F448022

General Info

Members Datasets Scaffolds Average Seq Length
457 270 914 92

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_1501898|Ga0395900_1501898_91_354
Length 87
Sequence MADKVKLHRCPVMFLKIPGHPCHKVQKALDEQGIEYEVVKHGRNREQVEALSGQRKLPFLELQDGQIYREESAEMAARIRAGGLGSP

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
3 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
155 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
156 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
157 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
160 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
162 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
163 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
170 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
171 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
172 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
173 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
174 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
175 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
176 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
180 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
181 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
182 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
187 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
190 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
191 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
192 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
196 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
197 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
198 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
201 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
202 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
203 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
208 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
212 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
213 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
214 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
228 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
229 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
230 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
231 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
242 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
243 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
244 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
249 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
250 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
254 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
255 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
256 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
257 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
261 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
262 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
263 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
264 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
265 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
266 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
267 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
268 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.44
Nodule 0
Rhizoplane 13.13
Rhizosphere 85.56
Stem 0
Stem Tuber 0
Unclassified 11.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_1501898 3300037418 Bacteria 586
2 JGI24745J21846_1047664 3300002073 Bacteria 539
3 JGI24748J21848_1004859 3300002074 Bacteria 1548
4 JGI24034J26672_10000242 3300002239 Bacteria 7228
5 JGI24034J26672_10108930 3300002239 Bacteria 528
6 JGI24742J22300_10000304 3300002244 Bacteria 7292
7 Ga0070683_100001599 3300005329 Bacteria 17519
8 Ga0070683_100258940 3300005329 Bacteria 1655
9 Ga0070683_100302088 3300005329 Bacteria 1523
10 Ga0070690_101257664 3300005330 Bacteria 592
11 Ga0070670_101211841 3300005331 Bacteria 690
12 Ga0068869_100035879 3300005334 Bacteria 3518
13 Ga0070666_10372740 3300005335 Unclassified 1024
14 Ga0068868_100000537 3300005338 Bacteria 25429
15 Ga0068868_100002702 3300005338 Bacteria 12306
16 Ga0070660_100001486 3300005339 Bacteria 16058
17 Ga0070691_10072818 3300005341 Bacteria 1669
18 Ga0070687_101083867 3300005343 Bacteria 585
19 Ga0070661_100000031 3300005344 Bacteria 113816
20 Ga0070661_100209368 3300005344 Bacteria 1492
21 Ga0070668_100340057 3300005347 Bacteria 1268
22 Ga0070675_100799509 3300005354 Bacteria 862
23 Ga0070659_100030321 3300005366 Bacteria 4185
24 Ga0070659_100184354 3300005366 Bacteria 1714
25 Ga0070667_100310123 3300005367 Bacteria 1422
26 Ga0070667_100931006 3300005367 Unclassified 809
27 Ga0070703_10158240 3300005406 Bacteria 857
28 Ga0070714_100027543 3300005435 Bacteria 4707
29 Ga0070714_100457491 3300005435 Bacteria 1213
30 Ga0070714_101473424 3300005435 Bacteria 665
31 Ga0070713_100184841 3300005436 Bacteria 1875
32 Ga0070713_101074037 3300005436 Bacteria 778
33 Ga0070710_10548766 3300005437 Bacteria 798
34 Ga0070710_10744039 3300005437 Bacteria 696
35 Ga0070711_100374170 3300005439 Bacteria 1150
36 Ga0070711_100660023 3300005439 Unclassified 878
37 Ga0070711_101030009 3300005439 Unclassified 707
38 Ga0070711_101385216 3300005439 Bacteria 612
39 Ga0070705_101159852 3300005440 Unclassified 635
40 Ga0070700_100138702 3300005441 Bacteria 1650
41 Ga0070694_101908888 3300005444 Bacteria 507
42 Ga0070678_100442650 3300005456 Bacteria 1137
43 Ga0070678_101665963 3300005456 Bacteria 600
44 Ga0070662_100000079 3300005457 Bacteria 53583
45 Ga0070662_100047904 3300005457 Bacteria 3077
46 Ga0070681_10228147 3300005458 Bacteria 1777
47 Ga0068867_100311117 3300005459 Bacteria 1302
48 Ga0068867_101063318 3300005459 Bacteria 737
49 Ga0070685_10171856 3300005466 Bacteria 1389
50 Ga0070679_100429660 3300005530 Bacteria 1266
51 Ga0070684_100055308 3300005535 Bacteria 3459
52 Ga0068853_100164783 3300005539 Bacteria 2002
53 Ga0070672_101712036 3300005543 Bacteria 565
54 Ga0070686_100189026 3300005544 Bacteria 1469
55 Ga0070696_101287662 3300005546 Bacteria 620
56 Ga0070693_100001830 3300005547 Bacteria 9710
57 Ga0070693_100480563 3300005547 Bacteria 878
58 Ga0070665_100822414 3300005548 Bacteria 942
59 Ga0070665_101094981 3300005548 Unclassified 808
60 Ga0070704_100085825 3300005549 Bacteria 2331
61 Ga0068855_100012772 3300005563 Bacteria 10129
62 Ga0070664_100437926 3300005564 Bacteria 1199
63 Ga0070664_101264801 3300005564 Bacteria 697
64 Ga0068854_100114507 3300005578 Bacteria 2039
65 Ga0068856_100000675 3300005614 Bacteria 36933
66 Ga0068856_100063460 3300005614 Bacteria 3650
67 Ga0070702_100076887 3300005615 Bacteria 1988
68 Ga0068859_100227600 3300005617 Bacteria 1953
69 Ga0068864_100282076 3300005618 Bacteria 1551
70 Ga0068866_11471809 3300005718 Bacteria 500
71 Ga0068861_100336546 3300005719 Bacteria 1320
72 Ga0068851_10289907 3300005834 Bacteria 938
73 Ga0068870_10015947 3300005840 Bacteria 3578
74 Ga0068858_100037064 3300005842 Bacteria 4521
75 Ga0068860_100880374 3300005843 Bacteria 911
76 Ga0068860_102145445 3300005843 Bacteria 580
77 Ga0070717_10046887 3300006028 Bacteria 3538
78 Ga0070717_10068694 3300006028 Bacteria 2950
79 Ga0070717_10581245 3300006028 Bacteria 1016
80 Ga0070716_100924498 3300006173 Bacteria 685
81 Ga0070712_100392086 3300006175 Bacteria 1145
82 Ga0070712_100989246 3300006175 Bacteria 728
83 Ga0070712_102011403 3300006175 Bacteria 506
84 Ga0097621_100084066 3300006237 Bacteria 2653
85 Ga0068871_100095251 3300006358 Bacteria 2486
86 Ga0075430_100245712 3300006846 Bacteria 1483
87 Ga0075430_100776266 3300006846 Bacteria 790
88 Ga0075431_100089064 3300006847 Bacteria 3186
89 Ga0075434_100020776 3300006871 Bacteria 6373
90 Ga0075429_100445508 3300006880 Bacteria 1135
91 Ga0068865_100280639 3300006881 Bacteria 1326
92 Ga0068865_100553313 3300006881 Bacteria 966
93 Ga0097620_100227598 3300006931 Bacteria 1953
94 Ga0075435_100031092 3300007076 Bacteria 4203
95 Ga0105240_10207485 3300009093 Bacteria 2292
96 Ga0105245_10088666 3300009098 Bacteria 2842
97 Ga0105245_10449067 3300009098 Bacteria 1297
98 Ga0105247_10007153 3300009101 Bacteria 6852
99 Ga0114129_10125055 3300009147 Bacteria 3537
100 Ga0114129_11779552 3300009147 Bacteria 750
101 Ga0105243_10209901 3300009148 Bacteria 1714
102 Ga0105243_10403318 3300009148 Bacteria 1271
103 Ga0105243_10455341 3300009148 Bacteria 1202
104 Ga0105241_10026636 3300009174 Bacteria 4303
105 Ga0105242_10751146 3300009176 Bacteria 960
106 Ga0105242_11557345 3300009176 Bacteria 693
107 Ga0105248_10250403 3300009177 Bacteria 1994
108 Ga0105248_11951588 3300009177 Bacteria 666
109 Ga0105237_10197009 3300009545 Bacteria 2014
110 Ga0105238_10068456 3300009551 Bacteria 3551
111 Ga0105249_10395520 3300009553 Bacteria 1411
112 Ga0105249_13237978 3300009553 Bacteria 524
113 Ga0105239_10023158 3300010375 Bacteria 6845
114 Ga0105246_10702825 3300011119 Bacteria 886
115 Ga0105246_11658082 3300011119 Bacteria 606
116 Ga0157329_1012188 3300012491 Bacteria 700
117 Ga0157370_10002526 3300013104 Bacteria 21995
118 Ga0157369_10208060 3300013105 Bacteria 2051
119 Ga0157374_10680118 3300013296 Bacteria 1041
120 Ga0157378_10044897 3300013297 Bacteria 3925
121 Ga0157378_10131101 3300013297 Bacteria 2320
122 Ga0163162_10088796 3300013306 Bacteria 3170
123 Ga0163162_11982892 3300013306 Bacteria 667
124 Ga0157372_10511008 3300013307 Bacteria 1401
125 Ga0157375_10107304 3300013308 Bacteria 2885
126 Ga0157375_11077065 3300013308 Bacteria 940
127 Ga0163163_10001862 3300014325 Bacteria 17807
128 Ga0157380_10072463 3300014326 Bacteria 2790
129 Ga0157377_10039481 3300014745 Bacteria 2611
130 Ga0157377_10279395 3300014745 Bacteria 1094
131 Ga0157377_10363799 3300014745 Bacteria 974
132 Ga0157379_10126705 3300014968 Bacteria 2297
133 Ga0157376_10942755 3300014969 Bacteria 883
134 Ga0163161_10000140 3300017792 Bacteria 66684
135 Ga0163161_11849435 3300017792 Bacteria 537
136 Ga0163161_12048010 3300017792 Bacteria 509
137 Ga0207692_10133613 3300025898 Bacteria 1404
138 Ga0207692_10191661 3300025898 Bacteria 1197
139 Ga0207692_10747196 3300025898 Bacteria 637
140 Ga0207642_11023035 3300025899 Bacteria 532
141 Ga0207710_10204251 3300025900 Bacteria 977
142 Ga0207688_10009713 3300025901 Bacteria 5234
143 Ga0207688_10064648 3300025901 Bacteria 2066
144 Ga0207688_10423702 3300025901 Bacteria 827
145 Ga0207645_10187910 3300025907 Bacteria 1357
146 Ga0207645_10248664 3300025907 Bacteria 1176
147 Ga0207643_10019501 3300025908 Bacteria 3717
148 Ga0207705_10216254 3300025909 Bacteria 1454
149 Ga0207654_10251569 3300025911 Bacteria 1185
150 Ga0207695_10416211 3300025913 Bacteria 1228
151 Ga0207671_10089029 3300025914 Bacteria 2323
152 Ga0207693_11341403 3300025915 Bacteria 533
153 Ga0207663_10090192 3300025916 Bacteria 2032
154 Ga0207663_10249903 3300025916 Bacteria 1304
155 Ga0207663_10562099 3300025916 Viruses 893
156 Ga0207660_10620305 3300025917 Unclassified 881
157 Ga0207662_10606102 3300025918 Unclassified 762
158 Ga0207657_10015622 3300025919 Bacteria 7345
159 Ga0207649_10000021 3300025920 Bacteria 209660
160 Ga0207652_10949385 3300025921 Unclassified 758
161 Ga0207646_11904918 3300025922 Unclassified 506
162 Ga0207694_10040867 3300025924 Bacteria 3573
163 Ga0207650_10184643 3300025925 Bacteria 1664
164 Ga0207650_11554645 3300025925 Bacteria 562
165 Ga0207659_10126947 3300025926 Bacteria 1963
166 Ga0207687_10002256 3300025927 Bacteria 13140
167 Ga0207687_10890828 3300025927 Bacteria 761
168 Ga0207700_12000839 3300025928 Bacteria 506
169 Ga0207664_10068303 3300025929 Bacteria 2854
170 Ga0207664_10265748 3300025929 Bacteria 1502
171 Ga0207664_10321311 3300025929 Bacteria 1366
172 Ga0207664_11953456 3300025929 Unclassified 509
173 Ga0207690_10087119 3300025932 Bacteria 2196
174 Ga0207690_10230214 3300025932 Bacteria 1422
175 Ga0207706_10000302 3300025933 Bacteria 53541
176 Ga0207706_10024370 3300025933 Bacteria 5425
177 Ga0207706_11430699 3300025933 Unclassified 566
178 Ga0207709_10401466 3300025935 Bacteria 1048
179 Ga0207709_10624356 3300025935 Bacteria 856
180 Ga0207669_10353736 3300025937 Bacteria 1136
181 Ga0207669_10432744 3300025937 Bacteria 1038
182 Ga0207704_10252855 3300025938 Bacteria 1324
183 Ga0207665_10008999 3300025939 Bacteria 6552
184 Ga0207665_10375603 3300025939 Bacteria 1078
185 Ga0207665_10520807 3300025939 Bacteria 921
186 Ga0207691_10218373 3300025940 Bacteria 1654
187 Ga0207711_10140263 3300025941 Bacteria 2174
188 Ga0207711_11104190 3300025941 Bacteria 734
189 Ga0207689_10037631 3300025942 Bacteria 4012
190 Ga0207661_10000772 3300025944 Bacteria 20769
191 Ga0207661_10296133 3300025944 Bacteria 1449
192 Ga0207661_10515406 3300025944 Bacteria 1093
193 Ga0207661_10859345 3300025944 Bacteria 835
194 Ga0207679_11085031 3300025945 Bacteria 734
195 Ga0207679_11936186 3300025945 Bacteria 537
196 Ga0207667_10143816 3300025949 Bacteria 2455
197 Ga0207712_10280709 3300025961 Bacteria 1359
198 Ga0207712_11011063 3300025961 Bacteria 738
199 Ga0207640_10033994 3300025981 Bacteria 3178
200 Ga0207640_10095418 3300025981 Bacteria 2071
201 Ga0207640_10533685 3300025981 Bacteria 983
202 Ga0207658_10281480 3300025986 Bacteria 1426
203 Ga0207658_11073779 3300025986 Unclassified 735
204 Ga0207677_10000426 3300026023 Bacteria 28416
205 Ga0207677_10010418 3300026023 Bacteria 5259
206 Ga0207703_10009810 3300026035 Bacteria 7510
207 Ga0207639_10034322 3300026041 Bacteria 3749
208 Ga0207639_10197158 3300026041 Bacteria 1724
209 Ga0207678_10203284 3300026067 Bacteria 1694
210 Ga0207708_10002697 3300026075 Bacteria 13042
211 Ga0207708_10027112 3300026075 Bacteria 4338
212 Ga0207702_10005392 3300026078 Bacteria 11203
213 Ga0207702_10046256 3300026078 Bacteria 3663
214 Ga0207641_10938437 3300026088 Bacteria 860
215 Ga0207648_10601549 3300026089 Bacteria 1013
216 Ga0207676_10566661 3300026095 Bacteria 1087
217 Ga0207674_10273655 3300026116 Bacteria 1636
218 Ga0207675_100289637 3300026118 Bacteria 1593
219 Ga0207683_10433949 3300026121 Bacteria 1210
220 Ga0207683_11141281 3300026121 Unclassified 723
221 Ga0207698_10472722 3300026142 Bacteria 1214
222 Ga0268266_10509876 3300028379 Bacteria 1149
223 Ga0268264_10720141 3300028381 Bacteria 992
224 Ga0373934_0109498 3300035086 Unclassified 1120
225 Ga0373944_0137546 3300035089 Unclassified 853
226 Ga0373923_0114535 3300035111 Bacteria 1200
227 Ga0373936_0010004 3300035113 Bacteria 3580
228 Ga0373945_0287782 3300035116 Unclassified 701
229 Ga0373953_0222042 3300035117 Unclassified 819
230 Ga0373953_0409477 3300035117 Unclassified 597
231 Ga0373956_0198844 3300035119 Bacteria 950
232 Ga0373957_0394369 3300035120 Bacteria 595
233 Ga0373943_0035074 3300035170 Bacteria 2395
234 Ga0373943_0123984 3300035170 Bacteria 1376
235 Ga0373946_0007759 3300035171 Bacteria 3936
236 Ga0373955_0386968 3300035172 Bacteria 849
237 Ga0373924_0335828 3300035410 Bacteria 673
238 Ga0373935_0154352 3300035692 Bacteria 1560
239 Ga0373935_0302448 3300035692 Bacteria 1131
240 Ga0373935_0870430 3300035692 Bacteria 667
241 Ga0373927_0228023 3300035695 Bacteria 1224
242 Ga0373927_0904032 3300035695 Bacteria 583
243 Ga0373933_0334370 3300035724 Bacteria 983
244 Ga0373947_0049769 3300035725 Bacteria 2517
245 Ga0373947_0680923 3300035725 Unclassified 701
246 Ga0373937_0033806 3300036401 Bacteria 4647
247 Ga0373937_0217479 3300036401 Unclassified 1798
248 Ga0373937_1994223 3300036401 Unclassified 526
249 Ga0373925_0071905 3300037068 Bacteria 2616
250 Ga0395899_0303934 3300037312 Bacteria 1079
251 Ga0395898_0290412 3300037466 Bacteria 1560
252 Ga0395898_1302082 3300037466 Bacteria 656
253 Ga0395898_1838505 3300037466 Bacteria 526
254 Ga0395905_0721915 3300037471 Bacteria 899
255 Ga0395901_1029959 3300038443 Bacteria 797
256 Ga0451789_0748575 3300041443 Bacteria 572
257 Ga0451802_1817718 3300041460 Bacteria 572
258 Ga0451807_0841566 3300041486 Bacteria 574
259 Ga0451807_1234653 3300041486 Unclassified 580
260 Ga0451839_1519767 3300041496 Bacteria 1773
261 Ga0451845_0694484 3300041501 Bacteria 551
262 Ga0451849_0226317 3300041505 Unclassified 574
263 Ga0451851_0714749 3300041507 Bacteria 709
264 Ga0466963_0000002 3300044694 Bacteria 108477
265 Ga0466967_2506489 3300045976 Bacteria 511
266 Ga0495592_0000401 3300046454 Bacteria 33431
267 Ga0495603_0001815 3300046455 Bacteria 12603
268 Ga0495603_0045943 3300046455 Bacteria 2603
269 Ga0495603_0339588 3300046455 Unclassified 862
270 Ga0495629_0106248 3300046459 Bacteria 1958
271 Ga0495629_0194122 3300046459 Unclassified 1404
272 Ga0495641_0011011 3300046461 Bacteria 5186
273 Ga0495641_0093921 3300046461 Bacteria 1340
274 Ga0495651_0279651 3300046462 Unclassified 1128
275 Ga0495653_0013154 3300046463 Bacteria 6747
276 Ga0495653_0374997 3300046463 Unclassified 910
277 Ga0495580_0350121 3300046472 Bacteria 1001
278 Ga0495580_0493167 3300046472 Unclassified 818
279 Ga0495582_0000968 3300046473 Bacteria 16051
280 Ga0495582_0082860 3300046473 Bacteria 1782
281 Ga0495662_0019225 3300046476 Bacteria 3304
282 Ga0495662_0114955 3300046476 Bacteria 1319
283 Ga0495664_0165376 3300046477 Bacteria 1342
284 Ga0495664_0338463 3300046477 Bacteria 907
285 Ga0495594_0123371 3300046499 Bacteria 1465
286 Ga0495606_0000082 3300046507 Bacteria 159585
287 Ga0495608_0544151 3300046511 Unclassified 700
288 Ga0495608_0836955 3300046511 Unclassified 541
289 Ga0495618_0095749 3300046514 Bacteria 1898
290 Ga0495628_0003968 3300046516 Bacteria 13186
291 Ga0495628_0214222 3300046516 Bacteria 1448
292 Ga0495630_0000007 3300046517 Bacteria 376915
293 Ga0495630_0065775 3300046517 Bacteria 2724
294 Ga0495630_0083119 3300046517 Bacteria 2417
295 Ga0495630_0197147 3300046517 Unclassified 1536
296 Ga0495637_0211110 3300046520 Bacteria 710
297 Ga0495644_0003290 3300046523 Bacteria 6388
298 Ga0495666_0243447 3300046526 Unclassified 820
299 Ga0495652_0293288 3300046529 Bacteria 1186
300 Ga0495665_0006548 3300046531 Bacteria 6291
301 Ga0495640_0011814 3300046533 Bacteria 6699
302 Ga0495640_0293486 3300046533 Unclassified 1011
303 Ga0495586_0018068 3300046535 Bacteria 3750
304 Ga0495586_0094140 3300046535 Bacteria 1657
305 Ga0495586_0611379 3300046535 Bacteria 630
306 Ga0495587_0175350 3300046536 Unclassified 1217
307 Ga0495587_0222231 3300046536 Bacteria 1065
308 Ga0495667_0000020 3300046559 Bacteria 180876
309 Ga0495667_0016621 3300046559 Bacteria 4969
310 Ga0495667_0146162 3300046559 Bacteria 1523
311 Ga0495656_0000601 3300046615 Bacteria 11590
312 Ga0495634_0004700 3300046642 Bacteria 10617
313 Ga0495634_0028709 3300046642 Bacteria 3859
314 Ga0495634_0034476 3300046642 Bacteria 3473
315 Ga0495634_0321697 3300046642 Unclassified 931
316 Ga0495635_0000006 3300046663 Bacteria 301820
317 Ga0495635_0674499 3300046663 Unclassified 671
318 Ga0495588_0023499 3300046674 Bacteria 3053
319 Ga0495657_0463511 3300046675 Unclassified 741
320 Ga0495599_0030624 3300046678 Bacteria 3377
321 Ga0495623_0026372 3300046679 Bacteria 3741
322 Ga0495623_0497570 3300046679 Unclassified 644
323 Ga0495646_0263638 3300046680 Bacteria 920
324 Ga0495646_0359706 3300046680 Unclassified 761
325 Ga0495646_0361834 3300046680 Bacteria 759
326 Ga0495646_0486568 3300046680 Bacteria 634
327 Ga0495647_0003736 3300046681 Bacteria 4890
328 Ga0495647_0007927 3300046681 Bacteria 3567
329 Ga0495647_0256584 3300046681 Unclassified 779
330 Ga0495647_0357904 3300046681 Bacteria 665
331 Ga0495658_0027322 3300046683 Bacteria 3069
332 Ga0495658_0646597 3300046683 Bacteria 677
333 Ga0495669_0003450 3300046684 Bacteria 6516
334 Ga0495613_0116293 3300046689 Bacteria 1924
335 Ga0495613_0198957 3300046689 Bacteria 1413
336 Ga0495613_0892366 3300046689 Bacteria 576
337 Ga0495613_0939050 3300046689 Bacteria 558
338 Ga0495624_0071020 3300046690 Bacteria 2166
339 Ga0495624_0162491 3300046690 Bacteria 1364
340 Ga0495600_0406462 3300046809 Unclassified 846
341 Ga0495600_0666153 3300046809 Bacteria 628
342 Ga0495581_0090440 3300047315 Bacteria 1775
343 Ga0495581_0189373 3300047315 Bacteria 1203
344 Ga0495604_0042642 3300047317 Bacteria 3555
345 Ga0495674_0031008 3300047319 Bacteria 4859
346 Ga0495674_0207179 3300047319 Bacteria 1625
347 Ga0495674_0898367 3300047319 Unclassified 684
348 Ga0495676_0003199 3300047321 Bacteria 14801
349 Ga0495676_0018049 3300047321 Bacteria 6224
350 Ga0495676_0056755 3300047321 Bacteria 3094
351 Ga0495676_0403007 3300047321 Bacteria 907
352 Ga0495680_0002541 3300047322 Bacteria 18636
353 Ga0495680_0078421 3300047322 Bacteria 2499
354 Ga0495680_0145589 3300047322 Bacteria 1731
355 Ga0495680_0224799 3300047322 Unclassified 1338
356 Ga0495680_0278919 3300047322 Bacteria 1178
357 Ga0495680_0293820 3300047322 Bacteria 1142
358 Ga0495675_0114367 3300047444 Bacteria 1683
359 Ga0495684_0095933 3300047471 Bacteria 2244
360 Ga0495684_0649519 3300047471 Unclassified 706
361 Ga0495593_0117212 3300047673 Unclassified 1356
362 Ga0495602_0085407 3300048088 Bacteria 2637
363 Ga0495602_0467596 3300048088 Bacteria 887
364 Ga0495614_0276404 3300048089 Unclassified 772
365 Ga0496100_0000008 3300048903 Bacteria 231974
366 Ga0496100_0017726 3300048903 Bacteria 4210
367 Ga0496100_0041302 3300048903 Bacteria 2939
368 Ga0496100_0061730 3300048903 Bacteria 2470
369 Ga0496101_0000016 3300048904 Bacteria 240753
370 Ga0496101_0088907 3300048904 Bacteria 2295
371 Ga0496101_0199733 3300048904 Bacteria 1545
372 Ga0496101_0289358 3300048904 Bacteria 1282
373 Ga0496101_0420612 3300048904 Bacteria 1053
374 Ga0496101_0788366 3300048904 Bacteria 749
375 Ga0496102_0013688 3300048905 Bacteria 7032
376 Ga0496102_0208094 3300048905 Bacteria 1844
377 Ga0496102_0853796 3300048905 Bacteria 832
378 Ga0496102_0983603 3300048905 Bacteria 764
379 Ga0496103_0011325 3300048906 Bacteria 5281
380 Ga0496103_0034702 3300048906 Bacteria 3086
381 Ga0496104_0099056 3300048907 Bacteria 2790
382 Ga0496104_0574282 3300048907 Bacteria 1038
383 Ga0496104_1503050 3300048907 Bacteria 576
384 Ga0496104_1807947 3300048907 Bacteria 513
385 Ga0496105_0012466 3300048908 Bacteria 6731
386 Ga0496105_0306005 3300048908 Bacteria 1277
387 Ga0496105_0354080 3300048908 Bacteria 1172
388 Ga0496106_0000117 3300048909 Bacteria 60781
389 Ga0496106_0011766 3300048909 Bacteria 6459
390 Ga0496107_0000009 3300048910 Bacteria 231682
391 Ga0496107_0030781 3300048910 Bacteria 3826
392 Ga0496107_0061211 3300048910 Bacteria 2725
393 Ga0496108_0032738 3300048911 Bacteria 4317
394 Ga0496108_0049876 3300048911 Bacteria 3501
395 Ga0496108_0274078 3300048911 Bacteria 1469
396 Ga0496108_0659097 3300048911 Bacteria 909
397 Ga0496109_0182995 3300048912 Bacteria 1968
398 Ga0496109_0553177 3300048912 Bacteria 1085
399 Ga0496109_1828629 3300048912 Bacteria 540
400 Ga0496110_0011462 3300048913 Bacteria 7256
401 Ga0496110_0018623 3300048913 Bacteria 5824
402 Ga0496110_0539304 3300048913 Unclassified 1061
403 Ga0496110_1067991 3300048913 Bacteria 715
404 Ga0496111_0001707 3300048914 Bacteria 12830
405 Ga0496111_0032286 3300048914 Bacteria 3732
406 Ga0496112_0000191 3300048915 Bacteria 39632
407 Ga0496112_0160254 3300048915 Bacteria 2216
408 Ga0496112_0309962 3300048915 Bacteria 1523
409 Ga0496113_0018470 3300048916 Bacteria 4857
410 Ga0496113_0020059 3300048916 Bacteria 4691
411 Ga0496113_0027240 3300048916 Bacteria 4095
412 Ga0496113_0261224 3300048916 Bacteria 1383
413 Ga0496113_0497198 3300048916 Bacteria 979
414 Ga0496113_0997118 3300048916 Bacteria 660
415 Ga0496114_0058364 3300048917 Bacteria 3222
416 Ga0496114_0268687 3300048917 Bacteria 1502
417 Ga0496114_1018857 3300048917 Bacteria 711
418 Ga0496114_1282392 3300048917 Bacteria 619
419 Ga0496115_0005794 3300048918 Bacteria 8995
420 Ga0496115_0039265 3300048918 Bacteria 3758
421 Ga0501032_0335359 3300049569 Bacteria 975
422 Ga0501039_0262725 3300049575 Bacteria 1357
423 Ga0501042_0117358 3300049578 Bacteria 1916
424 Ga0501048_0118710 3300049582 Bacteria 1868
425 Ga0501068_0744525 3300049584 Bacteria 642
426 Ga0501071_0623390 3300049587 Bacteria 829
427 Ga0501072_0157311 3300049588 Bacteria 1812
428 Ga0501075_0087302 3300049591 Bacteria 2364
429 Ga0501076_0082885 3300049592 Bacteria 2575
430 Ga0501045_0394268 3300049824 Bacteria 1030
431 nmdc:mga05p37_360240_c1 3300050507 Bacteria 1710
432 nmdc:mga09592_473210_c1 3300050508 Bacteria 1080
433 nmdc:mga0qj67_366517_c1 3300050509 Bacteria 1164
434 nmdc:mga06r32_82109_c1 3300050510 Bacteria 3139
435 nmdc:mga08y16_1075208_c1 3300050511 Bacteria 781
436 nmdc:mga0n895_18977_c1 3300050512 Bacteria 6379
437 nmdc:mga0rr50_5913_c1 3300050513 Bacteria 7363
438 nmdc:mga08x19_107306_c1 3300050514 Bacteria 1859
439 nmdc:mga0a205_273157_c1 3300050515 Bacteria 1567
440 nmdc:mga0a205_4680_c1 3300050515 Bacteria 12277
441 Ga0495601_0019676 3300053077 Bacteria 4119
442 Ga0495601_0248697 3300053077 Bacteria 1161
443 Ga0495601_0586329 3300053077 Unclassified 716
444 Ga0495601_0991652 3300053077 Unclassified 528
445 Ga0495612_0035867 3300053078 Bacteria 2011
446 Ga0495612_0327326 3300053078 Unclassified 690
447 Ga0495595_0000181 3300053084 Bacteria 25220
448 Ga0495595_0060083 3300053084 Bacteria 1778
449 Ga0495595_0646142 3300053084 Bacteria 541
450 Ga0495595_0699277 3300053084 Unclassified 519
451 Ga0495619_0207815 3300053085 Unclassified 1355
452 Ga0495619_0252165 3300053085 Bacteria 1223
453 Ga0495619_0467689 3300053085 Unclassified 868
454 Ga0500566_0003427 3300053094 Bacteria 9458
455 Ga0500616_0015395 3300053153 Bacteria 4374
456 Ga0501082_0083778 3300060353 Bacteria 2751
457 Ga0530510_0021690 3300061734 Bacteria 4570
458 Ga0395900_1501898
459 JGI24745J21846_1047664
460 JGI24748J21848_1004859
461 JGI24034J26672_10000242
462 JGI24034J26672_10108930
463 JGI24742J22300_10000304
464 Ga0070683_100001599
465 Ga0070683_100258940
466 Ga0070683_100302088
467 Ga0070690_101257664
468 Ga0070670_101211841
469 Ga0068869_100035879
470 Ga0070666_10372740
471 Ga0068868_100000537
472 Ga0068868_100002702
473 Ga0070660_100001486
474 Ga0070691_10072818
475 Ga0070687_101083867
476 Ga0070661_100000031
477 Ga0070661_100209368
478 Ga0070668_100340057
479 Ga0070675_100799509
480 Ga0070659_100030321
481 Ga0070659_100184354
482 Ga0070667_100310123
483 Ga0070667_100931006
484 Ga0070703_10158240
485 Ga0070714_100027543
486 Ga0070714_100457491
487 Ga0070714_101473424
488 Ga0070713_100184841
489 Ga0070713_101074037
490 Ga0070710_10548766
491 Ga0070710_10744039
492 Ga0070711_100374170
493 Ga0070711_100660023
494 Ga0070711_101030009
495 Ga0070711_101385216
496 Ga0070705_101159852
497 Ga0070700_100138702
498 Ga0070694_101908888
499 Ga0070678_100442650
500 Ga0070678_101665963
501 Ga0070662_100000079
502 Ga0070662_100047904
503 Ga0070681_10228147
504 Ga0068867_100311117
505 Ga0068867_101063318
506 Ga0070685_10171856
507 Ga0070679_100429660
508 Ga0070684_100055308
509 Ga0068853_100164783
510 Ga0070672_101712036
511 Ga0070686_100189026
512 Ga0070696_101287662
513 Ga0070693_100001830
514 Ga0070693_100480563
515 Ga0070665_100822414
516 Ga0070665_101094981
517 Ga0070704_100085825
518 Ga0068855_100012772
519 Ga0070664_100437926
520 Ga0070664_101264801
521 Ga0068854_100114507
522 Ga0068856_100000675
523 Ga0068856_100063460
524 Ga0070702_100076887
525 Ga0068859_100227600
526 Ga0068864_100282076
527 Ga0068866_11471809
528 Ga0068861_100336546
529 Ga0068851_10289907
530 Ga0068870_10015947
531 Ga0068858_100037064
532 Ga0068860_100880374
533 Ga0068860_102145445
534 Ga0070717_10046887
535 Ga0070717_10068694
536 Ga0070717_10581245
537 Ga0070716_100924498
538 Ga0070712_100392086
539 Ga0070712_100989246
540 Ga0070712_102011403
541 Ga0097621_100084066
542 Ga0068871_100095251
543 Ga0075430_100245712
544 Ga0075430_100776266
545 Ga0075431_100089064
546 Ga0075434_100020776
547 Ga0075429_100445508
548 Ga0068865_100280639
549 Ga0068865_100553313
550 Ga0097620_100227598
551 Ga0075435_100031092
552 Ga0105240_10207485
553 Ga0105245_10088666
554 Ga0105245_10449067
555 Ga0105247_10007153
556 Ga0114129_10125055
557 Ga0114129_11779552
558 Ga0105243_10209901
559 Ga0105243_10403318
560 Ga0105243_10455341
561 Ga0105241_10026636
562 Ga0105242_10751146
563 Ga0105242_11557345
564 Ga0105248_10250403
565 Ga0105248_11951588
566 Ga0105237_10197009
567 Ga0105238_10068456
568 Ga0105249_10395520
569 Ga0105249_13237978
570 Ga0105239_10023158
571 Ga0105246_10702825
572 Ga0105246_11658082
573 Ga0157329_1012188
574 Ga0157370_10002526
575 Ga0157369_10208060
576 Ga0157374_10680118
577 Ga0157378_10044897
578 Ga0157378_10131101
579 Ga0163162_10088796
580 Ga0163162_11982892
581 Ga0157372_10511008
582 Ga0157375_10107304
583 Ga0157375_11077065
584 Ga0163163_10001862
585 Ga0157380_10072463
586 Ga0157377_10039481
587 Ga0157377_10279395
588 Ga0157377_10363799
589 Ga0157379_10126705
590 Ga0157376_10942755
591 Ga0163161_10000140
592 Ga0163161_11849435
593 Ga0163161_12048010
594 Ga0207692_10133613
595 Ga0207692_10191661
596 Ga0207692_10747196
597 Ga0207642_11023035
598 Ga0207710_10204251
599 Ga0207688_10009713
600 Ga0207688_10064648
601 Ga0207688_10423702
602 Ga0207645_10187910
603 Ga0207645_10248664
604 Ga0207643_10019501
605 Ga0207705_10216254
606 Ga0207654_10251569
607 Ga0207695_10416211
608 Ga0207671_10089029
609 Ga0207693_11341403
610 Ga0207663_10090192
611 Ga0207663_10249903
612 Ga0207663_10562099
613 Ga0207660_10620305
614 Ga0207662_10606102
615 Ga0207657_10015622
616 Ga0207649_10000021
617 Ga0207652_10949385
618 Ga0207646_11904918
619 Ga0207694_10040867
620 Ga0207650_10184643
621 Ga0207650_11554645
622 Ga0207659_10126947
623 Ga0207687_10002256
624 Ga0207687_10890828
625 Ga0207700_12000839
626 Ga0207664_10068303
627 Ga0207664_10265748
628 Ga0207664_10321311
629 Ga0207664_11953456
630 Ga0207690_10087119
631 Ga0207690_10230214
632 Ga0207706_10000302
633 Ga0207706_10024370
634 Ga0207706_11430699
635 Ga0207709_10401466
636 Ga0207709_10624356
637 Ga0207669_10353736
638 Ga0207669_10432744
639 Ga0207704_10252855
640 Ga0207665_10008999
641 Ga0207665_10375603
642 Ga0207665_10520807
643 Ga0207691_10218373
644 Ga0207711_10140263
645 Ga0207711_11104190
646 Ga0207689_10037631
647 Ga0207661_10000772
648 Ga0207661_10296133
649 Ga0207661_10515406
650 Ga0207661_10859345
651 Ga0207679_11085031
652 Ga0207679_11936186
653 Ga0207667_10143816
654 Ga0207712_10280709
655 Ga0207712_11011063
656 Ga0207640_10033994
657 Ga0207640_10095418
658 Ga0207640_10533685
659 Ga0207658_10281480
660 Ga0207658_11073779
661 Ga0207677_10000426
662 Ga0207677_10010418
663 Ga0207703_10009810
664 Ga0207639_10034322
665 Ga0207639_10197158
666 Ga0207678_10203284
667 Ga0207708_10002697
668 Ga0207708_10027112
669 Ga0207702_10005392
670 Ga0207702_10046256
671 Ga0207641_10938437
672 Ga0207648_10601549
673 Ga0207676_10566661
674 Ga0207674_10273655
675 Ga0207675_100289637
676 Ga0207683_10433949
677 Ga0207683_11141281
678 Ga0207698_10472722
679 Ga0268266_10509876
680 Ga0268264_10720141
681 Ga0373934_0109498
682 Ga0373944_0137546
683 Ga0373923_0114535
684 Ga0373936_0010004
685 Ga0373945_0287782
686 Ga0373953_0222042
687 Ga0373953_0409477
688 Ga0373956_0198844
689 Ga0373957_0394369
690 Ga0373943_0035074
691 Ga0373943_0123984
692 Ga0373946_0007759
693 Ga0373955_0386968
694 Ga0373924_0335828
695 Ga0373935_0154352
696 Ga0373935_0302448
697 Ga0373935_0870430
698 Ga0373927_0228023
699 Ga0373927_0904032
700 Ga0373933_0334370
701 Ga0373947_0049769
702 Ga0373947_0680923
703 Ga0373937_0033806
704 Ga0373937_0217479
705 Ga0373937_1994223
706 Ga0373925_0071905
707 Ga0395899_0303934
708 Ga0395898_0290412
709 Ga0395898_1302082
710 Ga0395898_1838505
711 Ga0395905_0721915
712 Ga0395901_1029959
713 Ga0451789_0748575
714 Ga0451802_1817718
715 Ga0451807_0841566
716 Ga0451807_1234653
717 Ga0451839_1519767
718 Ga0451845_0694484
719 Ga0451849_0226317
720 Ga0451851_0714749
721 Ga0466963_0000002
722 Ga0466967_2506489
723 Ga0495592_0000401
724 Ga0495603_0001815
725 Ga0495603_0045943
726 Ga0495603_0339588
727 Ga0495629_0106248
728 Ga0495629_0194122
729 Ga0495641_0011011
730 Ga0495641_0093921
731 Ga0495651_0279651
732 Ga0495653_0013154
733 Ga0495653_0374997
734 Ga0495580_0350121
735 Ga0495580_0493167
736 Ga0495582_0000968
737 Ga0495582_0082860
738 Ga0495662_0019225
739 Ga0495662_0114955
740 Ga0495664_0165376
741 Ga0495664_0338463
742 Ga0495594_0123371
743 Ga0495606_0000082
744 Ga0495608_0544151
745 Ga0495608_0836955
746 Ga0495618_0095749
747 Ga0495628_0003968
748 Ga0495628_0214222
749 Ga0495630_0000007
750 Ga0495630_0065775
751 Ga0495630_0083119
752 Ga0495630_0197147
753 Ga0495637_0211110
754 Ga0495644_0003290
755 Ga0495666_0243447
756 Ga0495652_0293288
757 Ga0495665_0006548
758 Ga0495640_0011814
759 Ga0495640_0293486
760 Ga0495586_0018068
761 Ga0495586_0094140
762 Ga0495586_0611379
763 Ga0495587_0175350
764 Ga0495587_0222231
765 Ga0495667_0000020
766 Ga0495667_0016621
767 Ga0495667_0146162
768 Ga0495656_0000601
769 Ga0495634_0004700
770 Ga0495634_0028709
771 Ga0495634_0034476
772 Ga0495634_0321697
773 Ga0495635_0000006
774 Ga0495635_0674499
775 Ga0495588_0023499
776 Ga0495657_0463511
777 Ga0495599_0030624
778 Ga0495623_0026372
779 Ga0495623_0497570
780 Ga0495646_0263638
781 Ga0495646_0359706
782 Ga0495646_0361834
783 Ga0495646_0486568
784 Ga0495647_0003736
785 Ga0495647_0007927
786 Ga0495647_0256584
787 Ga0495647_0357904
788 Ga0495658_0027322
789 Ga0495658_0646597
790 Ga0495669_0003450
791 Ga0495613_0116293
792 Ga0495613_0198957
793 Ga0495613_0892366
794 Ga0495613_0939050
795 Ga0495624_0071020
796 Ga0495624_0162491
797 Ga0495600_0406462
798 Ga0495600_0666153
799 Ga0495581_0090440
800 Ga0495581_0189373
801 Ga0495604_0042642
802 Ga0495674_0031008
803 Ga0495674_0207179
804 Ga0495674_0898367
805 Ga0495676_0003199
806 Ga0495676_0018049
807 Ga0495676_0056755
808 Ga0495676_0403007
809 Ga0495680_0002541
810 Ga0495680_0078421
811 Ga0495680_0145589
812 Ga0495680_0224799
813 Ga0495680_0278919
814 Ga0495680_0293820
815 Ga0495675_0114367
816 Ga0495684_0095933
817 Ga0495684_0649519
818 Ga0495593_0117212
819 Ga0495602_0085407
820 Ga0495602_0467596
821 Ga0495614_0276404
822 Ga0496100_0000008
823 Ga0496100_0017726
824 Ga0496100_0041302
825 Ga0496100_0061730
826 Ga0496101_0000016
827 Ga0496101_0088907
828 Ga0496101_0199733
829 Ga0496101_0289358
830 Ga0496101_0420612
831 Ga0496101_0788366
832 Ga0496102_0013688
833 Ga0496102_0208094
834 Ga0496102_0853796
835 Ga0496102_0983603
836 Ga0496103_0011325
837 Ga0496103_0034702
838 Ga0496104_0099056
839 Ga0496104_0574282
840 Ga0496104_1503050
841 Ga0496104_1807947
842 Ga0496105_0012466
843 Ga0496105_0306005
844 Ga0496105_0354080
845 Ga0496106_0000117
846 Ga0496106_0011766
847 Ga0496107_0000009
848 Ga0496107_0030781
849 Ga0496107_0061211
850 Ga0496108_0032738
851 Ga0496108_0049876
852 Ga0496108_0274078
853 Ga0496108_0659097
854 Ga0496109_0182995
855 Ga0496109_0553177
856 Ga0496109_1828629
857 Ga0496110_0011462
858 Ga0496110_0018623
859 Ga0496110_0539304
860 Ga0496110_1067991
861 Ga0496111_0001707
862 Ga0496111_0032286
863 Ga0496112_0000191
864 Ga0496112_0160254
865 Ga0496112_0309962
866 Ga0496113_0018470
867 Ga0496113_0020059
868 Ga0496113_0027240
869 Ga0496113_0261224
870 Ga0496113_0497198
871 Ga0496113_0997118
872 Ga0496114_0058364
873 Ga0496114_0268687
874 Ga0496114_1018857
875 Ga0496114_1282392
876 Ga0496115_0005794
877 Ga0496115_0039265
878 Ga0501032_0335359
879 Ga0501039_0262725
880 Ga0501042_0117358
881 Ga0501048_0118710
882 Ga0501068_0744525
883 Ga0501071_0623390
884 Ga0501072_0157311
885 Ga0501075_0087302
886 Ga0501076_0082885
887 Ga0501045_0394268
888 nmdc:mga05p37_360240_c1
889 nmdc:mga09592_473210_c1
890 nmdc:mga0qj67_366517_c1
891 nmdc:mga06r32_82109_c1
892 nmdc:mga08y16_1075208_c1
893 nmdc:mga0n895_18977_c1
894 nmdc:mga0rr50_5913_c1
895 nmdc:mga08x19_107306_c1
896 nmdc:mga0a205_273157_c1
897 nmdc:mga0a205_4680_c1
898 Ga0495601_0019676
899 Ga0495601_0248697
900 Ga0495601_0586329
901 Ga0495601_0991652
902 Ga0495612_0035867
903 Ga0495612_0327326
904 Ga0495595_0000181
905 Ga0495595_0060083
906 Ga0495595_0646142
907 Ga0495595_0699277
908 Ga0495619_0207815
909 Ga0495619_0252165
910 Ga0495619_0467689
911 Ga0500566_0003427
912 Ga0500616_0015395
913 Ga0501082_0083778
914 Ga0530510_0021690

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

20

80

0.89

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

16

81

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
7tbs-assembly1.cif.gz_A crystal structure of the glutaredoxin 2 from francisella tularensis 0.8497 2 82
1n2a-assembly1.cif.gz_B crystal structure of a bacterial glutathione transferase from escherichia coli with glutathione sulfonate in the active site 0.8462 4 82
2x64-assembly2.cif.gz_A glutathione-s-transferase from xylella fastidiosa 0.8309 3 78
4gf0-assembly1.cif.gz_A crystal structure of glutahtione transferase homolog from sulfitobacter, target efi-501084, with bound glutathione 0.8168 2 82
2c3n-assembly2.cif.gz_D human glutathione-s-transferase t1-1, apo form 0.8067 2 82
ID Description Score Start End Superfamily
1n2aB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8565 4 82 3.40.30.10
4gf0B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8384 4 82 3.40.30.10
af_B6U5S1_5_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8335 3 82 3.40.30.10
2x64A01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8309 3 78 3.40.30.10
af_Q4CZ29_2_81_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.828 1 86 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A538DXK3-F1-model_v4 GST N-terminal domain-containing protein 0.9303 1 83
AF-A0A538HJJ6-F1-model_v4 GST N-terminal domain-containing protein 0.9153 1 74
AF-A0A2W5Y4H6-F1-model_v4 Glutaredoxin 0.8984 1 83
AF-A0A538GGU2-F1-model_v4 GST N-terminal domain-containing protein 0.8941 1 83
AF-A0A6I2XWR7-F1-model_v4 NrdH-redoxin 0.8925 2 82

Map