F448024

General Info

Members Datasets Scaffolds Average Seq Length
457 265 914 246

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_1040604|Ga0436364_1040604_52847_53683
Length 278
Sequence MIAFANPAAQRSRRIAPRSALKQAIFSPRGRPMIEQTVDVATKDGAMETFLCHPERGGPFPPVLLLMDAPGVREELRDMARRLGTVGYYVLLPNLYYRAGRDTIYGPEVLEHGSAEHARMRAVRTKMTIPPVMDDIAAMLAFLESQPRAKQGPVGAHGYCMSGPYALAAAARFPERVAAAASFYGTWLVSEAEESPHLTLGRVKGELYIACAEHDDLAPLPMVEELRRLFEAAGSPGEIELYPAVHHGFAFPQRWCYDKPAAERHWERLIALYRRRLG

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
92 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
93 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
140 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
148 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
149 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
152 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
153 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
154 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
155 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
156 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
157 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
158 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
159 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
160 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
161 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
165 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
166 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
167 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
168 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
169 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
186 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
189 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
202 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
203 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
204 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
209 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
210 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
211 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
226 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
235 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
236 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
240 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
241 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
242 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
243 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
244 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
251 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
254 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
258 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
259 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
260 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
264 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
265 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.56
Metatranscriptomes 0
Isolates 0.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.63
Nodule 0
Rhizoplane 3.06
Rhizosphere 82.71
Stem 0
Stem Tuber 0
Unclassified 4.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_1040604 3300037853 Bacteria 60326
2 LJNas_1004300 3300000546 Bacteria 1583
3 JGI25153J46596_10017794 3300003215 Bacteria 2785
4 JGI25404J52841_10008922 3300003659 Bacteria 2141
5 Ga0055530_10000413 3300003791 Bacteria 38081
6 Ga0055531_10003653 3300003794 Bacteria 9700
7 Ga0065165_1000041 3300005262 Bacteria 203876
8 Ga0070658_10000819 3300005327 Bacteria 26592
9 Ga0070658_10048121 3300005327 Bacteria 3451
10 Ga0070658_10086990 3300005327 Bacteria 2571
11 Ga0070683_100078878 3300005329 Bacteria 3081
12 Ga0070680_100001453 3300005336 Bacteria 17175
13 Ga0070680_100003189 3300005336 Bacteria 12188
14 Ga0068868_100793581 3300005338 Bacteria 854
15 Ga0070660_100017854 3300005339 Bacteria 5175
16 Ga0070660_100061287 3300005339 Bacteria 2921
17 Ga0070660_100288194 3300005339 Bacteria 1344
18 Ga0070660_100313115 3300005339 Bacteria 1288
19 Ga0070689_100084422 3300005340 Bacteria 2496
20 Ga0070691_10008441 3300005341 Bacteria 4714
21 Ga0070661_100035754 3300005344 Bacteria 3609
22 Ga0070668_100409434 3300005347 Unclassified 1159
23 Ga0070675_100053163 3300005354 Bacteria 3330
24 Ga0070671_100416138 3300005355 Bacteria 1151
25 Ga0070659_100000056 3300005366 Bacteria 88478
26 Ga0070659_100000991 3300005366 Bacteria 20852
27 Ga0070714_100067316 3300005435 Bacteria 3087
28 Ga0070714_100223739 3300005435 Bacteria 1731
29 Ga0070714_100287826 3300005435 Bacteria 1528
30 Ga0070713_100053207 3300005436 Bacteria 3354
31 Ga0070713_100216365 3300005436 Unclassified 1737
32 Ga0070713_100529278 3300005436 Bacteria 1114
33 Ga0070710_10031294 3300005437 Bacteria 2871
34 Ga0070710_10168415 3300005437 Bacteria 1363
35 Ga0070701_10199153 3300005438 Bacteria 1183
36 Ga0070700_100021533 3300005441 Bacteria 3748
37 Ga0070708_100415673 3300005445 Bacteria 1268
38 Ga0070708_100619371 3300005445 Bacteria 1020
39 Ga0070681_10000334 3300005458 Bacteria 38316
40 Ga0070681_10004811 3300005458 Bacteria 12941
41 Ga0070706_100037665 3300005467 Bacteria 4466
42 Ga0070706_100132424 3300005467 Bacteria 2327
43 Ga0070707_100177667 3300005468 Bacteria 2075
44 Ga0070698_100000271 3300005471 Bacteria 52585
45 Ga0070698_100006786 3300005471 Bacteria 12409
46 Ga0070698_100305841 3300005471 Bacteria 1520
47 Ga0070699_100029298 3300005518 Bacteria 4746
48 Ga0070699_100317043 3300005518 Bacteria 1401
49 Ga0070679_100005911 3300005530 Bacteria 11370
50 Ga0070679_100031117 3300005530 Bacteria 5271
51 Ga0070679_100033006 3300005530 Bacteria 5123
52 Ga0070679_100432024 3300005530 Bacteria 1262
53 Ga0070684_100059494 3300005535 Bacteria 3340
54 Ga0070697_100164162 3300005536 Unclassified 1877
55 Ga0070697_100176064 3300005536 Bacteria 1812
56 Ga0070697_100211624 3300005536 Bacteria 1651
57 Ga0068853_100002861 3300005539 Bacteria 13091
58 Ga0068853_100560757 3300005539 Bacteria 1083
59 Ga0068853_100594245 3300005539 Bacteria 1051
60 Ga0070672_100659925 3300005543 Bacteria 914
61 Ga0070686_100166117 3300005544 Bacteria 1557
62 Ga0070696_100222026 3300005546 Bacteria 1418
63 Ga0070665_100000015 3300005548 Bacteria 462744
64 Ga0070665_100226975 3300005548 Bacteria 1867
65 Ga0070704_100395703 3300005549 Bacteria 1178
66 Ga0068855_100024352 3300005563 Bacteria 7244
67 Ga0068857_100202433 3300005577 Bacteria 1810
68 Ga0068857_100216890 3300005577 Bacteria 1747
69 Ga0068854_100367051 3300005578 Bacteria 1182
70 Ga0068856_100048646 3300005614 Bacteria 4179
71 Ga0068856_100311792 3300005614 Bacteria 1591
72 Ga0068859_100778343 3300005617 Bacteria 1045
73 Ga0068864_100390514 3300005618 Bacteria 1321
74 Ga0068861_100035617 3300005719 Bacteria 3688
75 Ga0068863_100144283 3300005841 Bacteria 2277
76 Ga0068860_100058040 3300005843 Bacteria 3679
77 Ga0081455_10000014 3300005937 Bacteria 193884
78 Ga0081455_10000562 3300005937 Bacteria 48394
79 Ga0081455_10062061 3300005937 Bacteria 3143
80 Ga0081540_1000035 3300005983 Bacteria 141244
81 Ga0081540_1006071 3300005983 Bacteria 8882
82 Ga0081540_1014691 3300005983 Bacteria 5001
83 Ga0081539_10018779 3300005985 Bacteria 4772
84 Ga0070717_10054899 3300006028 Bacteria 3286
85 Ga0070717_10097057 3300006028 Bacteria 2497
86 Ga0070717_10102645 3300006028 Bacteria 2430
87 Ga0075365_10024882 3300006038 Bacteria 3784
88 Ga0075432_10087689 3300006058 Bacteria 1136
89 Ga0070716_100670019 3300006173 Unclassified 789
90 Ga0070712_100098534 3300006175 Unclassified 2156
91 Ga0070712_100121675 3300006175 Unclassified 1964
92 Ga0070712_100136577 3300006175 Bacteria 1865
93 Ga0070712_100276826 3300006175 Unclassified 1350
94 Ga0075362_10002226 3300006177 Bacteria 6448
95 Ga0075362_10010939 3300006177 Bacteria 3561
96 Ga0075362_10135152 3300006177 Bacteria 1175
97 Ga0075362_10260200 3300006177 Bacteria 855
98 Ga0075367_10011310 3300006178 Bacteria 4716
99 Ga0075367_10024627 3300006178 Bacteria 3395
100 Ga0075367_10044061 3300006178 Bacteria 2614
101 Ga0075367_10116508 3300006178 Bacteria 1643
102 Ga0075369_10014051 3300006186 Bacteria 3192
103 Ga0075369_10155508 3300006186 Bacteria 1047
104 Ga0075366_10006657 3300006195 Bacteria 6340
105 Ga0075366_10122438 3300006195 Bacteria 1568
106 Ga0097621_100433902 3300006237 Bacteria 1181
107 Ga0075428_100055091 3300006844 Bacteria 4358
108 Ga0075428_100055094 3300006844 Bacteria 4358
109 Ga0075428_100067736 3300006844 Bacteria 3907
110 Ga0075430_100076521 3300006846 Bacteria 2805
111 Ga0075430_100090429 3300006846 Bacteria 2560
112 Ga0075430_100183699 3300006846 Bacteria 1739
113 Ga0075430_100649898 3300006846 Bacteria 870
114 Ga0075431_100004759 3300006847 Bacteria 13347
115 Ga0075431_100013649 3300006847 Bacteria 8210
116 Ga0075431_100100983 3300006847 Bacteria 2977
117 Ga0075433_10297688 3300006852 Bacteria 1429
118 Ga0075434_100002404 3300006871 Bacteria 16437
119 Ga0075434_100086239 3300006871 Bacteria 3140
120 Ga0075434_100297985 3300006871 Bacteria 1633
121 Ga0075434_100658795 3300006871 Bacteria 1065
122 Ga0075429_100043138 3300006880 Unclassified 3924
123 Ga0075429_100404500 3300006880 Bacteria 1195
124 Ga0097620_100778363 3300006931 Bacteria 1045
125 Ga0099794_10030471 3300007265 Bacteria 2520
126 Ga0105240_10004565 3300009093 Bacteria 21001
127 Ga0105240_10383978 3300009093 Bacteria 1585
128 Ga0111539_10054508 3300009094 Bacteria 4758
129 Ga0111539_10077258 3300009094 Bacteria 3919
130 Ga0111539_10208948 3300009094 Bacteria 2274
131 Ga0111539_10277642 3300009094 Bacteria 1950
132 Ga0105245_10616421 3300009098 Bacteria 1113
133 Ga0114129_10008235 3300009147 Bacteria 14864
134 Ga0114129_10082669 3300009147 Bacteria 4462
135 Ga0114129_10144803 3300009147 Unclassified 3255
136 Ga0114129_10203270 3300009147 Unclassified 2682
137 Ga0114129_11008117 3300009147 Bacteria 1048
138 Ga0105242_10462277 3300009176 Bacteria 1199
139 Ga0105248_11256892 3300009177 Bacteria 837
140 Ga0105238_10037228 3300009551 Bacteria 4947
141 Ga0105238_10376245 3300009551 Bacteria 1411
142 Ga0105249_10559484 3300009553 Bacteria 1195
143 Ga0099796_10047661 3300010159 Bacteria 1475
144 Ga0099796_10098179 3300010159 Unclassified 1098
145 Ga0099796_10109531 3300010159 Bacteria 1049
146 Ga0105239_10108549 3300010375 Bacteria 3075
147 Ga0105239_10435484 3300010375 Bacteria 1486
148 Ga0105246_10354403 3300011119 Bacteria 1203
149 Ga0157370_10121124 3300013104 Bacteria 2442
150 Ga0157370_10151649 3300013104 Bacteria 2157
151 Ga0157370_10312168 3300013104 Bacteria 1451
152 Ga0157369_10408661 3300013105 Bacteria 1408
153 Ga0157369_10510915 3300013105 Bacteria 1243
154 Ga0157378_10433660 3300013297 Bacteria 1301
155 Ga0163162_10195088 3300013306 Bacteria 2153
156 Ga0157372_10056431 3300013307 Bacteria 4388
157 Ga0157372_10141503 3300013307 Bacteria 2772
158 Ga0157375_10467662 3300013308 Bacteria 1426
159 Ga0163163_10011881 3300014325 Bacteria 7919
160 Ga0163163_10651309 3300014325 Bacteria 1117
161 Ga0157380_10306089 3300014326 Bacteria 1466
162 Ga0182008_10048347 3300014497 Bacteria 2112
163 Ga0157379_10139187 3300014968 Bacteria 2188
164 Ga0213876_10099392 3300021384 Bacteria 1542
165 Ga0213876_10137361 3300021384 Bacteria 1300
166 Ga0213875_10000007 3300021388 Bacteria 562717
167 Ga0213875_10000480 3300021388 Bacteria 34004
168 Ga0213875_10004720 3300021388 Bacteria 7419
169 Ga0213871_10001206 3300021441 Bacteria 4179
170 Ga0209758_1000541 3300025297 Bacteria 59943
171 Ga0209050_1000034 3300025298 Bacteria 433906
172 Ga0207426_1010890 3300025302 Bacteria 3499
173 Ga0207426_1015066 3300025302 Bacteria 2816
174 Ga0209257_1000052 3300025304 Bacteria 430947
175 Ga0207692_10045964 3300025898 Bacteria 2187
176 Ga0207692_10264477 3300025898 Bacteria 1035
177 Ga0207680_10166655 3300025903 Bacteria 1481
178 Ga0207647_10122116 3300025904 Bacteria 1535
179 Ga0207685_10249882 3300025905 Bacteria 857
180 Ga0207699_10110498 3300025906 Bacteria 1761
181 Ga0207705_10000362 3300025909 Bacteria 41196
182 Ga0207684_10060909 3300025910 Bacteria 3205
183 Ga0207684_10133525 3300025910 Bacteria 2131
184 Ga0207684_10138987 3300025910 Bacteria 2087
185 Ga0207684_10252119 3300025910 Bacteria 1523
186 Ga0207654_10209974 3300025911 Bacteria 1286
187 Ga0207707_10039573 3300025912 Bacteria 4120
188 Ga0207707_10091781 3300025912 Bacteria 2654
189 Ga0207707_10149642 3300025912 Bacteria 2041
190 Ga0207707_10481189 3300025912 Bacteria 1060
191 Ga0207695_10133228 3300025913 Bacteria 2441
192 Ga0207695_10237209 3300025913 Bacteria 1726
193 Ga0207695_10281178 3300025913 Bacteria 1558
194 Ga0207671_10274728 3300025914 Bacteria 1328
195 Ga0207693_10067704 3300025915 Unclassified 2796
196 Ga0207693_10076106 3300025915 Bacteria 2628
197 Ga0207693_10094240 3300025915 Unclassified 2347
198 Ga0207693_10113734 3300025915 Bacteria 2123
199 Ga0207693_10191339 3300025915 Bacteria 1610
200 Ga0207660_10004283 3300025917 Bacteria 9305
201 Ga0207660_10202982 3300025917 Bacteria 1549
202 Ga0207657_10000906 3300025919 Bacteria 31293
203 Ga0207657_10006424 3300025919 Bacteria 12192
204 Ga0207657_10139514 3300025919 Bacteria 1981
205 Ga0207652_10001016 3300025921 Bacteria 25826
206 Ga0207652_10045804 3300025921 Bacteria 3729
207 Ga0207652_10084118 3300025921 Bacteria 2787
208 Ga0207652_10172168 3300025921 Bacteria 1943
209 Ga0207646_10342508 3300025922 Bacteria 1351
210 Ga0207694_10008354 3300025924 Bacteria 7825
211 Ga0207694_10121132 3300025924 Bacteria 2089
212 Ga0207659_10012688 3300025926 Bacteria 5375
213 Ga0207700_10004193 3300025928 Bacteria 8461
214 Ga0207700_10060495 3300025928 Bacteria 2869
215 Ga0207700_10091035 3300025928 Bacteria 2409
216 Ga0207700_10180799 3300025928 Unclassified 1766
217 Ga0207700_10746615 3300025928 Bacteria 874
218 Ga0207664_10023723 3300025929 Bacteria 4601
219 Ga0207664_10149484 3300025929 Bacteria 1983
220 Ga0207664_10164273 3300025929 Bacteria 1896
221 Ga0207644_10385925 3300025931 Bacteria 1143
222 Ga0207690_10000568 3300025932 Bacteria 24144
223 Ga0207690_10010975 3300025932 Bacteria 5402
224 Ga0207670_10025769 3300025936 Bacteria 3696
225 Ga0207670_10253043 3300025936 Bacteria 1362
226 Ga0207704_10306696 3300025938 Bacteria 1218
227 Ga0207665_10336412 3300025939 Bacteria 1136
228 Ga0207679_10442661 3300025945 Bacteria 1151
229 Ga0207667_10006735 3300025949 Bacteria 13874
230 Ga0207667_10129372 3300025949 Bacteria 2600
231 Ga0207667_10213893 3300025949 Bacteria 1976
232 Ga0207667_10226616 3300025949 Bacteria 1914
233 Ga0207651_10561670 3300025960 Bacteria 994
234 Ga0207668_10242116 3300025972 Bacteria 1460
235 Ga0207640_10308209 3300025981 Bacteria 1255
236 Ga0207639_10011330 3300026041 Bacteria 6189
237 Ga0207639_10281036 3300026041 Bacteria 1464
238 Ga0207708_10022249 3300026075 Bacteria 4786
239 Ga0207708_10142362 3300026075 Bacteria 1882
240 Ga0207702_10224643 3300026078 Bacteria 1751
241 Ga0207702_10381512 3300026078 Bacteria 1355
242 Ga0207676_10176451 3300026095 Bacteria 1867
243 Ga0207674_10149524 3300026116 Bacteria 2293
244 Ga0207675_100052107 3300026118 Bacteria 3819
245 Ga0207698_10225156 3300026142 Bacteria 1698
246 Ga0209971_1003333 3300027682 Bacteria 3815
247 Ga0265356_1000386 3300028017 Bacteria 7997
248 Ga0268266_10000005 3300028379 Bacteria 1448194
249 Ga0268266_10039872 3300028379 Bacteria 4002
250 Ga0268266_10154478 3300028379 Bacteria 2071
251 Ga0268264_10025183 3300028381 Bacteria 4861
252 Ga0268264_10399521 3300028381 Bacteria 1320
253 Ga0265334_10017782 3300028573 Bacteria 2933
254 Ga0307517_10001422 3300028786 Bacteria 40266
255 Ga0265338_10102823 3300028800 Unclassified 2322
256 Ga0265332_10122567 3300031238 Bacteria 1092
257 Ga0265325_10028832 3300031241 Bacteria 2988
258 Ga0265329_10087949 3300031242 Bacteria 985
259 Ga0265327_10000360 3300031251 Bacteria 86617
260 Ga0307513_10001510 3300031456 Bacteria 33405
261 Ga0307408_100084910 3300031548 Bacteria 2376
262 Ga0307514_10013409 3300031649 Bacteria 6803
263 Ga0316577_10068567 3300031733 Bacteria 1981
264 Ga0307412_10212267 3300031911 Bacteria 1478
265 Ga0307414_10104447 3300032004 Bacteria 2140
266 Ga0373950_0012305 3300034818 Bacteria 1411
267 Ga0373959_0005110 3300034820 Bacteria 2145
268 Ga0373938_0051271 3300034957 Bacteria 943
269 Ga0373938_0058187 3300034957 Unclassified 898
270 Ga0373926_0019950 3300035083 Bacteria 2313
271 Ga0373940_0043156 3300035088 Unclassified 1245
272 Ga0373944_0102681 3300035089 Bacteria 968
273 Ga0373949_0019478 3300035090 Bacteria 1546
274 Ga0373951_0025024 3300035091 Bacteria 1385
275 Ga0373952_0020955 3300035092 Bacteria 1375
276 Ga0373936_0127548 3300035113 Bacteria 1091
277 Ga0373939_0002868 3300035114 Bacteria 4052
278 Ga0373939_0008305 3300035114 Bacteria 2545
279 Ga0373941_0007109 3300035115 Bacteria 2726
280 Ga0373954_0236882 3300035118 Bacteria 898
281 Ga0373956_0020528 3300035119 Bacteria 2812
282 Ga0373960_0003948 3300035121 Bacteria 3382
283 Ga0373942_0045741 3300035207 Unclassified 1210
284 Ga0373961_0019541 3300035241 Bacteria 1781
285 Ga0373962_0034328 3300035242 Unclassified 1404
286 Ga0373924_0014012 3300035410 Bacteria 3023
287 Ga0373931_0000271 3300035691 Bacteria 21921
288 Ga0373931_0022099 3300035691 Bacteria 3198
289 Ga0373931_0062627 3300035691 Bacteria 2008
290 Ga0373931_0099214 3300035691 Bacteria 1636
291 Ga0373935_0051403 3300035692 Bacteria 2617
292 Ga0373935_0143985 3300035692 Bacteria 1612
293 Ga0373927_0227045 3300035695 Bacteria 1227
294 Ga0373927_0230167 3300035695 Bacteria 1218
295 Ga0373933_0401254 3300035724 Bacteria 894
296 Ga0373947_0019189 3300035725 Bacteria 3941
297 Ga0373947_0086793 3300035725 Bacteria 1946
298 Ga0373937_0003937 3300036401 Bacteria 12550
299 Ga0373937_0004915 3300036401 Bacteria 11364
300 Ga0373937_0045062 3300036401 Bacteria 4030
301 Ga0373937_0670309 3300036401 Bacteria 983
302 Ga0316584_0005986 3300036712 Bacteria 8216
303 Ga0373925_0012361 3300037068 Bacteria 6182
304 Ga0373925_0119971 3300037068 Bacteria 2041
305 Ga0373925_0554459 3300037068 Bacteria 945
306 Ga0395899_0025121 3300037312 Bacteria 4498
307 Ga0395899_0064061 3300037312 Bacteria 2703
308 Ga0395899_0092164 3300037312 Bacteria 2195
309 Ga0395899_0558787 3300037312 Bacteria 734
310 Ga0395900_0022094 3300037418 Bacteria 6508
311 Ga0395900_0071310 3300037418 Bacteria 3571
312 Ga0395898_0006041 3300037466 Bacteria 13000
313 Ga0395898_0154599 3300037466 Bacteria 2194
314 Ga0395905_0363997 3300037471 Unclassified 1339
315 Ga0436364_0010042 3300037853 Bacteria 102214
316 Ga0436364_0309649 3300037853 Bacteria 36034
317 Ga0436364_0575752 3300037853 Bacteria 2145
318 Ga0436364_1230704 3300037853 Bacteria 5244
319 Ga0436364_1280177 3300037853 Bacteria 3565
320 Ga0395901_0018343 3300038443 Bacteria 7144
321 Ga0395901_0040905 3300038443 Bacteria 4801
322 Ga0395901_0395470 3300038443 Bacteria 1420
323 Ga0436365_0887425 3300039437 Bacteria 963
324 Ga0436365_1411420 3300039437 Bacteria 4288
325 Ga0436360_0488995 3300039438 Bacteria 881
326 Ga0436360_0945100 3300039438 Bacteria 6705
327 Ga0436361_0124257 3300039447 Bacteria 4652
328 Ga0436361_1187303 3300039447 Bacteria 3445
329 Ga0436363_0489530 3300039450 Bacteria 814
330 Ga0436363_0789910 3300039450 Unclassified 1161
331 Ga0436362_0218822 3300039453 Bacteria 1902
332 Ga0436362_1180911 3300039453 Bacteria 1255
333 Ga0439460_0047039 3300042461 Bacteria 1283
334 Ga0451577_0288603 3300042876 Bacteria 1487
335 Ga0466963_0014048 3300044694 Bacteria 4932
336 Ga0466957_0078307 3300044842 Bacteria 2055
337 Ga0466967_0309120 3300045976 Bacteria 1522
338 Ga0495629_0211238 3300046459 Bacteria 1340
339 Ga0495651_0131142 3300046462 Bacteria 1829
340 Ga0495653_0242933 3300046463 Bacteria 1199
341 Ga0495664_0011336 3300046477 Bacteria 5024
342 Ga0495584_0062405 3300046491 Bacteria 1873
343 Ga0495628_0239601 3300046516 Bacteria 1357
344 Ga0495630_0307771 3300046517 Bacteria 1211
345 Ga0495652_0146426 3300046529 Bacteria 1851
346 Ga0495586_0081589 3300046535 Bacteria 1777
347 Ga0495587_0003442 3300046536 Bacteria 10559
348 Ga0495645_0034901 3300046543 Bacteria 3667
349 Ga0495667_0102533 3300046559 Bacteria 1850
350 Ga0495667_0349883 3300046559 Bacteria 933
351 Ga0495635_0053691 3300046663 Bacteria 2776
352 Ga0495657_0031836 3300046675 Bacteria 3684
353 Ga0495599_0011527 3300046678 Bacteria 5434
354 Ga0495646_0083715 3300046680 Bacteria 1853
355 Ga0495604_0113173 3300047317 Bacteria 1975
356 Ga0495674_0200284 3300047319 Bacteria 1657
357 Ga0495674_0298200 3300047319 Bacteria 1317
358 Ga0495675_0136660 3300047444 Bacteria 1521
359 Ga0495684_0018224 3300047471 Bacteria 5412
360 Ga0495684_0355740 3300047471 Bacteria 1038
361 Ga0495602_0004234 3300048088 Bacteria 14925
362 Ga0495602_0238042 3300048088 Bacteria 1363
363 Ga0495602_0325485 3300048088 Bacteria 1117
364 Ga0496104_0007199 3300048907 Bacteria 9809
365 Ga0496105_0051611 3300048908 Bacteria 3397
366 Ga0496108_0009412 3300048911 Bacteria 7910
367 Ga0496109_0005367 3300048912 Bacteria 10715
368 Ga0496110_0075973 3300048913 Bacteria 2986
369 Ga0496110_0090788 3300048913 Bacteria 2731
370 Ga0496111_0017923 3300048914 Bacteria 4897
371 Ga0496111_0511425 3300048914 Bacteria 883
372 Ga0496112_0001903 3300048915 Bacteria 16465
373 Ga0496112_0295854 3300048915 Bacteria 1565
374 Ga0496113_0024672 3300048916 Bacteria 4277
375 Ga0496114_0328825 3300048917 Bacteria 1351
376 Ga0496115_0005219 3300048918 Bacteria 9441
377 Ga0496115_0284810 3300048918 Bacteria 1356
378 Ga0496119_0060262 3300048922 Bacteria 2273
379 Ga0496120_0055299 3300048923 Bacteria 2245
380 Ga0501034_0005006 3300049571 Bacteria 14572
381 Ga0501034_0013938 3300049571 Bacteria 8276
382 Ga0501034_0046613 3300049571 Bacteria 4379
383 Ga0501034_0104821 3300049571 Bacteria 2821
384 Ga0501034_0274275 3300049571 Bacteria 1627
385 Ga0501034_0540968 3300049571 Bacteria 1075
386 Ga0501037_0091335 3300049573 Bacteria 2202
387 Ga0501038_0554174 3300049574 Bacteria 874
388 Ga0501043_0563658 3300049579 Bacteria 845
389 Ga0501046_0202009 3300049580 Bacteria 1479
390 Ga0501047_0062670 3300049581 Bacteria 3587
391 Ga0501047_0065746 3300049581 Bacteria 3495
392 Ga0501047_0420816 3300049581 Bacteria 1167
393 Ga0501048_0101428 3300049582 Bacteria 2031
394 Ga0501068_0006030 3300049584 Bacteria 6659
395 Ga0501071_0046171 3300049587 Bacteria 3129
396 Ga0501072_0184626 3300049588 Bacteria 1664
397 Ga0501083_0338953 3300049744 Bacteria 978
398 Ga0501044_0003113 3300049823 Bacteria 18797
399 Ga0501044_0056538 3300049823 Bacteria 4029
400 Ga0501044_0203158 3300049823 Bacteria 1939
401 nmdc:mga03683_130450_c1 3300050489 Bacteria 1124
402 nmdc:mga03683_3042_c1 3300050489 Bacteria 5317
403 nmdc:mga03683_33638_c1 3300050489 Bacteria 2070
404 nmdc:mga03683_527_c1 3300050489 Bacteria 5175
405 nmdc:mga03683_57814_c1 3300050489 Bacteria 1633
406 nmdc:mga03683_67280_c1 3300050489 Bacteria 1525
407 nmdc:mga00v17_433583_c1 3300050491 Bacteria 853
408 nmdc:mga00v17_76903_c1 3300050491 Bacteria 2077
409 nmdc:mga0yw44_108144_c1 3300050492 Bacteria 1779
410 nmdc:mga0yw44_392287_c1 3300050492 Bacteria 938
411 nmdc:mga0k408_6009_c1 3300050493 Bacteria 6478
412 nmdc:mga06z11_23752_c1 3300050494 Bacteria 2884
413 nmdc:mga06z11_25226_c1 3300050494 Bacteria 2815
414 nmdc:mga06z11_66330_c1 3300050494 Bacteria 1897
415 nmdc:mga07m45_1679_c1 3300050496 Bacteria 8400
416 nmdc:mga05p37_15470_c1 3300050507 Bacteria 9170
417 nmdc:mga05p37_5976_c1 3300050507 Bacteria 14325
418 nmdc:mga05p37_825846_c1 3300050507 Bacteria 1010
419 nmdc:mga09592_52160_c1 3300050508 Unclassified 3452
420 nmdc:mga0qj67_112677_c1 3300050509 Bacteria 2196
421 nmdc:mga0qj67_203894_c1 3300050509 Bacteria 1606
422 nmdc:mga0qj67_33656_c1 3300050509 Bacteria 3999
423 nmdc:mga0qj67_493042_c1 3300050509 Bacteria 985
424 nmdc:mga0qj67_586207_c1 3300050509 Bacteria 893
425 nmdc:mga06r32_18053_c1 3300050510 Bacteria 6451
426 nmdc:mga06r32_21130_c1 3300050510 Bacteria 6006
427 nmdc:mga08y16_108739_c1 3300050511 Bacteria 2887
428 nmdc:mga08y16_266393_c1 3300050511 Bacteria 1769
429 nmdc:mga08y16_279717_c1 3300050511 Bacteria 1721
430 nmdc:mga08y16_56182_c1 3300050511 Bacteria 4114
431 nmdc:mga08y16_737181_c1 3300050511 Bacteria 982
432 nmdc:mga0n895_172045_c1 3300050512 Bacteria 2198
433 nmdc:mga0n895_2115_c1 3300050512 Bacteria 15326
434 nmdc:mga0n895_474903_c1 3300050512 Bacteria 1261
435 nmdc:mga0n895_604682_c1 3300050512 Bacteria 1098
436 nmdc:mga0rr50_21522_c1 3300050513 Bacteria 4404
437 nmdc:mga0a205_212924_c1 3300050515 Bacteria 1820
438 nmdc:mga0a205_3719_c2 3300050515 Bacteria 8445
439 nmdc:mga0a205_504671_c1 3300050515 Bacteria 1066
440 nmdc:mga0sz30_5232_c1 3300050516 Bacteria 2838
441 nmdc:mga0sz30_5712_c1 3300050516 Bacteria 4137
442 Ga0495601_0023364 3300053077 Bacteria 3798
443 Ga0495595_0015409 3300053084 Bacteria 3261
444 Ga0495595_0034761 3300053084 Bacteria 2281
445 Ga0495619_0006325 3300053085 Bacteria 7512
446 Ga0495619_0030983 3300053085 Bacteria 3464
447 Ga0495619_0178118 3300053085 Bacteria 1471
448 Ga0500651_0038158 3300053093 Bacteria 3027
449 Ga0500641_0000784 3300053096 Bacteria 11491
450 Ga0500641_0011970 3300053096 Bacteria 3160
451 Ga0500562_001424 3300053108 Bacteria 5880
452 Ga0500616_0003033 3300053153 Bacteria 13228
453 Ga0501084_0374419 3300054114 Bacteria 1203
454 Ga0501082_0079794 3300060353 Bacteria 2824
455 Ga0530510_0091376 3300061734 Bacteria 2221
456 2644001231 2643221598 Bacteria 4578346
457 2883579327 2883577096 Bacteria 4709178
458 Ga0436364_1040604
459 LJNas_1004300
460 JGI25153J46596_10017794
461 JGI25404J52841_10008922
462 Ga0055530_10000413
463 Ga0055531_10003653
464 Ga0065165_1000041
465 Ga0070658_10000819
466 Ga0070658_10048121
467 Ga0070658_10086990
468 Ga0070683_100078878
469 Ga0070680_100001453
470 Ga0070680_100003189
471 Ga0068868_100793581
472 Ga0070660_100017854
473 Ga0070660_100061287
474 Ga0070660_100288194
475 Ga0070660_100313115
476 Ga0070689_100084422
477 Ga0070691_10008441
478 Ga0070661_100035754
479 Ga0070668_100409434
480 Ga0070675_100053163
481 Ga0070671_100416138
482 Ga0070659_100000056
483 Ga0070659_100000991
484 Ga0070714_100067316
485 Ga0070714_100223739
486 Ga0070714_100287826
487 Ga0070713_100053207
488 Ga0070713_100216365
489 Ga0070713_100529278
490 Ga0070710_10031294
491 Ga0070710_10168415
492 Ga0070701_10199153
493 Ga0070700_100021533
494 Ga0070708_100415673
495 Ga0070708_100619371
496 Ga0070681_10000334
497 Ga0070681_10004811
498 Ga0070706_100037665
499 Ga0070706_100132424
500 Ga0070707_100177667
501 Ga0070698_100000271
502 Ga0070698_100006786
503 Ga0070698_100305841
504 Ga0070699_100029298
505 Ga0070699_100317043
506 Ga0070679_100005911
507 Ga0070679_100031117
508 Ga0070679_100033006
509 Ga0070679_100432024
510 Ga0070684_100059494
511 Ga0070697_100164162
512 Ga0070697_100176064
513 Ga0070697_100211624
514 Ga0068853_100002861
515 Ga0068853_100560757
516 Ga0068853_100594245
517 Ga0070672_100659925
518 Ga0070686_100166117
519 Ga0070696_100222026
520 Ga0070665_100000015
521 Ga0070665_100226975
522 Ga0070704_100395703
523 Ga0068855_100024352
524 Ga0068857_100202433
525 Ga0068857_100216890
526 Ga0068854_100367051
527 Ga0068856_100048646
528 Ga0068856_100311792
529 Ga0068859_100778343
530 Ga0068864_100390514
531 Ga0068861_100035617
532 Ga0068863_100144283
533 Ga0068860_100058040
534 Ga0081455_10000014
535 Ga0081455_10000562
536 Ga0081455_10062061
537 Ga0081540_1000035
538 Ga0081540_1006071
539 Ga0081540_1014691
540 Ga0081539_10018779
541 Ga0070717_10054899
542 Ga0070717_10097057
543 Ga0070717_10102645
544 Ga0075365_10024882
545 Ga0075432_10087689
546 Ga0070716_100670019
547 Ga0070712_100098534
548 Ga0070712_100121675
549 Ga0070712_100136577
550 Ga0070712_100276826
551 Ga0075362_10002226
552 Ga0075362_10010939
553 Ga0075362_10135152
554 Ga0075362_10260200
555 Ga0075367_10011310
556 Ga0075367_10024627
557 Ga0075367_10044061
558 Ga0075367_10116508
559 Ga0075369_10014051
560 Ga0075369_10155508
561 Ga0075366_10006657
562 Ga0075366_10122438
563 Ga0097621_100433902
564 Ga0075428_100055091
565 Ga0075428_100055094
566 Ga0075428_100067736
567 Ga0075430_100076521
568 Ga0075430_100090429
569 Ga0075430_100183699
570 Ga0075430_100649898
571 Ga0075431_100004759
572 Ga0075431_100013649
573 Ga0075431_100100983
574 Ga0075433_10297688
575 Ga0075434_100002404
576 Ga0075434_100086239
577 Ga0075434_100297985
578 Ga0075434_100658795
579 Ga0075429_100043138
580 Ga0075429_100404500
581 Ga0097620_100778363
582 Ga0099794_10030471
583 Ga0105240_10004565
584 Ga0105240_10383978
585 Ga0111539_10054508
586 Ga0111539_10077258
587 Ga0111539_10208948
588 Ga0111539_10277642
589 Ga0105245_10616421
590 Ga0114129_10008235
591 Ga0114129_10082669
592 Ga0114129_10144803
593 Ga0114129_10203270
594 Ga0114129_11008117
595 Ga0105242_10462277
596 Ga0105248_11256892
597 Ga0105238_10037228
598 Ga0105238_10376245
599 Ga0105249_10559484
600 Ga0099796_10047661
601 Ga0099796_10098179
602 Ga0099796_10109531
603 Ga0105239_10108549
604 Ga0105239_10435484
605 Ga0105246_10354403
606 Ga0157370_10121124
607 Ga0157370_10151649
608 Ga0157370_10312168
609 Ga0157369_10408661
610 Ga0157369_10510915
611 Ga0157378_10433660
612 Ga0163162_10195088
613 Ga0157372_10056431
614 Ga0157372_10141503
615 Ga0157375_10467662
616 Ga0163163_10011881
617 Ga0163163_10651309
618 Ga0157380_10306089
619 Ga0182008_10048347
620 Ga0157379_10139187
621 Ga0213876_10099392
622 Ga0213876_10137361
623 Ga0213875_10000007
624 Ga0213875_10000480
625 Ga0213875_10004720
626 Ga0213871_10001206
627 Ga0209758_1000541
628 Ga0209050_1000034
629 Ga0207426_1010890
630 Ga0207426_1015066
631 Ga0209257_1000052
632 Ga0207692_10045964
633 Ga0207692_10264477
634 Ga0207680_10166655
635 Ga0207647_10122116
636 Ga0207685_10249882
637 Ga0207699_10110498
638 Ga0207705_10000362
639 Ga0207684_10060909
640 Ga0207684_10133525
641 Ga0207684_10138987
642 Ga0207684_10252119
643 Ga0207654_10209974
644 Ga0207707_10039573
645 Ga0207707_10091781
646 Ga0207707_10149642
647 Ga0207707_10481189
648 Ga0207695_10133228
649 Ga0207695_10237209
650 Ga0207695_10281178
651 Ga0207671_10274728
652 Ga0207693_10067704
653 Ga0207693_10076106
654 Ga0207693_10094240
655 Ga0207693_10113734
656 Ga0207693_10191339
657 Ga0207660_10004283
658 Ga0207660_10202982
659 Ga0207657_10000906
660 Ga0207657_10006424
661 Ga0207657_10139514
662 Ga0207652_10001016
663 Ga0207652_10045804
664 Ga0207652_10084118
665 Ga0207652_10172168
666 Ga0207646_10342508
667 Ga0207694_10008354
668 Ga0207694_10121132
669 Ga0207659_10012688
670 Ga0207700_10004193
671 Ga0207700_10060495
672 Ga0207700_10091035
673 Ga0207700_10180799
674 Ga0207700_10746615
675 Ga0207664_10023723
676 Ga0207664_10149484
677 Ga0207664_10164273
678 Ga0207644_10385925
679 Ga0207690_10000568
680 Ga0207690_10010975
681 Ga0207670_10025769
682 Ga0207670_10253043
683 Ga0207704_10306696
684 Ga0207665_10336412
685 Ga0207679_10442661
686 Ga0207667_10006735
687 Ga0207667_10129372
688 Ga0207667_10213893
689 Ga0207667_10226616
690 Ga0207651_10561670
691 Ga0207668_10242116
692 Ga0207640_10308209
693 Ga0207639_10011330
694 Ga0207639_10281036
695 Ga0207708_10022249
696 Ga0207708_10142362
697 Ga0207702_10224643
698 Ga0207702_10381512
699 Ga0207676_10176451
700 Ga0207674_10149524
701 Ga0207675_100052107
702 Ga0207698_10225156
703 Ga0209971_1003333
704 Ga0265356_1000386
705 Ga0268266_10000005
706 Ga0268266_10039872
707 Ga0268266_10154478
708 Ga0268264_10025183
709 Ga0268264_10399521
710 Ga0265334_10017782
711 Ga0307517_10001422
712 Ga0265338_10102823
713 Ga0265332_10122567
714 Ga0265325_10028832
715 Ga0265329_10087949
716 Ga0265327_10000360
717 Ga0307513_10001510
718 Ga0307408_100084910
719 Ga0307514_10013409
720 Ga0316577_10068567
721 Ga0307412_10212267
722 Ga0307414_10104447
723 Ga0373950_0012305
724 Ga0373959_0005110
725 Ga0373938_0051271
726 Ga0373938_0058187
727 Ga0373926_0019950
728 Ga0373940_0043156
729 Ga0373944_0102681
730 Ga0373949_0019478
731 Ga0373951_0025024
732 Ga0373952_0020955
733 Ga0373936_0127548
734 Ga0373939_0002868
735 Ga0373939_0008305
736 Ga0373941_0007109
737 Ga0373954_0236882
738 Ga0373956_0020528
739 Ga0373960_0003948
740 Ga0373942_0045741
741 Ga0373961_0019541
742 Ga0373962_0034328
743 Ga0373924_0014012
744 Ga0373931_0000271
745 Ga0373931_0022099
746 Ga0373931_0062627
747 Ga0373931_0099214
748 Ga0373935_0051403
749 Ga0373935_0143985
750 Ga0373927_0227045
751 Ga0373927_0230167
752 Ga0373933_0401254
753 Ga0373947_0019189
754 Ga0373947_0086793
755 Ga0373937_0003937
756 Ga0373937_0004915
757 Ga0373937_0045062
758 Ga0373937_0670309
759 Ga0316584_0005986
760 Ga0373925_0012361
761 Ga0373925_0119971
762 Ga0373925_0554459
763 Ga0395899_0025121
764 Ga0395899_0064061
765 Ga0395899_0092164
766 Ga0395899_0558787
767 Ga0395900_0022094
768 Ga0395900_0071310
769 Ga0395898_0006041
770 Ga0395898_0154599
771 Ga0395905_0363997
772 Ga0436364_0010042
773 Ga0436364_0309649
774 Ga0436364_0575752
775 Ga0436364_1230704
776 Ga0436364_1280177
777 Ga0395901_0018343
778 Ga0395901_0040905
779 Ga0395901_0395470
780 Ga0436365_0887425
781 Ga0436365_1411420
782 Ga0436360_0488995
783 Ga0436360_0945100
784 Ga0436361_0124257
785 Ga0436361_1187303
786 Ga0436363_0489530
787 Ga0436363_0789910
788 Ga0436362_0218822
789 Ga0436362_1180911
790 Ga0439460_0047039
791 Ga0451577_0288603
792 Ga0466963_0014048
793 Ga0466957_0078307
794 Ga0466967_0309120
795 Ga0495629_0211238
796 Ga0495651_0131142
797 Ga0495653_0242933
798 Ga0495664_0011336
799 Ga0495584_0062405
800 Ga0495628_0239601
801 Ga0495630_0307771
802 Ga0495652_0146426
803 Ga0495586_0081589
804 Ga0495587_0003442
805 Ga0495645_0034901
806 Ga0495667_0102533
807 Ga0495667_0349883
808 Ga0495635_0053691
809 Ga0495657_0031836
810 Ga0495599_0011527
811 Ga0495646_0083715
812 Ga0495604_0113173
813 Ga0495674_0200284
814 Ga0495674_0298200
815 Ga0495675_0136660
816 Ga0495684_0018224
817 Ga0495684_0355740
818 Ga0495602_0004234
819 Ga0495602_0238042
820 Ga0495602_0325485
821 Ga0496104_0007199
822 Ga0496105_0051611
823 Ga0496108_0009412
824 Ga0496109_0005367
825 Ga0496110_0075973
826 Ga0496110_0090788
827 Ga0496111_0017923
828 Ga0496111_0511425
829 Ga0496112_0001903
830 Ga0496112_0295854
831 Ga0496113_0024672
832 Ga0496114_0328825
833 Ga0496115_0005219
834 Ga0496115_0284810
835 Ga0496119_0060262
836 Ga0496120_0055299
837 Ga0501034_0005006
838 Ga0501034_0013938
839 Ga0501034_0046613
840 Ga0501034_0104821
841 Ga0501034_0274275
842 Ga0501034_0540968
843 Ga0501037_0091335
844 Ga0501038_0554174
845 Ga0501043_0563658
846 Ga0501046_0202009
847 Ga0501047_0062670
848 Ga0501047_0065746
849 Ga0501047_0420816
850 Ga0501048_0101428
851 Ga0501068_0006030
852 Ga0501071_0046171
853 Ga0501072_0184626
854 Ga0501083_0338953
855 Ga0501044_0003113
856 Ga0501044_0056538
857 Ga0501044_0203158
858 nmdc:mga03683_130450_c1
859 nmdc:mga03683_3042_c1
860 nmdc:mga03683_33638_c1
861 nmdc:mga03683_527_c1
862 nmdc:mga03683_57814_c1
863 nmdc:mga03683_67280_c1
864 nmdc:mga00v17_433583_c1
865 nmdc:mga00v17_76903_c1
866 nmdc:mga0yw44_108144_c1
867 nmdc:mga0yw44_392287_c1
868 nmdc:mga0k408_6009_c1
869 nmdc:mga06z11_23752_c1
870 nmdc:mga06z11_25226_c1
871 nmdc:mga06z11_66330_c1
872 nmdc:mga07m45_1679_c1
873 nmdc:mga05p37_15470_c1
874 nmdc:mga05p37_5976_c1
875 nmdc:mga05p37_825846_c1
876 nmdc:mga09592_52160_c1
877 nmdc:mga0qj67_112677_c1
878 nmdc:mga0qj67_203894_c1
879 nmdc:mga0qj67_33656_c1
880 nmdc:mga0qj67_493042_c1
881 nmdc:mga0qj67_586207_c1
882 nmdc:mga06r32_18053_c1
883 nmdc:mga06r32_21130_c1
884 nmdc:mga08y16_108739_c1
885 nmdc:mga08y16_266393_c1
886 nmdc:mga08y16_279717_c1
887 nmdc:mga08y16_56182_c1
888 nmdc:mga08y16_737181_c1
889 nmdc:mga0n895_172045_c1
890 nmdc:mga0n895_2115_c1
891 nmdc:mga0n895_474903_c1
892 nmdc:mga0n895_604682_c1
893 nmdc:mga0rr50_21522_c1
894 nmdc:mga0a205_212924_c1
895 nmdc:mga0a205_3719_c2
896 nmdc:mga0a205_504671_c1
897 nmdc:mga0sz30_5232_c1
898 nmdc:mga0sz30_5712_c1
899 Ga0495601_0023364
900 Ga0495595_0015409
901 Ga0495595_0034761
902 Ga0495619_0006325
903 Ga0495619_0030983
904 Ga0495619_0178118
905 Ga0500651_0038158
906 Ga0500641_0000784
907 Ga0500641_0011970
908 Ga0500562_001424
909 Ga0500616_0003033
910 Ga0501084_0374419
911 Ga0501082_0079794
912 Ga0530510_0091376
913 2644001231
914 2883579327

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

47

277

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zic-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s, r206a) mutant- 1.7 a 0.8962 1 242
4u2g-assembly1.cif.gz_A crystal structure of dienelactone hydrolase b-4 variant (q35h, f38l, y64h, q76l, q110l, c123s, y137c, a141v, y145c, n154d, e199g, s208g, g211d, s233g and 237q) at 1.80 a resolution 0.8939 1 242
1zix-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase mutant (e36d, r105h, c123s, g211d, k234n)- 1.8 a 0.8938 1 245
4u2f-assembly1.cif.gz_A crystal structure of dienelactone hydrolase b-1 variant (q35h, f38l, y64h, q110l, c123s, y137c, y145c, n154d, e199g, s208g and g211d) at 1.80 a resolution 0.8935 1 242
1zi9-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (e36d, c123s) mutant- 1.5 a 0.8933 1 242
ID Description Score Start End Superfamily
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.927 1 244 3.40.50.1820
af_Q54MZ9_1_255_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9198 1 244 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9005 1 241 3.40.50.1820
af_I6XF92_3_241_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8969 1 241 3.40.50.1820
1zi9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8933 1 242 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A0R3DNB0-F1-model_v4 deleted 0.9725 1 245
AF-A0A2E0N7Z6-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.9684 100 244 GO:0016787
AF-A0A0R3DNB0-F1-model_v4 deleted 0.9646 1 245
AF-A0A2D8YYX0-F1-model_v4 Hydrolase 0.9621 2 245 GO:0016787
AF-A0A2E5PLA0-F1-model_v4 Hydrolase 0.962 1 244 GO:0016787

Map