009551 Bacteria 1283
114 Ga0105249_10013501 3300009553 Bacteria 7213
115 Ga0105249_10193256 3300009553 Bacteria 1987
116 Ga0105239_10001127 3300010375 Bacteria 36856
117 Ga0105239_10008108 3300010375 Bacteria 11989
118 Ga0105239_10012933 3300010375 Bacteria 9285
119 Ga0105239_10026242 3300010375 Bacteria 6413
120 Ga0105239_10149364 3300010375 Bacteria 2608
121 Ga0105239_10482877 3300010375 Bacteria 1408
122 Ga0157373_10107571 3300013100 Bacteria 1960
123 Ga0157371_10172691 3300013102 Bacteria 1545
124 Ga0157371_10278521 3300013102 Bacteria 1208
125 Ga0157370_10097457 3300013104 Bacteria 2758
126 Ga0157370_10109201 3300013104 Bacteria 2586
127 Ga0157369_10004375 3300013105 Bacteria 16679
128 Ga0157369_10016283 3300013105 Bacteria 8370
129 Ga0157369_10040284 3300013105 Bacteria 5100
130 Ga0157369_10451944 3300013105 Bacteria 1330
131 Ga0157374_10047290 3300013296 Bacteria 3989
132 Ga0157374_10135570 3300013296 Bacteria 2386
133 Ga0157378_10070393 3300013297 Bacteria 3141
134 Ga0157378_10136840 3300013297 Bacteria 2271
135 Ga0157378_10364101 3300013297 Bacteria 1416
136 Ga0163162_10018409 3300013306 Bacteria 6844
137 Ga0163162_10315001 3300013306 Bacteria 1697
138 Ga0163162_10389860 3300013306 Bacteria 1526
139 Ga0157372_10126980 3300013307 Bacteria 2933
140 Ga0157372_10219921 3300013307 Bacteria 2202
141 Ga0157375_10012677 3300013308 Bacteria 7482
142 Ga0163163_10028135 3300014325 Bacteria 5393
143 Ga0163163_10119109 3300014325 Bacteria 2673
144 Ga0163163_10189245 3300014325 Bacteria 2107
145 Ga0163163_10593439 3300014325 Bacteria 1171
146 Ga0157380_10008620 3300014326 Bacteria 7287
147 Ga0157380_10021230 3300014326 Bacteria 4868
148 Ga0182008_10095222 3300014497 Bacteria 1469
149 Ga0157379_10001252 3300014968 Bacteria 20605
150 Ga0157379_10021519 3300014968 Bacteria 5709
151 Ga0157379_10223953 3300014968 Bacteria 1704
152 Ga0157379_10597410 3300014968 Bacteria 1030
153 Ga0157376_10123241 3300014969 Bacteria 2301
154 Ga0213872_10047570 3300021361 Bacteria 1950
155 Ga0213876_10001119 3300021384 Bacteria 17114
156 Ga0209130_1001492 3300025284 Bacteria 15195
157 Ga0209025_1000509 3300025294 Bacteria 74336
158 Ga0209758_1000085 3300025297 Bacteria 256191
159 Ga0209758_1004952 3300025297 Bacteria 10671
160 Ga0207426_1000080 3300025302 Bacteria 304917
161 Ga0209257_1000376 3300025304 Bacteria 89065
162 Ga0207696_1000159 3300025711 Bacteria 111473
163 Ga0207682_10165229 3300025893 Bacteria 1005
164 Ga0207692_10101400 3300025898 Bacteria 1581
165 Ga0207642_10081845 3300025899 Bacteria 1570
166 Ga0207680_10022243 3300025903 Bacteria 3445
167 Ga0207699_10000207 3300025906 Bacteria 35120
168 Ga0207705_10213023 3300025909 Bacteria 1466
169 Ga0207654_10077895 3300025911 Bacteria 1988
170 Ga0207654_10104370 3300025911 Bacteria 1752
171 Ga0207707_10000002 3300025912 Bacteria 1142054
172 Ga0207707_10056532 3300025912 Bacteria 3414
173 Ga0207707_10061304 3300025912 Bacteria 3273
174 Ga0207695_10000003 3300025913 Bacteria 1368691
175 Ga0207695_10037544 3300025913 Bacteria 5226
176 Ga0207695_10063309 3300025913 Bacteria 3814
177 Ga0207695_10170681 3300025913 Bacteria 2100
178 Ga0207695_10171572 3300025913 Bacteria 2094
179 Ga0207695_10193866 3300025913 Bacteria 1948
180 Ga0207671_10047897 3300025914 Bacteria 3163
181 Ga0207671_10098378 3300025914 Bacteria 2213
182 Ga0207693_10001241 3300025915 Bacteria 22688
183 Ga0207693_10001861 3300025915 Bacteria 18466
184 Ga0207663_10007220 3300025916 Bacteria 5748
185 Ga0207663_10406781 3300025916 Bacteria 1042
186 Ga0207660_10001679 3300025917 Bacteria 14829
187 Ga0207660_10297293 3300025917 Bacteria 1285
188 Ga0207649_10000284 3300025920 Bacteria 39562
189 Ga0207649_10313488 3300025920 Bacteria 1150
190 Ga0207652_10000223 3300025921 Bacteria 59425
191 Ga0207652_10093595 3300025921 Bacteria 2645
192 Ga0207652_10214260 3300025921 Bacteria 1735
193 Ga0207681_10076899 3300025923 Bacteria 2345
194 Ga0207694_10000011 3300025924 Bacteria 417640
195 Ga0207694_10024377 3300025924 Bacteria 4594
196 Ga0207694_10349679 3300025924 Bacteria 1223
197 Ga0207694_10424667 3300025924 Bacteria 1108
198 Ga0207700_10044486 3300025928 Bacteria 3269
199 Ga0207700_10141276 3300025928 Bacteria 1979
200 Ga0207686_10111036 3300025934 Bacteria 1849
201 Ga0207686_10120705 3300025934 Bacteria 1784
202 Ga0207669_10032719 3300025937 Bacteria 2924
203 Ga0207669_10174833 3300025937 Bacteria 1533
204 Ga0207691_10066690 3300025940 Bacteria 3256
205 Ga0207711_10000003 3300025941 Bacteria 1042791
206 Ga0207711_10000005 3300025941 Bacteria 822972
207 Ga0207711_10000015 3300025941 Bacteria 494097
208 Ga0207711_10014384 3300025941 Bacteria 6571
209 Ga0207711_10024895 3300025941 Bacteria 5021
210 Ga0207689_10110624 3300025942 Bacteria 2258
211 Ga0207679_10315022 3300025945 Bacteria 1353
212 Ga0207667_10000093 3300025949 Bacteria 145814
213 Ga0207667_10621456 3300025949 Bacteria 1088
214 Ga0207712_10154103 3300025961 Bacteria 1778
215 Ga0207668_10443620 3300025972 Bacteria 1106
216 Ga0207703_10266268 3300026035 Bacteria 1551
217 Ga0207703_10370078 3300026035 Bacteria 1323
218 Ga0207639_10002042 3300026041 Bacteria 13609
219 Ga0207639_10084713 3300026041 Bacteria 2518
220 Ga0207639_10116746 3300026041 Bacteria 2186
221 Ga0207639_10512746 3300026041 Bacteria 1097
222 Ga0207702_10000148 3300026078 Bacteria 81831
223 Ga0207702_10490222 3300026078 Bacteria 1197
224 Ga0207641_10037982 3300026088 Bacteria 4024
225 Ga0207648_10015939 3300026089 Bacteria 6886
226 Ga0207648_10299676 3300026089 Bacteria 1441
227 Ga0207674_10054895 3300026116 Bacteria 4054
228 Ga0207674_10217079 3300026116 Bacteria 1861
229 Ga0207675_100025854 3300026118 Bacteria 5461
230 Ga0207683_10006884 3300026121 Bacteria 9737
231 Ga0207698_10030504 3300026142 Bacteria 3878
232 Ga0207698_10127384 3300026142 Bacteria 2168
233 Ga0207428_10000211 3300027907 Bacteria 80851
234 Ga0268266_10012052 3300028379 Bacteria 7483
235 Ga0268266_10025276 3300028379 Bacteria 5054
236 Ga0268266_10025815 3300028379 Bacteria 4999
237 Ga0268266_10045306 3300028379 Bacteria 3762
238 Ga0268266_10090872 3300028379 Bacteria 2676
239 Ga0268266_10246070 3300028379 Bacteria 1652
240 Ga0268264_10220961 3300028381 Bacteria 1744
241 Ga0268264_10256628 3300028381 Bacteria 1626
242 Ga0265318_10000052 3300028577 Bacteria 116086
243 Ga0307517_10101456 3300028786 Bacteria 2265
244 Ga0265338_10000007 3300028800 Bacteria 498229
245 Ga0265338_10007062 3300028800 Bacteria 14081
246 Ga0265338_10031164 3300028800 Bacteria 5231
247 Ga0265338_10100839 3300028800 Bacteria 2353
248 Ga0265338_10144248 3300028800 Bacteria 1860
249 Ga0265330_10001764 3300031235 Bacteria 12154
250 Ga0265330_10063995 3300031235 Bacteria 1598
251 Ga0265325_10000001 3300031241 Bacteria 726814
252 Ga0265325_10000490 3300031241 Bacteria 28750
253 Ga0265325_10048835 3300031241 Bacteria 2186
254 Ga0265340_10000265 3300031247 Bacteria 27074
255 Ga0265340_10005274 3300031247 Bacteria 7175
256 Ga0265339_10000812 3300031249 Bacteria 24127
257 Ga0265339_10063003 3300031249 Bacteria 1992
258 Ga0265331_10000020 3300031250 Bacteria 258149
259 Ga0265331_10000611 3300031250 Bacteria 31257
260 Ga0265331_10014875 3300031250 Bacteria 4127
261 Ga0265331_10016642 3300031250 Bacteria 3855
262 Ga0265327_10000076 3300031251 Bacteria 212272
263 Ga0265316_10002042 3300031344 Bacteria 21259
264 Ga0265316_10012782 3300031344 Bacteria 7500
265 Ga0265316_10027551 3300031344 Bacteria 4703
266 Ga0265316_10204975 3300031344 Bacteria 1461
267 Ga0265316_10329919 3300031344 Bacteria 1107
268 Ga0307513_10165332 3300031456 Bacteria 2098
269 Ga0307513_10280439 3300031456 Bacteria 1444
270 Ga0307408_100107917 3300031548 Bacteria 2133
271 Ga0265313_10004377 3300031595 Bacteria 10900
272 Ga0265313_10007052 3300031595 Bacteria 7776
273 Ga0265313_10013494 3300031595 Bacteria 4898
274 Ga0265313_10032555 3300031595 Bacteria 2660
275 Ga0307508_10123110 3300031616 Bacteria 2196
276 Ga0265314_10018015 3300031711 Bacteria 5522
277 Ga0265314_10039188 3300031711 Bacteria 3416
278 Ga0265314_10067635 3300031711 Bacteria 2405
279 Ga0265314_10101169 3300031711 Bacteria 1852
280 Ga0265342_10026505 3300031712 Bacteria 3630
281 Ga0307516_10009947 3300031730 Bacteria 10535
282 Ga0307516_10024010 3300031730 Bacteria 6235
283 Ga0307516_10306345 3300031730 Bacteria 1263
284 Ga0307405_10427439 3300031731 Bacteria 1044
285 Ga0307410_10129491 3300031852 Bacteria 1852
286 Ga0307406_10230373 3300031901 Bacteria 1383
287 Ga0307406_10325002 3300031901 Bacteria 1192
288 Ga0307416_100230012 3300032002 Bacteria 1787
289 Ga0307416_100620102 3300032002 Bacteria 1163
290 Ga0307415_100224723 3300032126 Bacteria 1508
291 Ga0373954_0043567 3300035118 Bacteria 2093
292 Ga0373957_0225012 3300035120 Bacteria 786
293 Ga0373931_0268237 3300035691 Bacteria 1044
294 Ga0373927_0234168 3300035695 Bacteria 1207
295 Ga0373933_0035079 3300035724 Bacteria 2927
296 Ga0373947_0151908 3300035725 Bacteria 1492
297 Ga0373937_0002502 3300036401 Bacteria 15266
298 Ga0373937_0014736 3300036401 Bacteria 6902
299 Ga0373937_0068439 3300036401 Bacteria 3273
300 Ga0373937_0259725 3300036401 Bacteria 1638
301 Ga0373925_0019559 3300037068 Bacteria 4927
302 Ga0373925_0094193 3300037068 Bacteria 2293
303 Ga0373925_0216858 3300037068 Bacteria 1526
304 Ga0395900_0111346 3300037418 Bacteria 2812
305 Ga0395905_0102062 3300037471 Bacteria 2693
306 Ga0436365_0428631 3300039437 Bacteria 1982
307 Ga0436365_1122293 3300039437 Bacteria 76517
308 Ga0436360_0662483 3300039438 Bacteria 943
309 Ga0436361_0250859 3300039447 Bacteria 3049
310 Ga0436361_0839909 3300039447 Bacteria 5145
311 Ga0451789_0427557 3300041443 Bacteria 937
312 Ga0451849_1218451 3300041505 Bacteria 2825
313 Ga0466967_0379653 3300045976 Bacteria 1372
314 Ga0466967_0540169 3300045976 Bacteria 1147
315 Ga0495580_0031639 3300046472 Bacteria 3822
316 Ga0495610_0028080 3300046512 Bacteria 2981
317 Ga0495610_0032421 3300046512 Bacteria 2713
318 Ga0495630_0254115 3300046517 Bacteria 1343
319 Ga0495652_0219112 3300046529 Bacteria 1431
320 Ga0495645_0030652 3300046543 Bacteria 3918
321 Ga0495645_0137737 3300046543 Bacteria 1706
322 Ga0495622_0004441 3300046557 Bacteria 6511
323 Ga0495622_0108797 3300046557 Bacteria 1269
324 Ga0495657_0299655 3300046675 Bacteria 959
325 Ga0495599_0312024 3300046678 Bacteria 948
326 Ga0495649_0162296 3300046694 Bacteria 1171
327 Ga0495600_0339378 3300046809 Bacteria 942
328 Ga0495636_0145249 3300047318 Bacteria 1062
329 Ga0495614_0206616 3300048089 Bacteria 890
330 Ga0496106_0403501 3300048909 Bacteria 1099
331 Ga0496115_0030245 3300048918 Bacteria 4259
332 Ga0496121_0001026 3300048924 Bacteria 49755
333 Ga0496126_0000314 3300048929 Bacteria 102938
334 Ga0495682_0001385 3300049460 Bacteria 13229
335 Ga0501031_0003980 3300049568 Bacteria 9524
336 Ga0501032_0002111 3300049569 Bacteria 15684
337 Ga0501032_0165540 3300049569 Bacteria 1451
338 Ga0501033_0004856 3300049570 Bacteria 10709
339 Ga0501033_0062572 3300049570 Bacteria 2740
340 Ga0501033_0075211 3300049570 Bacteria 2479
341 Ga0501033_0172522 3300049570 Bacteria 1553
342 Ga0501033_0207314 3300049570 Bacteria 1399
343 Ga0501033_0396787 3300049570 Bacteria 962
344 Ga0501034_0020103 3300049571 Bacteria 6817
345 Ga0501034_0098911 3300049571 Bacteria 2912
346 Ga0501034_0294579 3300049571 Bacteria 1560
347 Ga0501036_0001296 3300049572 Bacteria 19151
348 Ga0501036_0072405 3300049572 Bacteria 2913
349 Ga0501036_0186385 3300049572 Bacteria 1746
350 Ga0501037_0008096 3300049573 Bacteria 7701
351 Ga0501037_0402080 3300049573 Bacteria 939
352 Ga0501038_0049545 3300049574 Bacteria 3631
353 Ga0501038_0255724 3300049574 Bacteria 1386
354 Ga0501038_0264483 3300049574 Bacteria 1358
355 Ga0501039_0012399 3300049575 Bacteria 6507
356 Ga0501039_0156708 3300049575 Bacteria 1789
357 Ga0501040_0027902 3300049576 Bacteria 3803
358 Ga0501042_0010598 3300049578 Bacteria 6190
359 Ga0501043_0018973 3300049579 Bacteria 5397
360 Ga0501043_0075151 3300049579 Bacteria 2654
361 Ga0501046_0005546 3300049580 Bacteria 11274
362 Ga0501046_0023333 3300049580 Bacteria 5091
363 Ga0501046_0043026 3300049580 Bacteria 3598
364 Ga0501047_0077273 3300049581 Bacteria 3203
365 Ga0501047_0132393 3300049581 Bacteria 2374
366 Ga0501047_0170216 3300049581 Bacteria 2047
367 Ga0501047_0232860 3300049581 Bacteria 1695
368 Ga0501047_0281494 3300049581 Bacteria 1507
369 Ga0501048_0018168 3300049582 Bacteria 5172
370 Ga0501067_0007353 3300049583 Bacteria 6118
371 Ga0501068_0010615 3300049584 Bacteria 5181
372 Ga0501069_0005623 3300049585 Bacteria 6523
373 Ga0501069_0007791 3300049585 Bacteria 5623
374 Ga0501069_0011486 3300049585 Bacteria 4692
375 Ga0501070_0011350 3300049586 Bacteria 7527
376 Ga0501070_0040006 3300049586 Bacteria 3910
377 Ga0501070_0056464 3300049586 Bacteria 3255
378 Ga0501070_0124466 3300049586 Bacteria 2131
379 Ga0501071_0480465 3300049587 Bacteria 952
380 Ga0501072_0068692 3300049588 Bacteria 2797
381 Ga0501072_0197023 3300049588 Bacteria 1606
382 Ga0501073_0024731 3300049589 Bacteria 4311
383 Ga0501073_0027941 3300049589 Bacteria 4030
384 Ga0501073_0054368 3300049589 Bacteria 2803
385 Ga0501073_0143448 3300049589 Bacteria 1655
386 Ga0501074_0001757 3300049590 Bacteria 14801
387 Ga0501074_0037729 3300049590 Bacteria 3501
388 Ga0501075_0026629 3300049591 Bacteria 4259
389 Ga0501076_0041094 3300049592 Bacteria 3636
390 Ga0501077_0007245 3300049593 Bacteria 6842
391 Ga0501077_0111900 3300049593 Bacteria 1731
392 Ga0501079_0009757 3300049741 Bacteria 7280
393 Ga0501079_0013267 3300049741 Bacteria 6282
394 Ga0501079_0042922 3300049741 Bacteria 3491
395 Ga0501080_0014487 3300049742 Bacteria 7263
396 Ga0501080_0093293 3300049742 Bacteria 2795
397 Ga0501080_0212649 3300049742 Bacteria 1772
398 Ga0501080_0261205 3300049742 Bacteria 1578
399 Ga0501080_0318600 3300049742 Bacteria 1408
400 Ga0501080_0627321 3300049742 Bacteria 953
401 Ga0501081_0036485 3300049743 Bacteria 3353
402 Ga0501083_0004403 3300049744 Bacteria 9927
403 Ga0501083_0016604 3300049744 Bacteria 5148
404 Ga0501083_0043904 3300049744 Bacteria 3027
405 Ga0501083_0069804 3300049744 Bacteria 2338
406 Ga0501083_0125673 3300049744 Bacteria 1681
407 Ga0501035_0006403 3300049822 Bacteria 11069
408 Ga0501035_0049075 3300049822 Bacteria 3783
409 Ga0501035_0068802 3300049822 Bacteria 3139
410 Ga0501035_0164909 3300049822 Bacteria 1916
411 Ga0501035_0179002 3300049822 Bacteria 1828
412 Ga0501035_0492714 3300049822 Bacteria 1009
413 Ga0501044_0031230 3300049823 Bacteria 5607
414 Ga0501044_0034904 3300049823 Bacteria 5269
415 Ga0501044_0044502 3300049823 Bacteria 4606
416 Ga0501044_0060970 3300049823 Bacteria 3860
417 Ga0501044_0215921 3300049823 Bacteria 1870
418 Ga0501044_0565456 3300049823 Bacteria 1033
419 Ga0501045_0019349 3300049824 Bacteria 4853
420 nmdc:mga0qj67_149203_c1 3300050509 Bacteria 1896
421 nmdc:mga0qj67_79788_c1 3300050509 Bacteria 2621
422 nmdc:mga08y16_179_c1 3300050511 Bacteria 56078
423 nmdc:mga08y16_31003_c1 3300050511 Bacteria 5623
424 nmdc:mga0n895_71556_c1 3300050512 Bacteria 3439
425 nmdc:mga0n895_94786_c1 3300050512 Bacteria 2989
426 nmdc:mga0rr50_49135_c1 3300050513 Bacteria 3122
427 nmdc:mga08x19_30592_c1 3300050514 Bacteria 3383
428 nmdc:mga08x19_80_c1 3300050514 Bacteria 87696
429 Ga0500643_000026 3300053087 Bacteria 259231
430 Ga0500646_0046224 3300053090 Bacteria 1242
431 Ga0500555_041375 3300053103 Bacteria 1282
432 Ga0500595_053801 3300053119 Bacteria 1238
433 Ga0500642_0000303 3300053130 Bacteria 17604
434 Ga0500642_0114234 3300053130 Bacteria 1261
435 Ga0500652_077618 3300053131 Bacteria 1381
436 Ga0500559_0034131 3300053136 Bacteria 2193
437 Ga0500573_0000004 3300053140 Bacteria 341236
438 Ga0500616_0007964 3300053153 Bacteria 6652
439 Ga0500619_002422 3300053154 Bacteria 3588
440 Ga0500609_007097 3300053731 Bacteria 1514
441 Ga0501084_0000236 3300054114 Bacteria 41685
442 Ga0501084_0002143 3300054114 Bacteria 15776
443 Ga0501084_0016171 3300054114 Bacteria 6195
444 Ga0501082_0013502 3300060353 Bacteria 7017
445 Ga0501082_0052921 3300060353 Bacteria 3500
446 Ga0501082_0061525 3300060353 Bacteria 3232
447 Ga0501082_0078996 3300060353 Bacteria 2838
448 Ga0501082_0110761 3300060353 Bacteria 2376
449 Ga0501082_0588416 3300060353 Bacteria 974
450 Ga0501082_0659674 3300060353 Bacteria 916
451 Ga0530510_0023651 3300061734 Bacteria 4381
452 2821449315 2821443989 Bacteria 7658172
453 2842340115 2842333319 Bacteria 8899485
454 2842696960 2842694124 Bacteria 4063419
455 2844538605 2844533157 Bacteria 7517899
456 2883293173 2883291878 Bacteria 5894118
457 2883356156 2883354860 Bacteria 5865246
458 Ga0070665_100015549
459 JGI25151J46595_10001012
460 JGI25153J46596_10001304
461 JGI25160J50197_1022236
462 Ga0065707_10082983
463 Ga0065707_10220948
464 Ga0070658_10018547
465 Ga0070658_10213339
466 Ga0070658_10221903
467 Ga0070683_100618244
468 Ga0068869_100095935
469 Ga0070666_10032582
470 Ga0070680_100365866
471 Ga0068868_100348562
472 Ga0070661_100001122
473 Ga0070661_100286740
474 Ga0070669_100017193
475 Ga0070674_100079587
476 Ga0070659_100022636
477 Ga0070659_100541302
478 Ga0070667_100133922
479 Ga0070709_10000178
480 Ga0070710_10084176
481 Ga0070711_100013345
482 Ga0070711_100142632
483 Ga0070705_100227084
484 Ga0070678_100029987
485 Ga0070681_10000021
486 Ga0070681_10042836
487 Ga0070681_10149357
488 Ga0070681_10370413
489 Ga0068867_100025132
490 Ga0070698_100128726
491 Ga0070699_100084393
492 Ga0070679_100000298
493 Ga0070679_100063581
494 Ga0070679_100455277
495 Ga0070684_100160171
496 Ga0070697_100193861
497 Ga0068853_100002435
498 Ga0068853_100029250
499 Ga0068853_100722662
500 Ga0070672_100088542
501 Ga0070696_100061224
502 Ga0070696_100187913
503 Ga0070696_100193195
504 Ga0070665_100028487
505 Ga0070665_100033362
506 Ga0070665_100276682
507 Ga0070665_100305193
508 Ga0070665_100560768
509 Ga0068855_100000010
510 Ga0068855_100041788
511 Ga0070664_100194752
512 Ga0068857_100035745
513 Ga0068857_100655922
514 Ga0068856_100000460
515 Ga0068852_100033092
516 Ga0068852_100043727
517 Ga0068864_100188444
518 Ga0068866_10040570
519 Ga0068866_10063599
520 Ga0068861_100158084
521 Ga0068863_100019194
522 Ga0068858_100137048
523 Ga0068860_100126911
524 Ga0081538_10001311
525 Ga0081540_1014990
526 Ga0081539_10066835
527 Ga0070716_100033515
528 Ga0070712_100001600
529 Ga0070712_100002867
530 Ga0097621_100000693
531 Ga0097621_100006007
532 Ga0097621_100056985
533 Ga0097621_100058996
534 Ga0068871_100000385
535 Ga0068871_100007249
536 Ga0068871_100023375
537 Ga0068871_100151738
538 Ga0075428_100168090
539 Ga0075430_100139643
540 Ga0075431_100163961
541 Ga0075431_100444660
542 Ga0075434_100128878
543 Ga0068865_100014874
544 Ga0068865_100104501
545 Ga0075436_100000327
546 Ga0105250_10000010
547 Ga0105240_10000675
548 Ga0105240_10055789
549 Ga0105240_10141303
550 Ga0105240_10166144
551 Ga0105240_10216515
552 Ga0111539_10000097
553 Ga0111539_10029470
554 Ga0105241_10060420
555 Ga0105241_10138379
556 Ga0105241_10308760
557 Ga0105242_10004594
558 Ga0105242_10048968
559 Ga0105242_10273544
560 Ga0105242_10309813
561 Ga0105248_10000009
562 Ga0105248_10013067
563 Ga0105248_10784978
564 Ga0105237_10053669
565 Ga0105237_10181238
566 Ga0105238_10013230
567 Ga0105238_10014297
568 Ga0105238_10028247
569 Ga0105238_10061746
570 Ga0105238_10451340
571 Ga0105249_10013501
572 Ga0105249_10193256
573 Ga0105239_10001127
574 Ga0105239_10008108
575 Ga0105239_10012933
576 Ga0105239_10026242
577 Ga0105239_10149364
578 Ga0105239_10482877
579 Ga0157373_10107571
580 Ga0157371_10172691
581 Ga0157371_10278521
582 Ga0157370_10097457
583 Ga0157370_10109201
584 Ga0157369_10004375
585 Ga0157369_10016283
586 Ga0157369_10040284
587 Ga0157369_10451944
588 Ga0157374_10047290
589 Ga0157374_10135570
590 Ga0157378_10070393
591 Ga0157378_10136840
592 Ga0157378_10364101
593 Ga0163162_10018409
594 Ga0163162_10315001
595 Ga0163162_10389860
596 Ga0157372_10126980
597 Ga0157372_10219921
598 Ga0157375_10012677
599 Ga0163163_10028135
600 Ga0163163_10119109
601 Ga0163163_10189245
602 Ga0163163_10593439
603 Ga0157380_10008620
604 Ga0157380_10021230
605 Ga0182008_10095222
606 Ga0157379_10001252
607 Ga0157379_10021519
608 Ga0157379_10223953
609 Ga0157379_10597410
610 Ga0157376_10123241
611 Ga0213872_10047570
612 Ga0213876_10001119
613 Ga0209130_1001492
614 Ga0209025_1000509
615 Ga0209758_1000085
616 Ga0209758_1004952
617 Ga0207426_1000080
618 Ga0209257_1000376
619 Ga0207696_1000159
620 Ga0207682_10165229
621 Ga0207692_10101400
622 Ga0207642_10081845
623 Ga0207680_10022243
624 Ga0207699_10000207
625 Ga0207705_10213023
626 Ga0207654_10077895
627 Ga0207654_10104370
628 Ga0207707_10000002
629 Ga0207707_10056532
630 Ga0207707_10061304
631 Ga0207695_10000003
632 Ga0207695_10037544
633 Ga0207695_10063309
634 Ga0207695_10170681
635 Ga0207695_10171572
636 Ga0207695_10193866
637 Ga0207671_10047897
638 Ga0207671_10098378
639 Ga0207693_10001241
640 Ga0207693_10001861
641 Ga0207663_10007220
642 Ga0207663_10406781
643 Ga0207660_10001679
644 Ga0207660_10297293
645 Ga0207649_10000284
646 Ga0207649_10313488
647 Ga0207652_10000223
648 Ga0207652_10093595
649 Ga0207652_10214260
650 Ga0207681_10076899
651 Ga0207694_10000011
652 Ga0207694_10024377
653 Ga0207694_10349679
654 Ga0207694_10424667
655 Ga0207700_10044486
656 Ga0207700_10141276
657 Ga0207686_10111036
658 Ga0207686_10120705
659 Ga0207669_10032719
660 Ga0207669_10174833
661 Ga0207691_10066690
662 Ga0207711_10000003
663 Ga0207711_10000005
664 Ga0207711_10000015
665 Ga0207711_10014384
666 Ga0207711_10024895
667 Ga0207689_10110624
668 Ga0207679_10315022
669 Ga0207667_10000093
670 Ga0207667_10621456
671 Ga0207712_10154103
672 Ga0207668_10443620
673 Ga0207703_10266268
674 Ga0207703_10370078
675 Ga0207639_10002042
676 Ga0207639_10084713
677 Ga0207639_10116746
678 Ga0207639_10512746
679 Ga0207702_10000148
680 Ga0207702_10490222
681 Ga0207641_10037982
682 Ga0207648_10015939
683 Ga0207648_10299676
684 Ga0207674_10054895
685 Ga0207674_10217079
686 Ga0207675_100025854
687 Ga0207683_10006884
688 Ga0207698_10030504
689 Ga0207698_10127384
690 Ga0207428_10000211
691 Ga0268266_10012052
692 Ga0268266_10025276
693 Ga0268266_10025815
694 Ga0268266_10045306
695 Ga0268266_10090872
696 Ga0268266_10246070
697 Ga0268264_10220961
698 Ga0268264_10256628
699 Ga0265318_10000052
700 Ga0307517_10101456
701 Ga0265338_10000007
702 Ga0265338_10007062
703 Ga0265338_10031164
704 Ga0265338_10100839
705 Ga0265338_10144248
706 Ga0265330_10001764
707 Ga0265330_10063995
708 Ga0265325_10000001
709 Ga0265325_10000490
710 Ga0265325_10048835
711 Ga0265340_10000265
712 Ga0265340_10005274
713 Ga0265339_10000812
714 Ga0265339_10063003
715 Ga0265331_10000020
716 Ga0265331_10000611
717 Ga0265331_10014875
718 Ga0265331_10016642
719 Ga0265327_10000076
720 Ga0265316_10002042
721 Ga0265316_10012782
722 Ga0265316_10027551
723 Ga0265316_10204975
724 Ga0265316_10329919
725 Ga0307513_10165332
726 Ga0307513_10280439
727 Ga0307408_100107917
728 Ga0265313_10004377
729 Ga0265313_10007052
730 Ga0265313_10013494
731 Ga0265313_10032555
732 Ga0307508_10123110
733 Ga0265314_10018015
734 Ga0265314_10039188
735 Ga0265314_10067635
736 Ga0265314_10101169
737 Ga0265342_10026505
738 Ga0307516_10009947
739 Ga0307516_10024010
740 Ga0307516_10306345
741 Ga0307405_10427439
742 Ga0307410_10129491
743 Ga0307406_10230373
744 Ga0307406_10325002
745 Ga0307416_100230012
746 Ga0307416_100620102
747 Ga0307415_100224723
748 Ga0373954_0043567
749 Ga0373957_0225012
750 Ga0373931_0268237
751 Ga0373927_0234168
752 Ga0373933_0035079
753 Ga0373947_0151908
754 Ga0373937_0002502
755 Ga0373937_0014736
756 Ga0373937_0068439
757 Ga0373937_0259725
758 Ga0373925_0019559
759 Ga0373925_0094193
760 Ga0373925_0216858
761 Ga0395900_0111346
762 Ga0395905_0102062
763 Ga0436365_0428631
764 Ga0436365_1122293
765 Ga0436360_0662483
766 Ga0436361_0250859
767 Ga0436361_0839909
768 Ga0451789_0427557
769 Ga0451849_1218451
770 Ga0466967_0379653
771 Ga0466967_0540169
772 Ga0495580_0031639
773 Ga0495610_0028080
774 Ga0495610_0032421
775 Ga0495630_0254115
776 Ga0495652_0219112
777 Ga0495645_0030652
778 Ga0495645_0137737
779 Ga0495622_0004441
780 Ga0495622_0108797
781 Ga0495657_0299655
782 Ga0495599_0312024
783 Ga0495649_0162296
784 Ga0495600_0339378
785 Ga0495636_0145249
786 Ga0495614_0206616
787 Ga0496106_0403501
788 Ga0496115_0030245
789 Ga0496121_0001026
790 Ga0496126_0000314
791 Ga0495682_0001385
792 Ga0501031_0003980
793 Ga0501032_0002111
794 Ga0501032_0165540
795 Ga0501033_0004856
796 Ga0501033_0062572
797 Ga0501033_0075211
798 Ga0501033_0172522
799 Ga0501033_0207314
800 Ga0501033_0396787
801 Ga0501034_0020103
802 Ga0501034_0098911
803 Ga0501034_0294579
804 Ga0501036_0001296
805 Ga0501036_0072405
806 Ga0501036_0186385
807 Ga0501037_0008096
808 Ga0501037_0402080
809 Ga0501038_0049545
810 Ga0501038_0255724
811 Ga0501038_0264483
812 Ga0501039_0012399
813 Ga0501039_0156708
814 Ga0501040_0027902
815 Ga0501042_0010598
816 Ga0501043_0018973
817 Ga0501043_0075151
818 Ga0501046_0005546
819 Ga0501046_0023333
820 Ga0501046_0043026
821 Ga0501047_0077273
822 Ga0501047_0132393
823 Ga0501047_0170216
824 Ga0501047_0232860
825 Ga0501047_0281494
826 Ga0501048_0018168
827 Ga0501067_0007353
828 Ga0501068_0010615
829 Ga0501069_0005623
830 Ga0501069_0007791
831 Ga0501069_0011486
832 Ga0501070_0011350
833 Ga0501070_0040006
834 Ga0501070_0056464
835 Ga0501070_0124466
836 Ga0501071_0480465
837 Ga0501072_0068692
838 Ga0501072_0197023
839 Ga0501073_0024731
840 Ga0501073_0027941
841 Ga0501073_0054368
842 Ga0501073_0143448
843 Ga0501074_0001757
844 Ga0501074_0037729
845 Ga0501075_0026629
846 Ga0501076_0041094
847 Ga0501077_0007245
848 Ga0501077_0111900
849 Ga0501079_0009757
850 Ga0501079_0013267
851 Ga0501079_0042922
852 Ga0501080_0014487
853 Ga0501080_0093293
854 Ga0501080_0212649
855 Ga0501080_0261205
856 Ga0501080_0318600
857 Ga0501080_0627321
858 Ga0501081_0036485
859 Ga0501083_0004403
860 Ga0501083_0016604
861 Ga0501083_0043904
862 Ga0501083_0069804
863 Ga0501083_0125673
864 Ga0501035_0006403
865 Ga0501035_0049075
866 Ga0501035_0068802
867 Ga0501035_0164909
868 Ga0501035_0179002
869 Ga0501035_0492714
870 Ga0501044_0031230
871 Ga0501044_0034904
872 Ga0501044_0044502
873 Ga0501044_0060970
874 Ga0501044_0215921
875 Ga0501044_0565456
876 Ga0501045_0019349
877 nmdc:mga0qj67_149203_c1
878 nmdc:mga0qj67_79788_c1
879 nmdc:mga08y16_179_c1
880 nmdc:mga08y16_31003_c1
881 nmdc:mga0n895_71556_c1
882 nmdc:mga0n895_94786_c1
883 nmdc:mga0rr50_49135_c1
884 nmdc:mga08x19_30592_c1
885 nmdc:mga08x19_80_c1
886 Ga0500643_000026
887 Ga0500646_0046224
888 Ga0500555_041375
889 Ga0500595_053801
890 Ga0500642_0000303
891 Ga0500642_0114234
892 Ga0500652_077618
893 Ga0500559_0034131
894 Ga0500573_0000004
895 Ga0500616_0007964
896 Ga0500619_002422
897 Ga0500609_007097
898 Ga0501084_0000236
899 Ga0501084_0002143
900 Ga0501084_0016171
901 Ga0501082_0013502
902 Ga0501082_0052921
903 Ga0501082_0061525
904 Ga0501082_0078996
905 Ga0501082_0110761
906 Ga0501082_0588416
907 Ga0501082_0659674
908 Ga0530510_0023651
909 2821449315
910 2842340115
911 2842696960
912 2844538605
913 2883293173
914 2883356156

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

44

195

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ch8-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9662 17 256
7ch8-assembly1.cif.gz_I cryo-em structure of p.aeruginosa mlafebd with adp-v 0.9645 17 256
7cha-assembly1.cif.gz_J cryo-em structure of p.aeruginosa mlafebd with amppnp 0.962 17 256
7d06-assembly1.cif.gz_B cryo em structure of the nucleotide free acinetobacter mlafedb complex 0.9536 17 256
8fee-assembly1.cif.gz_H structure of mce1 transporter from mycobacterium smegmatis in the absence of lucb (map2) 0.9484 16 256
ID Description Score Start End Superfamily
af_P9WQL5_26_341_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.973 19 253 3.40.50.300
af_P63386_5_251_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.961 17 257 3.40.50.300
af_Q2G1F8_275_530_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9453 18 256 3.40.50.300
af_Q2G1L8_1_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9447 17 235 3.40.50.300
af_P16678_3_252_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9431 17 253 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A522AFW5-F1-model_v4 ATP-binding cassette domain-containing protein 0.9863 17 260 GO:0005524
GO:0016887
AF-A0A3C0VK17-F1-model_v4 ABC transporter ATP-binding protein 0.966 17 257 GO:0005524
GO:0016887
AF-F5P099-F1-model_v4 ABC transporter family protein 0.9623 16 238 GO:0005524
GO:0016887
AF-X1D8U0-F1-model_v4 ABC transporter domain-containing protein 0.9595 33 256 GO:0005524
GO:0015833
GO:0016887
GO:0055085
AF-A0A6I5VRF0-F1-model_v4 ATP-binding cassette domain-containing protein 0.9579 33 253 GO:0005524
GO:0015833
GO:0016887
GO:0055085

Map